ADF-H domain-containing protein

Overview
NameADF-H domain-containing protein
Smed IDSMED30031764
Length (bp)586
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ADF-H domain-containing protein (SMED30031764) t-SNE clustered cells

Violin plots show distribution of expression levels for ADF-H domain-containing protein (SMED30031764) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ADF-H domain-containing protein (SMED30031764) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ADF-H domain-containing protein (SMED30031764) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031764

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30031764SMESG000022423.1 Contig1245GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30031764SMESG000022423.1 Contig1245GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
central nervous systemSMED30031764SMESG000022423.1 Contig1245GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30031764SMESG000022423.1 dd_Smed_v4_112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031764SMESG000022423.1 dd_Smed_v4_112_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031764SMESG000022423.1 dd_Smed_v6_112_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031764SMESG000022423.1 dd_Smed_v6_112_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 2 cellSMED30031764SMESG000022423.1 dd_Smed_v4_112_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ADF-H domain-containing protein vs. Ensembl Human
Match: CFL1 (cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874])

HSP 1 Score: 60.4622 bits (145), Expect = 3.598e-11
Identity = 46/155 (29.68%), Postives = 78/155 (50.32%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQH---------KFQYIIYGLNQQKDRII-----KLETGELG----TPYEVFRKHMIETYAKEGCYALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEK 463
            MASGV     V +  N +K++          + + +++ L++ K  II     ++  G++G     PY  F K + +   K+  YALYD         +  L FI W PE+  + S+MI A+SK  I  ++ G+K +++AN  +E+ D C + EK
Sbjct:    1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPD---KDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEK 152          
BLAST of ADF-H domain-containing protein vs. Ensembl Human
Match: CFL1 (cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874])

HSP 1 Score: 60.4622 bits (145), Expect = 4.209e-11
Identity = 47/155 (30.32%), Postives = 77/155 (49.68%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQH---------KFQYIIYGLNQQKDRIIKLE-----TGELG----TPYEVFRKHMIETYAKEGCYALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEK 463
            MASGV     V +  N +K++          + + +++ L++ K  II  E      G++G     PY  F K + +   K+  YALYD         +  L FI W PE+  + S+MI A+SK  I  ++ G+K +++AN  +E+ D C + EK
Sbjct:    1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPD---KDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEK 152          
BLAST of ADF-H domain-containing protein vs. Ensembl Human
Match: CFL1 (cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874])

HSP 1 Score: 60.4622 bits (145), Expect = 4.209e-11
Identity = 47/155 (30.32%), Postives = 77/155 (49.68%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQH---------KFQYIIYGLNQQKDRIIKLE-----TGELG----TPYEVFRKHMIETYAKEGCYALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEK 463
            MASGV     V +  N +K++          + + +++ L++ K  II  E      G++G     PY  F K + +   K+  YALYD         +  L FI W PE+  + S+MI A+SK  I  ++ G+K +++AN  +E+ D C + EK
Sbjct:    1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPD---KDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEK 152          
BLAST of ADF-H domain-containing protein vs. Ensembl Human
Match: CFL1 (cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874])

HSP 1 Score: 60.4622 bits (145), Expect = 7.356e-11
Identity = 47/158 (29.75%), Postives = 79/158 (50.00%), Query Frame = 2
Query:   71 FVKMASGVKCDPSVEEYLNYIKLQH---------KFQYIIYGLNQQKDRIIKLE-----TGELG----TPYEVFRKHMIETYAKEGCYALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEK 463
            +V+ ASGV     V +  N +K++          + + +++ L++ K  II  E      G++G     PY  F K + +   K+  YALYD         +  L FI W PE+  + S+MI A+SK  I  ++ G+K +++AN  +E+ D C + EK
Sbjct:   36 YVRPASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPD---KDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEK 190          
BLAST of ADF-H domain-containing protein vs. Ensembl Human
Match: CFL1 (cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874])

HSP 1 Score: 56.9954 bits (136), Expect = 5.319e-10
Identity = 39/127 (30.71%), Postives = 67/127 (52.76%), Query Frame = 2
Query:  137 LQHKFQYIIYGLNQQKDRIIKLE-----TGELG----TPYEVFRKHMIETYAKEGCYALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEK 463
            ++ + + +++ L++ K  II  E      G++G     PY  F K + +   K+  YALYD         +  L FI W PE+  + S+MI A+SK  I  ++ G+K +++AN  +E+ D C + EK
Sbjct:   12 VKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYATFVKMLPD---KDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEK 135          
BLAST of ADF-H domain-containing protein vs. Ensembl Celegans
Match: unc-60 (Actin-depolymerizing factor 2, isoform c [Source:UniProtKB/Swiss-Prot;Acc:Q07749])

HSP 1 Score: 52.373 bits (124), Expect = 9.389e-9
Identity = 39/150 (26.00%), Postives = 72/150 (48.00%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVF---RKHMIETYAKEGCYALYDYQGTLA--------------FISWIPETMKINSRMIMAASKSEIATRMVGVKA--KIEANSEDEIDECVIKEKTAS 472
            MASGVK DPS +   + +  +H+  YII+ +++    I+  + GE   PY  F    K ++E   KE  YA  D + T+               F+ + P+   +  RM+ A+S   +   + G+++  +++A+   ++DE  +K    S
Sbjct:    1 MASGVKVDPSCKNAYDLLHNKHQHSYIIFKIDKNDTAIVVEKVGEKNAPYAEFVEEMKKLVED-GKECRYAAVDVEVTVQRQGAEGTSTLNKVIFVQYCPDNAPVRRRMLYASSVRALKASL-GLESLFQVQASEMSDLDEKSVKSDLMS 148          
BLAST of ADF-H domain-containing protein vs. Ensembl Fly
Match: tsr (gene:FBgn0011726 transcript:FBtr0072188)

HSP 1 Score: 48.1358 bits (113), Expect = 4.038e-7
Identity = 39/143 (27.27%), Postives = 66/143 (46.15%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLET-GELGTPYEVFRKHMIETYAKEGCYALYDY------QGT--------LAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDECVIKEK 463
            MASGV      +     IK   K +Y+I+ +  +K   I +ET  +    Y+ F + + +    E  Y L+D+      QGT        L  +SW P+T K+  +M+ ++S   +   +VGV+  I+A    E     ++EK
Sbjct:    1 MASGVTVSDVCKTTYEEIKKDKKHRYVIFYIRDEKQ--IDVETVADRNAEYDQFLEDIQKCGPGECRYGLFDFEYMHQCQGTSESSKKQKLFLMSWCPDTAKVKKKMLYSSSFDALKKSLVGVQKYIQATDLSEASREAVEEK 141          
BLAST of ADF-H domain-containing protein vs. Ensembl Zebrafish
Match: cfl1 (cofilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-215])

HSP 1 Score: 53.1434 bits (126), Expect = 1.245e-8
Identity = 41/143 (28.67%), Postives = 67/143 (46.85%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQH----------KFQYIIYGLNQQKDRII-----KLETGELGTPYEVFRKHMIETYAKEGCYALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI 439
            MASGV  + +V    N +K++           + + +++ L+  K  II     ++  G+ G PY  F K +     +   YALYD         +  L FI W PE+  + S+MI A+SK  I  +  G+K + + N  D+I
Sbjct:    1 MASGVTVEETVLTVFNEMKVRKAHCNEEEKSKRKKAVMFCLSDDKKHIIMEQGQEILQGDEGDPYLKFVKMLPPNDCR---YALYDATYETKETKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGMDDI 140          
BLAST of ADF-H domain-containing protein vs. Ensembl Zebrafish
Match: cfl2 (cofilin 2 (muscle) [Source:ZFIN;Acc:ZDB-GENE-040426-1815])

HSP 1 Score: 51.2174 bits (121), Expect = 5.013e-8
Identity = 43/157 (27.39%), Postives = 73/157 (46.50%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQH---------KFQYIIYGLNQQKDRII-----KLETGELGT----PYEVFRKHMIETYAKEGCY-ALYDYQGT----LAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEKTASKI 478
            MASGV     V +  N +K++          + + +++ L+  K +II     ++  G++G     PY  F K +     + G Y A Y+ + +    L FI W PE   + S+MI A+SK  I  +  G+K + + N  D+I D   + EK    +
Sbjct:    1 MASGVTVSDEVIKVFNDMKVRKSSSSDEVKKRKKAVLFCLSDDKKKIIVEEGRQILVGDIGDSVDDPYACFVKLLPLNDCRYGLYDATYETKESKKEDLVFIFWAPEGAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIQDRSTLAEKLGGNV 157          
BLAST of ADF-H domain-containing protein vs. Ensembl Xenopus
Match: oat.2 (ornithine aminotransferase, gene 2 [Source:Xenbase;Acc:XB-GENE-1005707])

HSP 1 Score: 58.9214 bits (141), Expect = 1.283e-10
Identity = 47/153 (30.72%), Postives = 74/153 (48.37%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQHKF---------QYIIYGLNQQKDRIIKLETGE----------LGTPYEVFRKHMIETYAKEGCY-ALYDYQGT----LAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANS-EDEIDECVIKEK 463
            MASGV     V +  N +K++H+          + +++ L++ K  II LE G+          +  PY+ F K +     +   Y ALY+ + T    L F+ W PE   + S+MI A+SK  I  R  G+K + + N+ ED  D C + EK
Sbjct:    1 MASGVMVSDDVIKVFNDMKVRHQLSPEEAKKRKKAVVFCLSEDKKMII-LEPGKEILQGDVGCNVDDPYKAFVKMLPRNDCRYALYDALYETKETKKEDLVFVFWAPEEASLKSKMIYASSKDAIKKRFPGIKHEWQTNTFEDINDPCNLAEK 152          
BLAST of ADF-H domain-containing protein vs. Ensembl Xenopus
Match: oat.2 (ornithine aminotransferase, gene 2 [Source:Xenbase;Acc:XB-GENE-1005707])

HSP 1 Score: 56.6102 bits (135), Expect = 8.082e-10
Identity = 46/152 (30.26%), Postives = 73/152 (48.03%), Query Frame = 2
Query:   83 ASGVKCDPSVEEYLNYIKLQHKF---------QYIIYGLNQQKDRIIKLETGE----------LGTPYEVFRKHMIETYAKEGCY-ALYDYQGT----LAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANS-EDEIDECVIKEK 463
            ASGV     V +  N +K++H+          + +++ L++ K  II LE G+          +  PY+ F K +     +   Y ALY+ + T    L F+ W PE   + S+MI A+SK  I  R  G+K + + N+ ED  D C + EK
Sbjct:    1 ASGVMVSDDVIKVFNDMKVRHQLSPEEAKKRKKAVVFCLSEDKKMII-LEPGKEILQGDVGCNVDDPYKAFVKMLPRNDCRYALYDALYETKETKKEDLVFVFWAPEEASLKSKMIYASSKDAIKKRFPGIKHEWQTNTFEDINDPCNLAEK 151          
BLAST of ADF-H domain-containing protein vs. Ensembl Xenopus
Match: zc4h2 (zinc finger, C4H2 domain containing [Source:Xenbase;Acc:XB-GENE-941217])

HSP 1 Score: 54.299 bits (129), Expect = 6.466e-9
Identity = 44/161 (27.33%), Postives = 72/161 (44.72%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIK---------LQHKFQYIIYGLNQQKDRIIKLET-----GELG----TPYEVFRKHMIETYAKEGC-YALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEKTASKI 478
            MASGV  +  V +  N +K         ++ + + +++ L+  K  II  ET     G++G     PY  F    +     + C Y LYD         +  L FI W P+   + S+MI A+SK  I  +  G+K + + N  D+I D C + +K    +
Sbjct:    1 MASGVTVNDEVIKVFNEMKVRKSSTPEEIKKRKKAVLFCLSPDKKEIIVEETKQILVGDIGEAVPDPYRTF----VNLLPLDDCRYGLYDATYETKESKKEDLVFIFWAPDNAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRCTLADKLGGNV 157          
BLAST of ADF-H domain-containing protein vs. Ensembl Xenopus
Match: zc4h2 (zinc finger, C4H2 domain containing [Source:Xenbase;Acc:XB-GENE-941217])

HSP 1 Score: 50.0618 bits (118), Expect = 1.577e-7
Identity = 36/133 (27.07%), Postives = 61/133 (45.86%), Query Frame = 2
Query:  137 LQHKFQYIIYGLNQQKDRIIKLET-----GELG----TPYEVFRKHMIETYAKEGC-YALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEKTASKI 478
            ++ + + +++ L+  K  II  ET     G++G     PY  F    +     + C Y LYD         +  L FI W P+   + S+MI A+SK  I  +  G+K + + N  D+I D C + +K    +
Sbjct:   12 IKKRKKAVLFCLSPDKKEIIVEETKQILVGDIGEAVPDPYRTF----VNLLPLDDCRYGLYDATYETKESKKEDLVFIFWAPDNAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRCTLADKLGGNV 140          
BLAST of ADF-H domain-containing protein vs. Ensembl Mouse
Match: Cfl1 (cofilin 1, non-muscle [Source:MGI Symbol;Acc:MGI:101757])

HSP 1 Score: 59.6918 bits (143), Expect = 5.080e-11
Identity = 47/155 (30.32%), Postives = 76/155 (49.03%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQH---------KFQYIIYGLNQQKDRIIKLE-----TGELG----TPYEVFRKHMIETYAKEGCYALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEK 463
            MASGV     V +  N +K++          + + +++ L++ K  II  E      G++G     PY  F K + +   K+  YALYD         +  L FI W PE   + S+MI A+SK  I  ++ G+K +++AN  +E+ D C + EK
Sbjct:    1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYTTFVKMLPD---KDCRYALYDATYETKESKKEDLVFIFWAPENAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEK 152          
BLAST of ADF-H domain-containing protein vs. Ensembl Mouse
Match: Cfl1 (cofilin 1, non-muscle [Source:MGI Symbol;Acc:MGI:101757])

HSP 1 Score: 59.3066 bits (142), Expect = 1.642e-10
Identity = 46/155 (29.68%), Postives = 77/155 (49.68%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQH---------KFQYIIYGLNQQKDRII-----KLETGELG----TPYEVFRKHMIETYAKEGCYALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEK 463
            MASGV     V +  N +K++          + + +++ L++ K  II     ++  G++G     PY  F K + +   K+  YALYD         +  L FI W PE   + S+MI A+SK  I  ++ G+K +++AN  +E+ D C + EK
Sbjct:    1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYTTFVKMLPD---KDCRYALYDATYETKESKKEDLVFIFWAPENAPLKSKMIYASSKDAIKKKLTGIKHELQANCYEEVKDRCTLAEK 152          
BLAST of ADF-H domain-containing protein vs. Ensembl Mouse
Match: Cfl2 (cofilin 2, muscle [Source:MGI Symbol;Acc:MGI:101763])

HSP 1 Score: 52.373 bits (124), Expect = 2.104e-8
Identity = 42/157 (26.75%), Postives = 72/157 (45.86%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIK---------LQHKFQYIIYGLNQQKDRII-----KLETGELGTPYEVFRKHMIETYAKEGC-YALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEKTASKI 478
            MASGV  +  V +  N +K         ++ + + +++ L+  K +II     ++  G++G   E      ++      C YALYD         +  L FI W PE+  + S+MI A+SK  I  +  G+K + + N  D+I D   + EK    +
Sbjct:    1 MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDCRYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGSV 157          
BLAST of ADF-H domain-containing protein vs. Ensembl Mouse
Match: Dstn (destrin [Source:MGI Symbol;Acc:MGI:1929270])

HSP 1 Score: 49.2914 bits (116), Expect = 2.540e-7
Identity = 34/128 (26.56%), Postives = 60/128 (46.88%), Query Frame = 2
Query:  137 LQHKFQYIIYGLNQQKDRIIKLE-----TGELGTPYEVFRKHMIETYAKEGC-YALYD--------YQGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDECVIKEKTASKI 478
            ++ + + +I+ L+  K  I+  E      G++G       KH +    ++ C YALYD         +  L F  W PE   + S+MI A+SK  I  +  G+K + +AN  ++++   I EK    +
Sbjct:   29 IKKRKKAVIFCLSADKKCIVVEEGKEILVGDVGATITDPFKHFVGMLPEKDCRYALYDASFETKESRKEELMFFLWAPEQAPLKSKMIYASSKDAIKKKFPGIKHEYQANGPEDLNRTCIAEKLGGSL 156          
BLAST of ADF-H domain-containing protein vs. Ensembl Mouse
Match: Cfl1 (cofilin 1, non-muscle [Source:MGI Symbol;Acc:MGI:101757])

HSP 1 Score: 46.595 bits (109), Expect = 3.397e-6
Identity = 39/133 (29.32%), Postives = 61/133 (45.86%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKL---------QHKFQYIIYGLNQQKDRIIKLE-----TGELG----TPYEVFRKHMIETYAKEGCYALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVG 400
            MASGV     V +  N +K+         + + + +++ L++ K  II  E      G++G     PY  F K + +   K+  YALYD         +  L FI W PE   + S+MI A+SK  I  ++ G
Sbjct:    1 MASGVAVSDGVIKVFNDMKVRKSSTPEEVKKRKKAVLFCLSEDKKNIILEEGKEILVGDVGQTVDDPYTTFVKMLPD---KDCRYALYDATYETKESKKEDLVFIFWAPENAPLKSKMIYASSKDAIKKKLTG 130          
BLAST of ADF-H domain-containing protein vs. UniProt/SwissProt
Match: sp|P37167|ACTP_ACACA (Actophorin OS=Acanthamoeba castellanii OX=5755 PE=1 SV=2)

HSP 1 Score: 65.4698 bits (158), Expect = 1.520e-12
Identity = 33/139 (23.74%), Postives = 67/139 (48.20%), Query Frame = 2
Query:   86 SGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAKEGCYALYDYQ--------GTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDECVIKEKTASKI 478
            SG+       +  N +KL H+ +Y+ + +N     ++    G     YE F+  + E   ++  YA++DY+          + FI W P++  I S+M+  ++K  I  ++VG++ +++A    EI E  + E+    +
Sbjct:    2 SGIAVSDDCVQKFNELKLGHQHRYVTFKMNASNTEVVVEHVGGPNATYEDFKSQLPE---RDCRYAIFDYEFQVDGGQRNKITFILWAPDSAPIKSKMMYTSTKDSIKKKLVGIQVEVQATDAAEISEDAVSERAKKDV 137          
BLAST of ADF-H domain-containing protein vs. UniProt/SwissProt
Match: sp|P0CM06|COFI_CRYNJ (Cofilin OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) OX=214684 GN=COF1 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 4.461e-12
Identity = 43/142 (30.28%), Postives = 69/142 (48.59%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAKEGCYALYDYQGTLA----------FISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDECVIKEKTASK 475
            M+SGV+      E    +K   K  Y+IYGL++ K  I+ L+  E     + F   + E   K+  +A+YD++ TL           FI W P+   + ++MI A+SK  I  R+ G+  +I+A    EI +  + EK   K
Sbjct:    1 MSSGVQPTQECLEKFQELKTGKKLTYVIYGLSEDKRSIVVLKASE----DKDFDSFVAELPEKDCRWAVYDFEFTLPGGEGVRNKLCFIVWSPDDASVKNKMIFASSKEAIRRRLDGIHTEIQATDFSEITKDALFEKATRK 138          
BLAST of ADF-H domain-containing protein vs. UniProt/SwissProt
Match: sp|P0CM07|COFI_CRYNB (Cofilin OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) OX=283643 GN=COF1 PE=3 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 4.461e-12
Identity = 43/142 (30.28%), Postives = 69/142 (48.59%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAKEGCYALYDYQGTLA----------FISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDECVIKEKTASK 475
            M+SGV+      E    +K   K  Y+IYGL++ K  I+ L+  E     + F   + E   K+  +A+YD++ TL           FI W P+   + ++MI A+SK  I  R+ G+  +I+A    EI +  + EK   K
Sbjct:    1 MSSGVQPTQECLEKFQELKTGKKLTYVIYGLSEDKRSIVVLKASE----DKDFDSFVAELPEKDCRWAVYDFEFTLPGGEGVRNKLCFIVWSPDDASVKNKMIFASSKEAIRRRLDGIHTEIQATDFSEITKDALFEKATRK 138          
BLAST of ADF-H domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4P6E9|COFI_USTMA (Cofilin OS=Ustilago maydis (strain 521 / FGSC 9021) OX=237631 GN=COF1 PE=3 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 8.260e-12
Identity = 38/129 (29.46%), Postives = 62/129 (48.06%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAKEGCYALYDYQ---------GTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI 439
            M+SGVK      +    +KL  K +YIIY LN +   I+ ++     T Y+ F   +  T   E  YA+YD++           + F SW P+  KI  +M+ A+SK  +   +VG+  +I+     E+
Sbjct:    1 MSSGVKVSQECLDKFQELKLGKKIKYIIYSLNDKNTEIV-VQNTSTSTSYDDFLAELPPT---ECRYAIYDFEYEKGDAGKRNKICFFSWSPDDAKIKPKMVFASSKDALRKALVGISTEIQGTDFSEV 125          
BLAST of ADF-H domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9AY76|ADF2_ORYSJ (Actin-depolymerizing factor 2 OS=Oryza sativa subsp. japonica OX=39947 GN=ADF2 PE=2 SV=1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.364e-11
Identity = 33/136 (24.26%), Postives = 71/136 (52.21%), Query Frame = 2
Query:   83 ASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAKEGCYALYDY---------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDECVIKEK 463
            +SG+   P + +    ++++  F+Y+I+ + +++ +++  +TG     Y+ F   + E   +   YALYD+         +  + FI+W P T +I ++M+ + SK  I   + G   +I+A    E+D  V++E+
Sbjct:   11 SSGMGVAPDIRDTFLELQMKKAFRYVIFKIEEKQKQVVVEKTGATTESYDDFLASLPENDCR---YALYDFDFVTGENVQKSKIFFIAWSPSTSRIRAKMLYSTSKDRIKQELDGFHYEIQATDPTEVDLEVLRER 143          
BLAST of ADF-H domain-containing protein vs. TrEMBL
Match: A0A183JCS2 (ADF-H domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS480 PE=3 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 3.247e-19
Identity = 49/136 (36.03%), Postives = 81/136 (59.56%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAK-EGCYALYDYQG-----TLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDECVIKEKTA 469
            M++GVKC  S  E    +K   K +YI++ +   K+ I  L   +    Y  F+  +++   + EGCYA+YDY+      TL F+SW+P T+ +  RMI AASKS + + ++G+K ++EAN  DEI+E  +++K +
Sbjct:    1 MSTGVKCHRSCIEAFECLKRYKKHRYILFHIEDDKE-IKVLCQADRTETYHNFKDSLLKKMDEGEGCYAVYDYEAEGKLPTLIFVSWVPSTLDVKKRMIYAASKSVLKSSLIGIKHEVEANDVDEIEEEELRKKAS 135          
BLAST of ADF-H domain-containing protein vs. TrEMBL
Match: A0A183PBJ5 (ADF-H domain-containing protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS11731 PE=3 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 5.791e-19
Identity = 48/136 (35.29%), Postives = 81/136 (59.56%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAK-EGCYALYDYQG-----TLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDECVIKEKTA 469
            M++GVKC  S  E    +K   K +YI++ +   K+  +  +     T Y  F+  +++   + EGCYA+YDY+      TL F+SW+P T+ +  RMI AASKS + + ++G+K ++EAN  DEI+E  +++K +
Sbjct:    1 MSTGVKCHRSCIEAFECLKRYKKHRYILFHIEDDKEIKVFCQADRTET-YHNFKDSLLKKMDEGEGCYAVYDYEAEGKLPTLIFVSWVPSTLDVKKRMIYAASKSVLKSSLIGIKHEVEANDVDEIEEEELRKKAS 135          
BLAST of ADF-H domain-containing protein vs. TrEMBL
Match: A0A183MWL9 (ADF-H domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS20444 PE=3 SV=1)

HSP 1 Score: 88.1965 bits (217), Expect = 6.728e-19
Identity = 49/136 (36.03%), Postives = 81/136 (59.56%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAK-EGCYALYDYQG-----TLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDECVIKEKTA 469
            M++GVKC  S  E    +K   K +YI++ +   K+ I  L   +    Y  F+  +++   + EGCYA+YDY+      TL F+SW+P T+ +  RMI AASKS + + ++G+K ++EAN  DEI+E  +++K +
Sbjct:    1 MSTGVKCHRSCIEAFECLKRYKKHRYILFHIEDDKE-IKVLCQADRTETYHNFKDCLLKKMDEGEGCYAVYDYEAEGKLPTLIFVSWVPSTLDVKKRMIYAASKSVLKSSLIGIKHEVEANDVDEIEEEELRKKAS 135          
BLAST of ADF-H domain-containing protein vs. TrEMBL
Match: A0A183QMA2 (ADF-H domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.176e-18
Identity = 48/128 (37.50%), Postives = 75/128 (58.59%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAK-EGCYALYDYQ-----GTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDE 445
            M++GVKC  S  E    +KL  K +YII+ +   K+ I  L   +    Y  F+  +++   + +GCYA+YDY+      +L F+SW+P T+ +  RMI AASK  +   +VGV+ ++EAN  DEI+E
Sbjct:    1 MSTGVKCHRSCIEAFEDLKLNKKHRYIIFHIEDDKE-IKVLCRADRTETYHSFKDILLKMMDEGKGCYAVYDYEVEGKVPSLIFVSWVPSTLDVRKRMIYAASKCVLKASLVGVRREVEANDVDEIEE 127          
BLAST of ADF-H domain-containing protein vs. TrEMBL
Match: G4LX89 (Cofilin, actophorin, putative OS=Schistosoma mansoni OX=6183 GN=Smp_120700.1 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.176e-18
Identity = 48/128 (37.50%), Postives = 75/128 (58.59%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAK-EGCYALYDYQ-----GTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDE 445
            M++GVKC  S  E    +KL  K +YII+ +   K+ I  L   +    Y  F+  +++   + +GCYA+YDY+      +L F+SW+P T+ +  RMI AASK  +   +VGV+ ++EAN  DEI+E
Sbjct:    1 MSTGVKCHRSCIEAFEDLKLNKKHRYIIFHIEDDKE-IKVLCRADRTETYHSFKDILLKMMDEGKGCYAVYDYEVEGKVPSLIFVSWVPSTLDVRKRMIYAASKCVLKASLVGVRREVEANDVDEIEE 127          
BLAST of ADF-H domain-containing protein vs. Ensembl Cavefish
Match: cfl1 (cofilin-2 [Source:NCBI gene;Acc:103047533])

HSP 1 Score: 53.9138 bits (128), Expect = 5.206e-9
Identity = 45/153 (29.41%), Postives = 72/153 (47.06%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQH----------KFQYIIYGLNQQKDRIIKLETGEL-----GTPYEVFRKHMIETYAKEGC-YALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEK 463
            MASGV  + +V    N +K++           + + +++ L+  K +I+  E  E+     G PY  F K +      + C YALYD         +  L FI W PE+  + S+MI A+SK  I  +  G+K + + N  D+I D   + EK
Sbjct:    1 MASGVTVEENVLTIFNEMKVRKAQANEEERRKRKKAVLFCLSDDKKKIVMEEGNEILQGDEGDPYLKFVKML----PPDDCRYALYDATYETKETKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIKDRKTLAEK 149          
BLAST of ADF-H domain-containing protein vs. Ensembl Cavefish
Match: cfl1 (cofilin-2 [Source:NCBI gene;Acc:103047533])

HSP 1 Score: 51.6026 bits (122), Expect = 4.441e-8
Identity = 41/143 (28.67%), Postives = 67/143 (46.85%), Query Frame = 2
Query:   83 ASGVKCDPSVEEYLNYIKLQH----------KFQYIIYGLNQQKDRIIKLETGEL-----GTPYEVFRKHMIETYAKEGC-YALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI 439
            ASGV  + +V    N +K++           + + +++ L+  K +I+  E  E+     G PY  F K +      + C YALYD         +  L FI W PE+  + S+MI A+SK  I  +  G+K + + N  D+I
Sbjct:   29 ASGVTVEENVLTIFNEMKVRKAQANEEERRKRKKAVLFCLSDDKKKIVMEEGNEILQGDEGDPYLKFVKML----PPDDCRYALYDATYETKETKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDI 167          
BLAST of ADF-H domain-containing protein vs. Ensembl Cavefish
Match: cfl2 (cofilin 2 [Source:NCBI gene;Acc:103041014])

HSP 1 Score: 50.8322 bits (120), Expect = 6.034e-8
Identity = 42/157 (26.75%), Postives = 74/157 (47.13%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQH---------KFQYIIYGLNQQKDRII-----KLETGELG----TPYEVFRKHMIETYAKEGCY-ALYDYQGT----LAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEKTASKI 478
            MASGV  +  V +  N +K++          + + +++ L+  K +II     ++  G++G     PY  F K +     + G Y A Y+ + +    L FI W PE   + S+MI A+SK  I  +  G+K + + N  D+I D   + +K    +
Sbjct:    1 MASGVTVNDEVIKVFNDMKVRKSSTSDEVKKRKKAVLFCLSDDKKKIIVEEGKQILVGDIGETVDDPYACFVKLLPLNDCRYGLYDATYETKESKKEDLVFIFWAPEGAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIQDRSTLADKLGGNV 157          
BLAST of ADF-H domain-containing protein vs. Ensembl Cavefish
Match: cfl1l (cofilin-2-like [Source:NCBI gene;Acc:103024737])

HSP 1 Score: 50.447 bits (119), Expect = 9.832e-8
Identity = 37/136 (27.21%), Postives = 69/136 (50.74%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQH-------KFQYIIYGLNQQKDRII-----KLETGELGTPYEVFRKHMIETYAKEGC-YALYD--------YQGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEAN 424
            MASGV     V E+   I++++       +F+ +I  +++ +  II      L+  ++     VF+K ++ T  ++ C YALYD         +  L FI W PE   + S+M+ A+SK  + +++ G+K + + N
Sbjct:    1 MASGVAISDEVVEHYTKIRVRYQGSEEKERFKIVIMRMSEDQKSIIVDHESSLKVKDVEKEDNVFKK-ILSTLPEKDCRYALYDCTYETKESLKEDLVFIMWAPEDAPLKSKMVYASSKGALRSKLPGLKFEWQVN 135          
BLAST of ADF-H domain-containing protein vs. Ensembl Sea Lamprey
Match: cfl1 (cofilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-215])

HSP 1 Score: 48.521 bits (114), Expect = 8.236e-8
Identity = 43/156 (27.56%), Postives = 70/156 (44.87%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQH---------KFQYIIYGLNQQKDRIIKLE-----TGELG----TPYEVFRKHMIETYAKEGC-YALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEK 463
            MASGV     V +  N +K++          + + +++ +      II  E      G++G     PY+ F K +     K+ C YALYD         +  L FI W P+   + S+M+ A+SK  I  +  G+K + + N  D+I D   + EK
Sbjct:    1 MASGVLVSDDVVQIFNNMKVRKSSTPEEVKKRKKAVLFCIGPDMRNIIAEEGKEILVGDVGETVKDPYDTFVKLL----PKDDCRYALYDATYETRETKKEDLVFIFWAPDGAPLKSKMVYASSKEAIKKKFTGIKHEWQVNGLDDIQDRLTLAEK 152          
BLAST of ADF-H domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007240.1 (pep scaffold:Pmarinus_7.0:GL476479:38272:39885:-1 gene:ENSPMAG00000006535.1 transcript:ENSPMAT00000007240.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 3.367e-7
Identity = 41/159 (25.79%), Postives = 71/159 (44.65%), Query Frame = 2
Query:   83 ASGVKCDPSVEEYLNYIKLQH---------KFQYIIYGLNQQKDRII-----KLETGELG----TPYEVFRKHMIETYAKEGCYALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEKTASKI 478
            ASGV     V    N +K++          + + +++ L+  K +II     ++  G++G     PY  F K +     +   YALYD         +  L F+ W P++  + S+MI A+SK  I  +  G+K + + N  ++I D   + EK    I
Sbjct:    2 ASGVAVSDDVIRVFNDMKVRKASSAEEVKKRKKAVLFCLSPDKKQIIVEPAKEILVGDIGQSVDDPYGAFVKLLPPNDCR---YALYDATYETNESKKEDLVFVFWAPDSAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGMEDIGDRLTLAEKLGGNI 157          
BLAST of ADF-H domain-containing protein vs. Ensembl Sea Lamprey
Match: cfl2 (cofilin 2 (muscle) [Source:ZFIN;Acc:ZDB-GENE-040426-1815])

HSP 1 Score: 45.4394 bits (106), Expect = 1.143e-6
Identity = 42/159 (26.42%), Postives = 70/159 (44.03%), Query Frame = 2
Query:   83 ASGVKCDPSVEEYLNYIK---------LQHKFQYIIYGLNQQKDRII-----KLETGELG----TPYEVFRKHMIETYAKEGCYALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANS-EDEIDECVIKEKTASKI 478
            ASGV     V    N +K         ++ + + +++ L+  K +II     ++  G++G     PY  F K +     +   YALYD         +  L F+ W P++  + S+MI A+SK  I  +  G+K + + N  ED  D   + EK    I
Sbjct:    2 ASGVSVSDDVIRVFNDMKVRKSSTQEEIKKRKKAVLFCLSDDKRQIIVETSRQILVGDIGETVEDPYGAFVKLLPLNDCR---YALYDATYETRESKKEDLVFVFWAPDSAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLEDIKDHYTLAEKLGGNI 157          
BLAST of ADF-H domain-containing protein vs. Ensembl Yeast
Match: COF1 (Cofilin, involved in pH-dependent actin filament depolarization; binds both actin monomers and filaments and severs filaments; involved in the selective sorting, export of the secretory cargo from the late golgi; genetically interacts with pmr1; thought to be regulated by phosphorylation at SER4; ubiquitous and essential in eukaryotes [Source:SGD;Acc:S000003973])

HSP 1 Score: 57.3806 bits (137), Expect = 2.464e-11
Identity = 35/138 (25.36%), Postives = 64/138 (46.38%), Query Frame = 2
Query:   86 SGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAKEGCYALYDYQ----------GTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDECVIKEKTA 469
            SGV          N +KL  K+++I++GLN  K  I+  ET      Y+ F + + E    +  YA+YD++            + F +W P+T  + S+M+ A+SK  +   + GV   ++     E+    + E+ +
Sbjct:    4 SGVAVADESLTAFNDLKLGKKYKFILFGLNDAKTEIVVKET-STDPSYDAFLEKLPEN---DCLYAIYDFEYEINGNEGKRSKIVFFTWSPDTAPVRSKMVYASSKDALRRALNGVSTDVQGTDFSEVSYDSVLERVS 137          
BLAST of ADF-H domain-containing protein vs. Ensembl Medaka
Match: cfl1 (cofilin 1 [Source:NCBI gene;Acc:101173715])

HSP 1 Score: 51.2174 bits (121), Expect = 4.458e-8
Identity = 42/153 (27.45%), Postives = 71/153 (46.41%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQ----------HKFQYIIYGLNQQKDRII-----KLETGELGTPYEVFRKHMIETYAKEGC-YALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANS-EDEIDECVIKEK 463
            MASGVK    V    N +K++           + + +++ L+     I+     ++  G+LGT  +   +H ++    + C YALYD         +  L FI W P++  + S+MI A+SK  I  +  G+K + + N  ED  D   + EK
Sbjct:    1 MASGVKVTDEVIAIFNDMKVRKAQANEDEKRRRKKAVLFCLSSDLKNIVLDDGKEILQGDLGTTVQDPYQHFVKMLPPDDCRYALYDATYETKETKKEDLVFIFWAPDSAPLKSKMIYASSKDAIKRKFEGIKHEWQVNGLEDLKDRHTLAEK 153          
BLAST of ADF-H domain-containing protein vs. Ensembl Medaka
Match: cfl2 (cofilin-2 [Source:NCBI gene;Acc:101159957])

HSP 1 Score: 49.6766 bits (117), Expect = 1.630e-7
Identity = 43/155 (27.74%), Postives = 71/155 (45.81%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQH---------KFQYIIYGLNQQKDRII-----KLETGELG----TPYEVFRKHMIETYAKEGCYALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEK 463
            MASGV     V    N +K++          + + +++ +++ K  II     ++  G++G     PY  F K +     +   YALYD         +  L FI W PE+  + S+MI A+SK  I  +  G+K + + N  D+I D   + EK
Sbjct:    1 MASGVTVTDEVIRVFNDMKVRKSSTQDEVKKRKKAVMFCMSEDKKNIIVEDGKQILVGDIGETVDDPYLCFVKLLPPNDCR---YALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIQDRATLAEK 152          
BLAST of ADF-H domain-containing protein vs. Ensembl Medaka
Match: cfl2 (cofilin-2 [Source:NCBI gene;Acc:101159957])

HSP 1 Score: 46.595 bits (109), Expect = 1.894e-6
Identity = 35/127 (27.56%), Postives = 62/127 (48.82%), Query Frame = 2
Query:  137 LQHKFQYIIYGLNQQKDRII-----KLETGELG----TPYEVFRKHMIETYAKEGCYALYDY--------QGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI-DECVIKEK 463
            ++ + + +++ +++ K  II     ++  G++G     PY  F K +     +   YALYD         +  L FI W PE+  + S+MI A+SK  I  +  G+K + + N  D+I D   + EK
Sbjct:   29 VKKRKKAVMFCMSEDKKNIIVEDGKQILVGDIGETVDDPYLCFVKLLPPNDCR---YALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASSKDAIKKKFTGIKHEWQVNGLDDIQDRATLAEK 152          
BLAST of ADF-H domain-containing protein vs. Planmine SMEST
Match: SMESG000022423.1 (SMESG000022423.1)

HSP 1 Score: 275.404 bits (703), Expect = 4.001e-96
Identity = 133/133 (100.00%), Postives = 133/133 (100.00%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAKEGCYALYDYQGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDECVIKEKTASKI 478
            MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAKEGCYALYDYQGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDECVIKEKTASKI
Sbjct:    1 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAKEGCYALYDYQGTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEIDECVIKEKTASKI 133          
BLAST of ADF-H domain-containing protein vs. Planmine SMEST
Match: SMESG000080129.1 (SMESG000080129.1)

HSP 1 Score: 70.8626 bits (172), Expect = 9.858e-16
Identity = 38/126 (30.16%), Postives = 70/126 (55.56%), Query Frame = 2
Query:   80 MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPYEVFRKHMIETYAK-EGCYALYDYQ-----GTLAFISWIPETMKINSRMIMAASKSEIATRMVGVKAKIEANSEDEI 439
            M++GV   P+  E    IK+  K++Y+++G+ +    I   +       YE F   + E  A+ +G YA+Y+Y+       L F+ WIP+ + + ++M+ A S+  +  +++G+KA I+AN  DEI
Sbjct:    1 MSTGVVVSPNCAEAYGEIKMGRKYRYVLFGITEGDKLIDVTKKAPREATYEDFVADLNEACAQNKGLYAVYEYELSEKNSQLIFVVWIPDVIPVRAKMLYAGSQEGLRKQLIGIKAVIKANDVDEI 126          
BLAST of ADF-H domain-containing protein vs. Planmine SMEST
Match: SMESG000045466.1 (SMESG000045466.1)

HSP 1 Score: 45.4394 bits (106), Expect = 8.552e-7
Identity = 20/52 (38.46%), Postives = 31/52 (59.62%), Query Frame = 2
Query:  266 KEGCYALYDYQ-----GTLAFISWIPETMKINSRMIMAASKSEIATRMVGVK 406
            K+G YA++DY        L FI WIP  + +  RMI+A+SK  I  ++ G++
Sbjct:    6 KDGAYAIFDYPLENKGDLLIFICWIPIDLPVKKRMILASSKDAIKKKLKGIR 57          
BLAST of ADF-H domain-containing protein vs. Planmine SMEST
Match: SMESG000045466.1 (SMESG000045466.1)

HSP 1 Score: 45.4394 bits (106), Expect = 9.311e-7
Identity = 20/52 (38.46%), Postives = 31/52 (59.62%), Query Frame = 2
Query:  266 KEGCYALYDYQ-----GTLAFISWIPETMKINSRMIMAASKSEIATRMVGVK 406
            K+G YA++DY        L FI WIP  + +  RMI+A+SK  I  ++ G++
Sbjct:    8 KDGAYAIFDYPLENKGDLLIFICWIPIDLPVKKRMILASSKDAIKKKLKGIR 59          
The following BLAST results are available for this feature:
BLAST of ADF-H domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CFL13.598e-1129.68cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874][more]
CFL14.209e-1130.32cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874][more]
CFL14.209e-1130.32cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874][more]
CFL17.356e-1129.75cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874][more]
CFL15.319e-1030.71cofilin 1 [Source:HGNC Symbol;Acc:HGNC:1874][more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
unc-609.389e-926.00Actin-depolymerizing factor 2, isoform c [Source:... [more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tsr4.038e-727.27gene:FBgn0011726 transcript:FBtr0072188[more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cfl11.245e-828.67cofilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-215][more]
cfl25.013e-827.39cofilin 2 (muscle) [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
oat.21.283e-1030.72ornithine aminotransferase, gene 2 [Source:Xenbase... [more]
oat.28.082e-1030.26ornithine aminotransferase, gene 2 [Source:Xenbase... [more]
zc4h26.466e-927.33zinc finger, C4H2 domain containing [Source:Xenbas... [more]
zc4h21.577e-727.07zinc finger, C4H2 domain containing [Source:Xenbas... [more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cfl15.080e-1130.32cofilin 1, non-muscle [Source:MGI Symbol;Acc:MGI:1... [more]
Cfl11.642e-1029.68cofilin 1, non-muscle [Source:MGI Symbol;Acc:MGI:1... [more]
Cfl22.104e-826.75cofilin 2, muscle [Source:MGI Symbol;Acc:MGI:10176... [more]
Dstn2.540e-726.56destrin [Source:MGI Symbol;Acc:MGI:1929270][more]
Cfl13.397e-629.32cofilin 1, non-muscle [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of ADF-H domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P37167|ACTP_ACACA1.520e-1223.74Actophorin OS=Acanthamoeba castellanii OX=5755 PE=... [more]
sp|P0CM06|COFI_CRYNJ4.461e-1230.28Cofilin OS=Cryptococcus neoformans var. neoformans... [more]
sp|P0CM07|COFI_CRYNB4.461e-1230.28Cofilin OS=Cryptococcus neoformans var. neoformans... [more]
sp|Q4P6E9|COFI_USTMA8.260e-1229.46Cofilin OS=Ustilago maydis (strain 521 / FGSC 9021... [more]
sp|Q9AY76|ADF2_ORYSJ2.364e-1124.26Actin-depolymerizing factor 2 OS=Oryza sativa subs... [more]
back to top
BLAST of ADF-H domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183JCS23.247e-1936.03ADF-H domain-containing protein OS=Schistosoma cur... [more]
A0A183PBJ55.791e-1935.29ADF-H domain-containing protein OS=Schistosoma mat... [more]
A0A183MWL96.728e-1936.03ADF-H domain-containing protein OS=Schistosoma mar... [more]
A0A183QMA23.176e-1837.50ADF-H domain-containing protein OS=Schistosoma rod... [more]
G4LX893.176e-1837.50Cofilin, actophorin, putative OS=Schistosoma manso... [more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cfl15.206e-929.41cofilin-2 [Source:NCBI gene;Acc:103047533][more]
cfl14.441e-828.67cofilin-2 [Source:NCBI gene;Acc:103047533][more]
cfl26.034e-826.75cofilin 2 [Source:NCBI gene;Acc:103041014][more]
cfl1l9.832e-827.21cofilin-2-like [Source:NCBI gene;Acc:103024737][more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cfl18.236e-827.56cofilin 1 [Source:ZFIN;Acc:ZDB-GENE-030131-215][more]
ENSPMAT00000007240.13.367e-725.79pep scaffold:Pmarinus_7.0:GL476479:38272:39885:-1 ... [more]
cfl21.143e-626.42cofilin 2 (muscle) [Source:ZFIN;Acc:ZDB-GENE-04042... [more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
COF12.464e-1125.36Cofilin, involved in pH-dependent actin filament d... [more]
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ADF-H domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cfl14.458e-827.45cofilin 1 [Source:NCBI gene;Acc:101173715][more]
cfl21.630e-727.74cofilin-2 [Source:NCBI gene;Acc:101159957][more]
cfl21.894e-627.56cofilin-2 [Source:NCBI gene;Acc:101159957][more]
back to top
BLAST of ADF-H domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000022423.14.001e-96100.00SMESG000022423.1[more]
SMESG000080129.19.858e-1630.16SMESG000080129.1[more]
SMESG000045466.18.552e-738.46SMESG000045466.1[more]
SMESG000045466.19.311e-738.46SMESG000045466.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031764 ID=SMED30031764|Name=ADF-H domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=586bp
GTAAACACAAATATACTTTGTTTGTCTACATCAATTTGTTAAAACAGTTT
TCGGTTTTAGATAAAGTTCCTTTGTTAAAATGGCTTCAGGTGTTAAATGT
GATCCATCAGTTGAAGAATATCTTAATTATATTAAATTACAACACAAATT
TCAATATATTATCTATGGACTAAACCAACAGAAGGATAGAATTATTAAAT
TAGAAACTGGGGAATTAGGTACTCCTTATGAGGTATTCAGAAAACACATG
ATTGAAACGTATGCTAAAGAAGGATGCTATGCATTATATGACTATCAGGG
TACTTTGGCTTTTATTTCATGGATACCAGAAACCATGAAAATCAATAGTC
GTATGATTATGGCTGCTTCAAAATCTGAGATTGCAACACGTATGGTTGGT
GTGAAGGCTAAAATCGAGGCCAACAGCGAAGATGAAATTGATGAATGCGT
AATTAAGGAAAAGACGGCTTCTAAAATATAAAATGGTCTTCAATTAGTTT
TGAAGTCAACTGAAATCCTTGTTATGCTATCCAGTAACATAGTCGCTCTT
TGTTTTTTATAATTACATGGATTTGAATTTCTTAGT
back to top

protein sequence of SMED30031764-orf-1

>SMED30031764-orf-1 ID=SMED30031764-orf-1|Name=SMED30031764-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=134bp
MASGVKCDPSVEEYLNYIKLQHKFQYIIYGLNQQKDRIIKLETGELGTPY
EVFRKHMIETYAKEGCYALYDYQGTLAFISWIPETMKINSRMIMAASKSE
IATRMVGVKAKIEANSEDEIDECVIKEKTASKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000429neoblast
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR017904ADF/Cofilin
IPR002108ADF-H
IPR029006ADF-H/Gelsolin-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0015629actin cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0030042actin filament depolymerization
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002108Actin-depolymerising factor homology domainSMARTSM00102adf_2coord: 9..130
e-value: 8.7E-18
score: 75.1
IPR002108Actin-depolymerising factor homology domainPFAMPF00241Cofilin_ADFcoord: 14..128
e-value: 7.5E-21
score: 74.2
IPR002108Actin-depolymerising factor homology domainPROSITEPS51263ADF_Hcoord: 2..130
score: 19.186
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 1..132
e-value: 4.2E-28
score: 100.0
NoneNo IPR availablePANTHERPTHR11913:SF12COFILIN/ACTIN-DEPOLYMERIZING FACTOR HOMOLOGcoord: 2..132
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 1..129
IPR017904ADF/CofilinPANTHERPTHR11913COFILIN-RELATEDcoord: 2..132