Nudix hydrolase domain-containing protein

Overview
NameNudix hydrolase domain-containing protein
Smed IDSMED30031757
Length (bp)880
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nudix hydrolase domain-containing protein (SMED30031757) t-SNE clustered cells

Violin plots show distribution of expression levels for Nudix hydrolase domain-containing protein (SMED30031757) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nudix hydrolase domain-containing protein (SMED30031757) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nudix hydrolase domain-containing protein (SMED30031757) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031757

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30031757SMESG000032411.1 dd_Smed_v4_2068_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031757SMESG000032411.1 dd_Smed_v4_2068_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031757SMESG000032411.1 OX_Smed_1.0.17783ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30031757SMESG000032411.1 dd_Smed_v4_2068_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Human
Match: NUDT8 (nudix hydrolase 8 [Source:HGNC Symbol;Acc:HGNC:8055])

HSP 1 Score: 98.2117 bits (243), Expect = 8.935e-24
Identity = 66/205 (32.20%), Postives = 100/205 (48.78%), Query Frame = 3
Query:  126 NLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRS-HRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFK 737
             L     +AAVL+PLC     P++L+  RS ++   H+G V                      SFPGG  +   + ++ TALRET+EE+G+++ +  VWG          ++ V PV+A +G L+   +  NS EV+  FA  L  L + +N GYT   F      + Y +PVF   +    R+WGLTA+ T   L LL P  ++
Sbjct:   24 RLRARPASAAVLVPLCSVRGVPALLYTLRSSRLTGRHKGDV----------------------SFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQ-KATVVPVLAGVGPLDPQSLRPNSEEVDEVFALPLAHLLQTQNQGYT--HFCRGGHFR-YTLPVF--LHGPH-RVWGLTAVITEFALQLLAPGTYQ 199          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Human
Match: NUDT8 (nudix hydrolase 8 [Source:HGNC Symbol;Acc:HGNC:8055])

HSP 1 Score: 70.8626 bits (172), Expect = 1.191e-14
Identity = 42/138 (30.43%), Postives = 68/138 (49.28%), Query Frame = 3
Query:  126 NLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRS-HRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNF 536
             L     +AAVL+PLC     P++L+  RS ++   H+G V                      SFPGG  +   + ++ TALRET+EE+G+++ +  VWG          ++ V PV+A +G L+   +  NS EV++
Sbjct:   24 RLRARPASAAVLVPLCSVRGVPALLYTLRSSRLTGRHKGDV----------------------SFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQ-KATVVPVLAGVGPLDPQSLRPNSEEVSW 138          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Celegans
Match: ndx-3 (Nudix hydrolase 3 [Source:UniProtKB/Swiss-Prot;Acc:Q23236])

HSP 1 Score: 94.7449 bits (234), Expect = 7.001e-23
Identity = 65/217 (29.95%), Postives = 102/217 (47.00%), Query Frame = 3
Query:  120 PKNLFKNAKNAA--VLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLN-WDKIIENSNEVNFTFARSLEFLC--------EPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFK 737
            P+ +  +  N+A  VLIPL   + + S+L  +RS+ +RSHRG+V                       FPGG  +  GE+  +TALRET EEIGV+ +  ++WG       +     VTP+V  I      + ++ NS+EV   F   ++ L         + K + YT+  F S      +  P    + +   R+WGL+ +  HQ L LL P+ +K
Sbjct:   41 PRLVSDSDANSAMSVLIPLVTVDGRDSVLLTKRSIHLRSHRGEV----------------------CFPGGRMDP-GETTTETALRETFEEIGVNAESVEIWGHLKSVIRRQADFNVTPIVGYISDERVLENLVVNSDEVQAVFTIPIDELIKKAGLTKFQSKRMKYTLPSFDSTEFKVHHNAP--NEYLHSTQRVWGLSGVMLHQALTLLNPDVYK 232          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Fly
Match: CG11095 (gene:FBgn0030528 transcript:FBtr0073827)

HSP 1 Score: 90.8929 bits (224), Expect = 4.542e-21
Identity = 72/225 (32.00%), Postives = 103/225 (45.78%), Query Frame = 3
Query:   69 ENKLIVQNKLKSFPPF-LPKNLF---KNAKNAAVLIPLCVYN--NKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLP 725
            E++     K++S P F  PK L    +  + +AVLI LC     N+ S+L+ +RS  +RSH  Q+                      SFPGG ++++  S +  ALRET+EEIG+      VWG           S V PVV  +   +  ++  N  EV   F+  L  L  PK   +T  +F S  +  V+ +        D  RIWG+T   TH FLH LLP
Sbjct:   53 ESQRRCMEKMRSLPAFPRPKALTPSRREKQTSAVLIALCQERGTNEISLLYTRRSRHLRSHSFQI----------------------SFPGGRRDDHDSSYVDCALRETEEEIGLPRHRIQVWGEAKQLQLPRTSSIV-PVVGVVPDFSLSELRLNWEEVEEAFSVPLTSLMLPKATRHT--QFRSGYSGPVFVV--------DHYRIWGITGYLTHLFLHCLLP 244          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Zebrafish
Match: nudt8 (nudix (nucleoside diphosphate linked moiety X)-type motif 8 [Source:ZFIN;Acc:ZDB-GENE-061013-219])

HSP 1 Score: 107.071 bits (266), Expect = 8.402e-27
Identity = 72/232 (31.03%), Postives = 111/232 (47.84%), Query Frame = 3
Query:   33 YLNSYMETIYSFENKLIVQNKLKSFPPFLPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRS-HRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLP 725
            + N+  E   S  N+   +  L++      ++  + A   AVL+ LCV    P++LF  RS +++  H+G V                      SF GG ++ +  +++ TALRE  EE+G+ + +  VWG       ++G   + PV+ANIG L       N +EV   F  +LE LCEP+N GYT  R         Y +PVF    +   R+WGLTA+   Q L L++P
Sbjct:   76 HRNAQFEECVSALNEARCRRSLQANAALYERDTHRWA---AVLVCLCVSRGDPALLFTLRSAQLKGRHKGDV----------------------SFAGGKKDPSDRTVVDTALREAAEELGIHIPEEKVWGVLKPLRDKSGM-MIAPVIANIGPLEALSFQPNPSEVEEIFTLTLEHLCEPRNRGYTHFRTGERYG---YTLPVFLSPKH---RVWGLTAVALDQALKLIVP 275          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Zebrafish
Match: nudt7 (nudix (nucleoside diphosphate linked moiety X)-type motif 7 [Source:ZFIN;Acc:ZDB-GENE-131127-212])

HSP 1 Score: 63.1586 bits (152), Expect = 2.373e-11
Identity = 61/216 (28.24%), Postives = 90/216 (41.67%), Query Frame = 3
Query:  117 LPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPK-NIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLL---PEYFKGIELN 752
            +PK+L K    A+VLIPL + + +  +L   RS+ +  H G+V                       FPGG  E +    + TALRE +EEIG+    + V  +     ++ G   +TPVVA I       I  N  EV+  F   L+F      + GY +          +Y  P  G  +    +IWGLTA        + L   PE+  G +L 
Sbjct:   25 IPKSLPK----ASVLIPLLLQDGELRLLLTVRSIHLSHHAGEVC----------------------FPGGKCESSDRDDVHTALREAEEEIGLPADAAQVIATLFPVINKAGL-LITPVVAFIQSSFRPSI--NPQEVSEVFTLPLDFFTRADHHSGYPVPSVFGPTHSFMYTDPASGRVH----QIWGLTAALAITVAAIGLQKTPEFQTGFDLE 207          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Xenopus
Match: dis3 (DIS3 homolog, exosome endoribonuclease and 3'-5' exoribonuclease [Source:Xenbase;Acc:XB-GENE-5925331])

HSP 1 Score: 107.457 bits (267), Expect = 1.800e-27
Identity = 71/231 (30.74%), Postives = 104/231 (45.02%), Query Frame = 3
Query:   57 IYSFENKLIVQNKLKSFPPFLPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRS-HRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVF---GGFNNDFPRIWGLTALFTHQFLHLLLPEYFK 737
            +Y+F  K+      +     L   +     +A VL+ LC +   PS L+  RS ++R  H+G V                      SFPGG ++ +   +I TA RE +EE+G+SLKD+ VWG+        G   + PV+ANIG L    +  N +EV      SL   C   + GYT  R         Y +PVF    G+     ++WGLTA+ T   L LL P  ++
Sbjct:   14 VYNFPCKIFSPETERRCREILSHTVLPPVASAGVLVTLCTFKGAPSFLYTLRSPQLRGRHKGDV----------------------SFPGGKRDSSDRDIIHTATREAEEELGISLKDNAVWGALKPITDWTGM-VIVPVMANIGALEDLALNPNRDEVESLLTLSLSVACLDASRGYTYFR---QQGHYSYTLPVFRLTKGY-----KVWGLTAMMTDSALSLLFPHLYR 213          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Xenopus
Match: itsn1 (intersectin 1 [Source:Xenbase;Acc:XB-GENE-5904194])

HSP 1 Score: 65.0846 bits (157), Expect = 8.549e-12
Identity = 46/153 (30.07%), Postives = 72/153 (47.06%), Query Frame = 3
Query:  144 KNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRF 602
            + A+VL+PL +   K  +LF  RSMK+++  G V                       FPGG +E+  +  +QTALRE +EEIG+  +  ++ G      S + +  +TPVVA + +    +   + NEV   F   L+F     +  YTI  F
Sbjct:   55 QKASVLLPLFIKEEKIHLLFTVRSMKLKTMPGDV----------------------CFPGGRREQTDKDDVQTALREAKEEIGLCPEQVEIIGRLIPAMSMSPRYLITPVVAVVEEPF--QACPDPNEVADVFLVPLDFFLSSDH--YTILHF 181          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Mouse
Match: Nudt8 (nudix (nucleoside diphosphate linked moiety X)-type motif 8 [Source:MGI Symbol;Acc:MGI:1913637])

HSP 1 Score: 104.375 bits (259), Expect = 1.372e-26
Identity = 67/205 (32.68%), Postives = 100/205 (48.78%), Query Frame = 3
Query:  126 NLFKNAKNAAVLIPLCVYNNKPSILFCQRSMK-VRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFK 737
             L      AAVL+PLC+    P++L+  RS + V  H+G+V                      SFPGG  + + + +I TALRETQEE+G+ +    VWG       +  ++ + PV+AN+G L+   +  N  EV+  F  SL  L + +N GYT            Y +PVF    +   R+WGLTA+ T   L LL P +++
Sbjct:   24 RLRSRPAAAAVLVPLCLVRGVPALLYTLRSSRLVGRHKGEV----------------------SFPGGKCDPDDQDVIHTALRETQEELGLEVPKEHVWGVLQPVYDRE-KATIVPVLANVGPLDLQSLRPNLEEVDEVFEMSLAHLLQTQNQGYT---HFCQGGHFSYTLPVFLHGPH---RVWGLTAVITELTLKLLAPGFYQ 199          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Mouse
Match: Gm49405 (predicted gene, 49405 [Source:MGI Symbol;Acc:MGI:6155029])

HSP 1 Score: 104.375 bits (259), Expect = 1.372e-26
Identity = 67/205 (32.68%), Postives = 100/205 (48.78%), Query Frame = 3
Query:  126 NLFKNAKNAAVLIPLCVYNNKPSILFCQRSMK-VRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFK 737
             L      AAVL+PLC+    P++L+  RS + V  H+G+V                      SFPGG  + + + +I TALRETQEE+G+ +    VWG       +  ++ + PV+AN+G L+   +  N  EV+  F  SL  L + +N GYT            Y +PVF    +   R+WGLTA+ T   L LL P +++
Sbjct:   24 RLRSRPAAAAVLVPLCLVRGVPALLYTLRSSRLVGRHKGEV----------------------SFPGGKCDPDDQDVIHTALRETQEELGLEVPKEHVWGVLQPVYDRE-KATIVPVLANVGPLDLQSLRPNLEEVDEVFEMSLAHLLQTQNQGYT---HFCQGGHFSYTLPVFLHGPH---RVWGLTAVITELTLKLLAPGFYQ 199          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9CR24|NUDT8_MOUSE (Nucleoside diphosphate-linked moiety X motif 8 OS=Mus musculus OX=10090 GN=Nudt8 PE=1 SV=1)

HSP 1 Score: 104.375 bits (259), Expect = 9.596e-26
Identity = 67/205 (32.68%), Postives = 100/205 (48.78%), Query Frame = 3
Query:  126 NLFKNAKNAAVLIPLCVYNNKPSILFCQRSMK-VRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFK 737
             L      AAVL+PLC+    P++L+  RS + V  H+G+V                      SFPGG  + + + +I TALRETQEE+G+ +    VWG       +  ++ + PV+AN+G L+   +  N  EV+  F  SL  L + +N GYT            Y +PVF    +   R+WGLTA+ T   L LL P +++
Sbjct:   24 RLRSRPAAAAVLVPLCLVRGVPALLYTLRSSRLVGRHKGEV----------------------SFPGGKCDPDDQDVIHTALRETQEELGLEVPKEHVWGVLQPVYDRE-KATIVPVLANVGPLDLQSLRPNLEEVDEVFEMSLAHLLQTQNQGYT---HFCQGGHFSYTLPVFLHGPH---RVWGLTAVITELTLKLLAPGFYQ 199          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8WV74|NUDT8_HUMAN (Nucleoside diphosphate-linked moiety X motif 8 OS=Homo sapiens OX=9606 GN=NUDT8 PE=1 SV=2)

HSP 1 Score: 98.2117 bits (243), Expect = 4.291e-23
Identity = 66/205 (32.20%), Postives = 100/205 (48.78%), Query Frame = 3
Query:  126 NLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRS-HRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFK 737
             L     +AAVL+PLC     P++L+  RS ++   H+G V                      SFPGG  +   + ++ TALRET+EE+G+++ +  VWG          ++ V PV+A +G L+   +  NS EV+  FA  L  L + +N GYT   F      + Y +PVF   +    R+WGLTA+ T   L LL P  ++
Sbjct:   24 RLRARPASAAVLVPLCSVRGVPALLYTLRSSRLTGRHKGDV----------------------SFPGGKCDPADQDVVHTALRETREELGLAVPEEHVWGLLRPVYDPQ-KATVVPVLAGVGPLDPQSLRPNSEEVDEVFALPLAHLLQTQNQGYT--HFCRGGHFR-YTLPVF--LHGPH-RVWGLTAVITEFALQLLAPGTYQ 199          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q23236|NDX3_CAEEL (Nudix hydrolase 3 OS=Caenorhabditis elegans OX=6239 GN=ndx-3 PE=3 SV=2)

HSP 1 Score: 94.7449 bits (234), Expect = 8.905e-22
Identity = 65/217 (29.95%), Postives = 102/217 (47.00%), Query Frame = 3
Query:  120 PKNLFKNAKNAA--VLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLN-WDKIIENSNEVNFTFARSLEFLC--------EPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFK 737
            P+ +  +  N+A  VLIPL   + + S+L  +RS+ +RSHRG+V                       FPGG  +  GE+  +TALRET EEIGV+ +  ++WG       +     VTP+V  I      + ++ NS+EV   F   ++ L         + K + YT+  F S      +  P    + +   R+WGL+ +  HQ L LL P+ +K
Sbjct:   41 PRLVSDSDANSAMSVLIPLVTVDGRDSVLLTKRSIHLRSHRGEV----------------------CFPGGRMDP-GETTTETALRETFEEIGVNAESVEIWGHLKSVIRRQADFNVTPIVGYISDERVLENLVVNSDEVQAVFTIPIDELIKKAGLTKFQSKRMKYTLPSFDSTEFKVHHNAP--NEYLHSTQRVWGLSGVMLHQALTLLNPDVYK 232          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q7N3M0|NUDL_PHOLL (Uncharacterized Nudix hydrolase NudL OS=Photorhabdus laumondii subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01) OX=243265 GN=nudL PE=3 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.652e-14
Identity = 66/221 (29.86%), Postives = 97/221 (43.89%), Query Frame = 3
Query:   48 METIYSFENKLIVQNKLKSFPPFLPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGY-TISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQF 707
            M ++  F N+     +L+  PP  PK L  N ++AAVL+P+ +   KP++L  +RS  +RSH GQV                      +FPGG+ +   +S+I TALRE +EE+ +  +   V G      S  G   VTP+V  +       +  N  EV   F   L       +  Y  +SR    +  +VY    F  +      IWGLTA   HQ 
Sbjct:    1 MISLSDFVNRF----QLQLPPP--PKRLSDNNRHAAVLLPI-ICKPKPTLLLTRRSATLRSHAGQV----------------------AFPGGVADPKDKSIIATALREAEEEVNIPHQKVQVLGQLAPLNSSGG-YLVTPIVGLLPP--GLSLHSNPAEVAKIFEVPLSEALSLSSYHYLDVSRRGQQH--RVY----FYWYQQHL--IWGLTATIIHQL 181          
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6D4L1|NUDL_PECAS (Uncharacterized Nudix hydrolase NudL OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=nudL PE=3 SV=1)

HSP 1 Score: 71.633 bits (174), Expect = 8.983e-14
Identity = 59/218 (27.06%), Postives = 91/218 (41.74%), Query Frame = 3
Query:   72 NKLIVQNKLKSFPPFLPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRF------SSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQF 707
            N  I + +L+  P   P +     + AAVL+P+  +   P++L  +RS  +R H GQV                      +FPGG  ++   S+I+TALRE QEE+ +  ++  V G      S +G   VTPVV  I      +   N +EV        E    P +  + ++R+            +VY       +   F  +WGLTA   HQ 
Sbjct:    9 NDFITRFQLQLPPSLRPVH---QQRQAAVLVPIICHPT-PTLLLTRRSADLRKHAGQV----------------------AFPGGAADKTDRSIIETALREAQEEVAIPPENVQVLGVLPPLDSVSG-FQVTPVVGLIAAQT--RFHPNEDEVA-------ELFEMPLDEAFALTRYYPLDIERKQQRHRVY----LSWYQQQF--VWGLTAAIIHQL 184          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: T1J0J8 (Nudix hydrolase domain-containing protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 8.614e-37
Identity = 94/215 (43.72%), Postives = 121/215 (56.28%), Query Frame = 3
Query:   93 KLKSFPPFLPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFK 737
            KL+ F P +P  LFK A   AVLIPLC YNN+  ILF  RS K+ SH GQV                      SFPGGM+E N  +L+ TALRET+EE+GV  +D DVWGS     S   +  V PVVA +G +  D+ ++ S EV   F RSL  LC+ +N G  +  F      K + IPV   FN +F +IWGLTA+  H+FL +LLP  ++
Sbjct:  158 KLRPFIP-IPDRLFKRA---AVLIPLCSYNNENGILFTLRSAKLGSHAGQV----------------------SFPGGMEESNDATLVNTALRETEEELGVKFEDVDVWGSLPTILSIR-KVAVLPVVAFVGAVEMDR-MKLSQEVEVVFVRSLRSLCDRRNFGTDL--FC-----KRFCIPV---FNGEF-KIWGLTAMILHRFLGVLLPGVYE 333          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: A0A1S3J0Y1 (uncharacterized protein LOC106169237 OS=Lingula unguis OX=7574 GN=LOC106169237 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.530e-35
Identity = 90/254 (35.43%), Postives = 132/254 (51.97%), Query Frame = 3
Query:   21 LIVKYLNSYMETIYSFENKLIVQNKL-------KSFPPFLPKN-----LFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQN-GQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNA---DKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYF 734
            +  K ++  +E I+S ENK+  Q  L       K      P       + + ++ AAVL+PLC  N  P+ILF  R+ ++ +HRGQV                      SFPGGM++E+  S++ TA+RE +EE+G+S    DVWG+    +S+N G   VTPVVA  G++  D +I N +EV   F +S+E LC P++ GYT  RF +         Y +P F G  +   RIWGLTA+  HQ L  + P  +
Sbjct:  179 IFTKKVDVSLENIFSSENKVRSQRALNTSGIEVKDEECAAPAKSIVIPIHQKSREAAVLVPLCTVNGVPAILFTLRTTRMNNHRGQV----------------------SFPGGMKDEDDGSIVDTAIREMEEELGISSSKIDVWGTLPTTSSKNDGSILVTPVVATCGEITEDSLIVNPHEVEEIFFQSIESLCNPEHQGYT--RFRTVIKPVYPNGYTLPAFTGGAH---RIWGLTAVVLHQTLRAIAPGIY 405          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: A0A0B6YAH6 (Nudix hydrolase domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF19079 PE=4 SV=1)

HSP 1 Score: 138.272 bits (347), Expect = 2.210e-35
Identity = 84/232 (36.21%), Postives = 119/232 (51.29%), Query Frame = 3
Query:   51 ETIYSFENKLIVQNKLKSFPPFLPKN---LFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFK 737
            E + S  NKL  Q KLK+  P        L +    AAVL+PLC  N +PS+LF  RS  ++ HRGQV                      SFPGG +EE+     QTALRET EE+G++    DVWG        +G+  + P++A   +++   +  N +EV   F  S++ LC+ +NIG T  RF   N    Y +PV+ G  +   RIWGLTA+  HQ L++L P  ++
Sbjct:   53 ENLLSDTNKLRAQQKLKAEIPVRTSKEYPLKQGHTYAAVLVPLCTVNGEPSMLFTLRSSSLKKHRGQV----------------------SFPGGNKEESDTDFTQTALRETHEELGIAASSFDVWGQMNPLPGSDGRKVIYPILARTAEVDVAHLNINHDEVEEAFCVSIKHLCDRRNIGAT--RF---NEGPGYTLPVYLGAPH---RIWGLTAVIVHQVLNILAPGMYE 254          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: A0A210PL21 (Nucleoside diphosphate-linked moiety X motif 8, mitochondrial OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT21293 PE=4 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 2.900e-34
Identity = 86/232 (37.07%), Postives = 125/232 (53.88%), Query Frame = 3
Query:   51 ETIYSFENKLIVQNKLKSFPPF---LPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCAS-QNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYF 734
            + I+S ENK  VQ KL +  P    +P++  +N K+AAVLIPLC  NN+PS+LF  RS KV  H+G+V                       FPGGM++     L QTALRET EE+G+ ++   +WG+     S ++G+  VTP +   G ++  K+  + +EV+  F R+L  LC+P N+G T  R         + +PVF G      RIWG+TA+  HQ L +L P  +
Sbjct:  115 QNIFSEENKCRVQRKLLTVKPVKRVVPQH--ENPKDAAVLIPLCYVNNEPSLLFMVRSWKVPVHKGEV----------------------CFPGGMKDATDLDLSQTALRETFEEMGLPMERVSLWGNMPKVPSKKDGKIQVTPYLGFCGDMDLSKLALDESEVDAVFTRTLASLCDPGNVGSTQFRAG-------FTLPVFLGGEL---RIWGMTAILLHQALTILAPGMY 312          
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Match: J3JWI8 (Nudix hydrolase domain-containing protein OS=Dendroctonus ponderosae OX=77166 PE=2 SV=1)

HSP 1 Score: 132.109 bits (331), Expect = 1.742e-33
Identity = 95/258 (36.82%), Postives = 132/258 (51.16%), Query Frame = 3
Query:    3 LFKKEALIVKYLNSYMETIYSFENKLIVQN---KLKSFPPFLPKNLFKNA--KNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANI-GKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISR--FSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPE--YFKGIE 746
            L K    ++K L     ++YS E  L  +N    +  F    P  +  +   K A VLIPLC+ + K +IL+  R+  ++SHRGQV                      SFPGGMQ+    +L QTALRET+EE+G+   + +VWGS G       ++ VTPV+  I G+     +  NS+EV   F   LE LC+P+N+GYT  R  F+S        +PVF G      R+WGLTAL T++FL  LLP   YF  I+
Sbjct:    2 LLKSRVSLLKKLGCRYSSLYSPEVILSDENIKRTVAKFSSMKPIRMIAHEPNKRAGVLIPLCLVDGKVAILYTLRAANLKSHRGQV----------------------SFPGGMQDVTDRNLEQTALRETEEELGIERTNIEVWGS-GNVIVTRLETSVTPVIGQIKGEYRKYDLKVNSSEVEDVFTVPLEDLCKPQNLGYTQFRGAFAS--------MPVFTGGKM---RVWGLTALLTYRFLSSLLPHQAYFHNIK 225          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Cavefish
Match: nudt8 (nudix hydrolase 8 [Source:NCBI gene;Acc:103046619])

HSP 1 Score: 112.849 bits (281), Expect = 3.817e-28
Identity = 78/222 (35.14%), Postives = 110/222 (49.55%), Query Frame = 3
Query:   63 SFENKLIVQNKLKSFPPFLPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRS-HRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLP 725
            S EN+   +N+LKS      K   KN   AAVL+ LC    +PS LF  RS K+R  H+G V                      SF GG ++ +  ++I TALRE +EE+G+++ ++ VWG        +G   + PV+AN+G +       N  EV   F  ++  LC P+N GYT  R   NN   VY +PV   F+N   +IWGLTA+     L L+ P
Sbjct:  224 SAENETRCRNRLKSNSALYEKEKEKN--RAAVLVSLCTVRGEPSFLFTLRSSKLRGRHKGDV----------------------SFAGGKRDPSDRNVIDTALREAKEELGITVTENVVWGVLKPLHDMSGM-MIAPVLANLGPVEALTFRPNPTEVEEIFTLTVAHLCNPQNQGYTNFR---NNDRHVYTLPV---FHNSKYKIWGLTAVALDHTLKLITP 414          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Cavefish
Match: nudt8 (nudix hydrolase 8 [Source:NCBI gene;Acc:103046619])

HSP 1 Score: 112.849 bits (281), Expect = 4.004e-28
Identity = 78/222 (35.14%), Postives = 110/222 (49.55%), Query Frame = 3
Query:   63 SFENKLIVQNKLKSFPPFLPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRS-HRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLP 725
            S EN+   +N+LKS      K   KN   AAVL+ LC    +PS LF  RS K+R  H+G V                      SF GG ++ +  ++I TALRE +EE+G+++ ++ VWG        +G   + PV+AN+G +       N  EV   F  ++  LC P+N GYT  R   NN   VY +PV   F+N   +IWGLTA+     L L+ P
Sbjct:  229 SAENETRCRNRLKSNSALYEKEKEKN--RAAVLVSLCTVRGEPSFLFTLRSSKLRGRHKGDV----------------------SFAGGKRDPSDRNVIDTALREAKEELGITVTENVVWGVLKPLHDMSGM-MIAPVLANLGPVEALTFRPNPTEVEEIFTLTVAHLCNPQNQGYTNFR---NNDRHVYTLPV---FHNSKYKIWGLTAVALDHTLKLITP 419          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-234i14.6 (si:dkey-234i14.6 [Source:ZFIN;Acc:ZDB-GENE-131121-173])

HSP 1 Score: 61.2326 bits (147), Expect = 2.848e-10
Identity = 54/183 (29.51%), Postives = 79/183 (43.17%), Query Frame = 3
Query:  144 KNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKN-IGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTA 689
            + A+VLIPL        +L   RS++++ + G+V                       FPGG  + N    I TALRE +EEIG+     +V   F    +Q G   VTPVV  I +    +   N  EV+  F+  +EF  +  N   Y ++  S      +Y  PV     +   +IWGLTA
Sbjct:   28 QKASVLIPLFFRGGDLHVLMTVRSIELKHNAGEVC----------------------FPGGKSDRNDTDEIHTALREAEEEIGLPPVGVEVVCRFTPILNQRGL-LVTPVVGFISESFSAR--PNPAEVSDVFSVPVEFFLKDANHTAYPVANISGMTHSFIYTDPV----TDKIHQIWGLTA 181          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Sea Lamprey
Match: nudt8 (nudix (nucleoside diphosphate linked moiety X)-type motif 8 [Source:ZFIN;Acc:ZDB-GENE-061013-219])

HSP 1 Score: 105.916 bits (263), Expect = 9.764e-28
Identity = 68/200 (34.00%), Postives = 98/200 (49.00%), Query Frame = 3
Query:  138 NAKNAAVLIPLCVYNNKPSILFCQRSMKVRS-HRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYF 734
            N  +AAVL+ LC +  +PS+L   RS  +   H G V                       FPGG QEE     + TALRE +EE+GV +    VWG         G+  V PV+A++G+++ D +  N +EV   F  SL  LC+P + GYT  RF +      Y +P+F   ++   R+WGLT +   Q L  LLP+ +
Sbjct:   47 NRVDAAVLVSLCRHAGEPSVLLTLRSRTMPGRHSGDV----------------------CFPGGKQEEGDRDAVATALREAREELGVDVSVDSVWGLLTPVPDVTGKMLVWPVLADLGEVDPDALNPNPDEVEEAFLVSLRHLCDPAHQGYT--RFRARGGRYAYTLPLFSTGHH---RVWGLTGVLLDQALAALLPDVY 219          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Sea Lamprey
Match: nudt7 (nudix (nucleoside diphosphate linked moiety X)-type motif 7 [Source:ZFIN;Acc:ZDB-GENE-131127-212])

HSP 1 Score: 62.7734 bits (151), Expect = 6.883e-12
Identity = 55/198 (27.78%), Postives = 85/198 (42.93%), Query Frame = 3
Query:  147 NAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDF-------------P--RIWGLTALF 695
             A+VL+PL ++N +P +L   RS ++R+++G+V                       FPGG Q+   +  I TALRE QEEIG++    +V   F    +  G   VTPVV  +      K   N +EV+  F   L     P            N++D+++ +P    FN  +             P   IWGLT++ 
Sbjct:   29 RASVLVPLFLWNGEPHVLLTVRSEQLRTNKGEV----------------------CFPGGKQDPQDQDEIATALREAQEEIGLAPDQVEVVCQFVPIINLRG-LMVTPVVGFVPSDFEPK--PNPDEVSAIFHMPLAHFLSP-----------INHSDRMFTMPGGSTFNIHYFTYQEAKSGEAEGPSYEIWGLTSII 190          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Nematostella
Match: EDO31011 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ60])

HSP 1 Score: 97.4413 bits (241), Expect = 9.028e-24
Identity = 68/231 (29.44%), Postives = 110/231 (47.62%), Query Frame = 3
Query:   66 FENKLIVQNK---LKSFPPFLP-KNLFKNAK-NAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFKGI 743
             EN L  +NK   +K      P K L +  K  A VL+P C+ +NKPS+LF  RS ++ SH GQV                      SFPGG +++   SL+ TA+RET EE+G+  K  D+W S    + +  +  +T VV  IG+++ D +  N +EV+  F   L      +       R++      +  + + G +     ++WGLTA+   + L  LL  +++ +
Sbjct:   88 IENALKEENKERTIKHLQKMKPNKKLIERCKLQAGVLVPFCMVDNKPSVLFTLRSSRLASHSGQV----------------------SFPGGKKDDCDVSLVVTAMRETSEELGIDEKQIDIWASLTPISDRVDKYAITAVVGYIGEVDVDSLPFNHHEVSDVFTIPLSEAVRNR-------RYTKWKTGLIMPVFLSGRY-----KVWGLTAIMLDRTLDALLTGHYQMV 284          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Nematostella
Match: EDO49326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHD4])

HSP 1 Score: 55.0694 bits (131), Expect = 5.524e-9
Identity = 37/102 (36.27%), Postives = 50/102 (49.02%), Query Frame = 3
Query:   90 NKLKSFPPFLPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGV 395
            NK KS     P+N       AAVLI L   NNK  +   +RS  +RSH+GQV                       FPGG  +++ + +++TALRE QEEIG+
Sbjct:   28 NKGKSTRTVYPRNF----SIAAVLILLVFKNNKFYLRLTRRSENLRSHKGQV----------------------VFPGGKNDDSDQDIVETALREAQEEIGL 103          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Medaka
Match: nudt8 (nudix hydrolase 8 [Source:NCBI gene;Acc:101160090])

HSP 1 Score: 98.2117 bits (243), Expect = 5.222e-23
Identity = 65/194 (33.51%), Postives = 93/194 (47.94%), Query Frame = 3
Query:  150 AAVLIPLCVYNNKPSILFCQRSMKVRS-HRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKV-YKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLP 725
            A++L+ LC    +PS+LF  RS  ++  H+G V                      SF GG  + +   ++ TALRE +EE+G+ +    VWG        +G   + PV+AN+G L       N  EV+  F  SL  LC+P+N GYT  R      DK  Y +PV   F N   R+WGLTA+     L L++P
Sbjct:  222 ASILVALCCSGGQPSVLFTLRSCTLKGRHKGDV----------------------SFAGGKSDPSDRDVVATALREAREELGIKVPREKVWGILKPLRDASGM-MIVPVLANLGPLEELTFKPNPEEVDEIFTLSLSHLCDPQNRGYTHFR----TGDKYGYTLPV---FRNGKHRVWGLTAVALDHTLKLIVP 385          
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Medaka
Match: nudt7 (nudix hydrolase 7 [Source:NCBI gene;Acc:101161308])

HSP 1 Score: 56.6102 bits (135), Expect = 4.067e-9
Identity = 59/217 (27.19%), Postives = 90/217 (41.47%), Query Frame = 3
Query:  111 PFLPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLL---PEYFKGIELN 752
            P LPK        A+VLIPL V  ++   L   RS ++R+  G+V                       FPGG ++    S + TALRE +EEIG+   D  V  +     +++G   VTPVV  I +        N  EV+  F+  L F    K+  + ++  +      ++    +   +     IWGLTA+       L L   PE+  G +L 
Sbjct:   24 PVLPK--------ASVLIPLFVRGDELHTLMTLRSEELRTSAGEV----------------------CFPGGKRDPGDRSDVDTALREAEEEIGLLPDDVLVVCTLFPIVNKSGL-LVTPVVGFIDETFSPS--PNPAEVSAVFSVPLGFFTREKD--HFVAHSAPGMMGPLHSFHFWDPASGCLHHIWGLTAMLAILVATLALQKKPEFDVGFDLE 205          
BLAST of Nudix hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000032411.1 (SMESG000032411.1)

HSP 1 Score: 428.328 bits (1100), Expect = 1.248e-153
Identity = 214/237 (90.30%), Postives = 214/237 (90.30%), Query Frame = 3
Query:   48 METIYSFENKLIVQNKLKSFPPFLPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFKGIELNLG 758
            METIYSFENKLIVQNKLKSFPPFLPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQV                       FPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFKGIELNLG
Sbjct:    1 METIYSFENKLIVQNKLKSFPPFLPKNLFKNAKNAAVLIPLCVYNNKPSILFCQRSMKVRSHRGQV----------------------CFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFKGIELNLG 215          
BLAST of Nudix hydrolase domain-containing protein vs. Planmine SMEST
Match: SMESG000032411.1 (SMESG000032411.1)

HSP 1 Score: 316.235 bits (809), Expect = 3.444e-110
Identity = 158/181 (87.29%), Postives = 158/181 (87.29%), Query Frame = 3
Query:  216 MKVRSHRGQVW**FPIISTNAYV*IVHVFYGNSFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFKGIELNLG 758
            MKVRSHRGQV                       FPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFKGIELNLG
Sbjct:    1 MKVRSHRGQV----------------------CFPGGMQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVVANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKVYKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFKGIELNLG 159          
The following BLAST results are available for this feature:
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NUDT88.935e-2432.20nudix hydrolase 8 [Source:HGNC Symbol;Acc:HGNC:805... [more]
NUDT81.191e-1430.43nudix hydrolase 8 [Source:HGNC Symbol;Acc:HGNC:805... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndx-37.001e-2329.95Nudix hydrolase 3 [Source:UniProtKB/Swiss-Prot;Ac... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG110954.542e-2132.00gene:FBgn0030528 transcript:FBtr0073827[more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nudt88.402e-2731.03nudix (nucleoside diphosphate linked moiety X)-typ... [more]
nudt72.373e-1128.24nudix (nucleoside diphosphate linked moiety X)-typ... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dis31.800e-2730.74DIS3 homolog, exosome endoribonuclease and 3'-5' e... [more]
itsn18.549e-1230.07intersectin 1 [Source:Xenbase;Acc:XB-GENE-5904194][more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Nudt81.372e-2632.68nudix (nucleoside diphosphate linked moiety X)-typ... [more]
Gm494051.372e-2632.68predicted gene, 49405 [Source:MGI Symbol;Acc:MGI:6... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9CR24|NUDT8_MOUSE9.596e-2632.68Nucleoside diphosphate-linked moiety X motif 8 OS=... [more]
sp|Q8WV74|NUDT8_HUMAN4.291e-2332.20Nucleoside diphosphate-linked moiety X motif 8 OS=... [more]
sp|Q23236|NDX3_CAEEL8.905e-2229.95Nudix hydrolase 3 OS=Caenorhabditis elegans OX=623... [more]
sp|Q7N3M0|NUDL_PHOLL2.652e-1429.86Uncharacterized Nudix hydrolase NudL OS=Photorhabd... [more]
sp|Q6D4L1|NUDL_PECAS8.983e-1427.06Uncharacterized Nudix hydrolase NudL OS=Pectobacte... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1J0J88.614e-3743.72Nudix hydrolase domain-containing protein OS=Strig... [more]
A0A1S3J0Y11.530e-3535.43uncharacterized protein LOC106169237 OS=Lingula un... [more]
A0A0B6YAH62.210e-3536.21Nudix hydrolase domain-containing protein (Fragmen... [more]
A0A210PL212.900e-3437.07Nucleoside diphosphate-linked moiety X motif 8, mi... [more]
J3JWI81.742e-3336.82Nudix hydrolase domain-containing protein OS=Dendr... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nudt83.817e-2835.14nudix hydrolase 8 [Source:NCBI gene;Acc:103046619][more]
nudt84.004e-2835.14nudix hydrolase 8 [Source:NCBI gene;Acc:103046619][more]
si:dkey-234i14.62.848e-1029.51si:dkey-234i14.6 [Source:ZFIN;Acc:ZDB-GENE-131121-... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nudt89.764e-2834.00nudix (nucleoside diphosphate linked moiety X)-typ... [more]
nudt76.883e-1227.78nudix (nucleoside diphosphate linked moiety X)-typ... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO310119.028e-2429.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493265.524e-936.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
nudt85.222e-2333.51nudix hydrolase 8 [Source:NCBI gene;Acc:101160090][more]
nudt74.067e-927.19nudix hydrolase 7 [Source:NCBI gene;Acc:101161308][more]
back to top
BLAST of Nudix hydrolase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000032411.11.248e-15390.30SMESG000032411.1[more]
SMESG000032411.13.444e-11087.29SMESG000032411.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031757 ID=SMED30031757|Name=Nudix hydrolase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=880bp
ATTTGTTTAAAAAAGAAGCACTTATTGTGAAATATTTGAACAGTTATATG
GAAACTATTTATTCGTTCGAAAATAAATTAATTGTTCAAAATAAGCTCAA
AAGCTTTCCTCCATTTCTTCCAAAAAACCTTTTCAAGAACGCAAAAAATG
CTGCTGTGCTTATTCCCCTTTGTGTGTATAATAACAAACCATCTATATTA
TTTTGTCAACGATCAATGAAAGTTAGAAGTCACAGGGGTCAAGTTTGGTA
ATAGTTTCCGATTATTTCAACAAATGCTTATGTATAAATTGTGCATGTCT
TCTACGGTAATAGTTTTCCTGGGGGTATGCAAGAAGAAAATGGTGAGTCT
TTAATTCAAACTGCTTTGAGAGAAACTCAAGAAGAAATAGGAGTTAGTTT
AAAAGATTCAGATGTTTGGGGAAGTTTTGGAGGTTGTGCTTCACAAAATG
GTCAGTCTTATGTAACTCCAGTAGTTGCAAATATTGGTAAACTAAATTGG
GATAAAATTATTGAGAATTCAAATGAAGTTAATTTTACTTTTGCTAGAAG
TCTTGAATTTTTATGTGAACCAAAAAATATTGGTTATACAATTTCTAGGT
TCAGTTCTAATAATGCTGATAAAGTATATAAAATTCCAGTATTTGGTGGT
TTCAATAATGATTTCCCTCGAATTTGGGGTTTGACTGCATTGTTCACCCA
TCAGTTCTTACATTTATTACTGCCAGAATATTTTAAAGGCATTGAATTAA
ACTTAGGATAACGAATTTGTTTATTATTATTCATTTAAAATATTTTTAAT
TGAAAATTAAATTGCTAAATTATCGTTTTTGTTGAGTTATATAATTAAAG
ATAATTTTGTTGGATTTTTAAATAAAGCTC
back to top

protein sequence of SMED30031757-orf-1

>SMED30031757-orf-1 ID=SMED30031757-orf-1|Name=SMED30031757-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=145bp
MQEENGESLIQTALRETQEEIGVSLKDSDVWGSFGGCASQNGQSYVTPVV
ANIGKLNWDKIIENSNEVNFTFARSLEFLCEPKNIGYTISRFSSNNADKV
YKIPVFGGFNNDFPRIWGLTALFTHQFLHLLLPEYFKGIELNLG*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000418head
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR015797NUDIX_hydrolase-like_dom_sf
IPR000086NUDIX_hydrolase_dom
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000086NUDIX hydrolase domainPFAMPF00293NUDIXcoord: 4..42
e-value: 1.8E-4
score: 21.6
NoneNo IPR availableGENE3DG3DSA:3.90.79.10coord: 2..129
e-value: 2.7E-18
score: 68.3
NoneNo IPR availablePANTHERPTHR12992:SF11NUCLEOSIDE DIPHOSPHATE-LINKED MOIETY X MOTIF 8coord: 4..135
NoneNo IPR availablePANTHERPTHR12992MUTT-NUDIX-RELATEDcoord: 4..135
IPR015797NUDIX hydrolase-like domain superfamilySUPERFAMILYSSF55811Nudixcoord: 4..124