WD repeat-containing protein 34

Overview
NameWD repeat-containing protein 34
Smed IDSMED30031755
Length (bp)1642
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of WD repeat-containing protein 34 (SMED30031755) t-SNE clustered cells

Violin plots show distribution of expression levels for WD repeat-containing protein 34 (SMED30031755) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of WD repeat-containing protein 34 (SMED30031755) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for WD repeat-containing protein 34 (SMED30031755) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031755

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30031755SMESG000051100.1 SmedASXL_015026SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30031755SMESG000051100.1 Contig13181newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031755SMESG000051100.1 Contig13181uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30031755SMESG000051100.1 dd_Smed_v6_14428_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30031755SMESG000051100.1 dd_Smed_v4_14428_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of WD repeat-containing protein 34 vs. Ensembl Human
Match: WDR34 (WD repeat domain 34 [Source:HGNC Symbol;Acc:HGNC:28296])

HSP 1 Score: 153.295 bits (386), Expect = 1.104e-39
Identity = 105/477 (22.01%), Postives = 216/477 (45.28%), Query Frame = 3
Query:  168 KKHRSSECQTDSYLYVEEDIHPDVDESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTVNGDIKESM--CLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRY----RGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENRSKN 1580
            + H  ++ QT++ + V        D   L  F+++V   + + L  N +S+AF+  + VN   ++ M  CLY +     +    +V+ +SWN  G+V+A A+G + H  W     + +  ++L  R+ +    +P  ++E  +   C+ FH    S +  G ++GE++VWD SR E+ L+  +   +  H +P++ ++W    G   S  + ++S+  DG +++W   +    L     + L  + LP+S +     RG      + +  + +  D    ++G+E G    C++    ++ +       +++P +   +   G ++ V  S    N   +    G +++Y++     +++++    YL+ +  SP+ P +   +   G + L +  +++                   KP  TVL    +   +D   + C+EFN Q    +AA D  GT+ +WQLS   TE   + 
Sbjct:   80 RNHVDAQVQTEAPVPVSVQPPSQYDIPRLAAFLRRVEAMVIRELNKNWQSHAFDGFE-VNWTEQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWST-LKSFVCAWNLDRRDLR--PQQPSAVVEVPSAVLCLAFHPTQPSHVAGGLYSGEVLVWDLSRLEDPLLWRTGLTDDTHTDPVSQVVWLPEPGH--SHRFQVLSVATDGKVLLWQ-GIGVGQLQLTEGFALVMQQLPRSTKLKKHPRGETEVGATAV--AFSSFDPRLFILGTEGGFPLKCSLAAGEAALTRMPSSVPLRAPAQFTFSPHGGPIYSVSCSPFHRNLFLSAGTDGHVHLYSMLQAPPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSS------------------QKP--TVL----IKQTQDESPVYCLEFNSQQTQLLAAGDAQGTVKVWQLSTEFTEQGPRE 523          
BLAST of WD repeat-containing protein 34 vs. Ensembl Human
Match: DNAI2 (dynein axonemal intermediate chain 2 [Source:HGNC Symbol;Acc:HGNC:18744])

HSP 1 Score: 64.6994 bits (156), Expect = 2.727e-10
Identity = 72/330 (21.82%), Postives = 144/330 (43.64%), Query Frame = 3
Query:  411 KNVSQLSWNCNG-TVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNL-SMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDH 1382
            +  + LSW+ +G   LA A+  +   +  V  ++   I+ L   NK      P+  L+ ++    ++F+   + +++ G +NG+I  WD  +    L+   S+    H++P+   +W  +  KT +  +   S   DG ++ W++  M + T + +        D+ K  +   +L  ++S+   S  P      ++G+E G++  CN K K+S+              E ++ T     G ++ +Q +     NF+     T  I+  +   +  I   +    YL D + SP+ P +  T+  +GTL + +F+      T  LK  D 
Sbjct:  163 RAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNK------PELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKG--SLVAELSTIESSHRDPVYGTIW--LQSKTGTECF---SASTDGQVMWWDIRKMSEPTEVVI-------LDITKKEQLENALG-AISLEFESTLPTK---FMVGTEQGIVISCNRKAKTSA--------------EKIVCTFPGHHGPIYALQRNPFYPKNFLTVGDWTARIWSED-SRESSIMWTKYHMAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDPTLSLKVCDE 453          
BLAST of WD repeat-containing protein 34 vs. Ensembl Human
Match: DNAI2 (dynein axonemal intermediate chain 2 [Source:HGNC Symbol;Acc:HGNC:18744])

HSP 1 Score: 64.6994 bits (156), Expect = 2.727e-10
Identity = 72/330 (21.82%), Postives = 144/330 (43.64%), Query Frame = 3
Query:  411 KNVSQLSWNCNG-TVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNL-SMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDH 1382
            +  + LSW+ +G   LA A+  +   +  V  ++   I+ L   NK      P+  L+ ++    ++F+   + +++ G +NG+I  WD  +    L+   S+    H++P+   +W  +  KT +  +   S   DG ++ W++  M + T + +        D+ K  +   +L  ++S+   S  P      ++G+E G++  CN K K+S+              E ++ T     G ++ +Q +     NF+     T  I+  +   +  I   +    YL D + SP+ P +  T+  +GTL + +F+      T  LK  D 
Sbjct:  163 RAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNK------PELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKG--SLVAELSTIESSHRDPVYGTIW--LQSKTGTECF---SASTDGQVMWWDIRKMSEPTEVVI-------LDITKKEQLENALG-AISLEFESTLPTK---FMVGTEQGIVISCNRKAKTSA--------------EKIVCTFPGHHGPIYALQRNPFYPKNFLTVGDWTARIWSED-SRESSIMWTKYHMAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDPTLSLKVCDE 453          
BLAST of WD repeat-containing protein 34 vs. Ensembl Human
Match: DNAI2 (dynein axonemal intermediate chain 2 [Source:HGNC Symbol;Acc:HGNC:18744])

HSP 1 Score: 64.3142 bits (155), Expect = 3.090e-10
Identity = 71/327 (21.71%), Postives = 144/327 (44.04%), Query Frame = 3
Query:  411 KNVSQLSWNCNG-TVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNL-SMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKN 1373
            +  + LSW+ +G   LA A+  +   +  V  ++   I+ L   NK      P+  L+ ++    ++F+   + +++ G +NG+I  WD  +    L+   S+    H++P+   +W  +  KT +  +   S   DG ++ W++  M + T + +        D+ K  +   +L  ++S+   S  P      ++G+E G++  CN K K+S+              E ++ T     G ++ +Q +     NF+     T  I+  +   +  I   +    YL D + SP+ P +  T+  +GTL + +F+      T  LK+
Sbjct:  163 RAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNK------PELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKG--SLVAELSTIESSHRDPVYGTIW--LQSKTGTECF---SASTDGQVMWWDIRKMSEPTEVVI-------LDITKKEQLENALG-AISLEFESTLPTK---FMVGTEQGIVISCNRKAKTSA--------------EKIVCTFPGHHGPIYALQRNPFYPKNFLTVGDWTARIWSED-SRESSIMWTKYHMAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDPTLSLKD 450          
BLAST of WD repeat-containing protein 34 vs. Ensembl Human
Match: DNAI2 (dynein axonemal intermediate chain 2 [Source:HGNC Symbol;Acc:HGNC:18744])

HSP 1 Score: 63.929 bits (154), Expect = 4.346e-10
Identity = 74/330 (22.42%), Postives = 142/330 (43.03%), Query Frame = 3
Query:  411 KNVSQLSWNCNG-TVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNL-SMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDH 1382
            +  + LSW+ +G   LA A+  +   +  V  ++   I+ L   NK     KP + L T      ++F+   + +++ G +NG+I  WD  +    L+   S+    H++P+   +W  +  KT +  +   S   DG ++ W++  M + T +          D+ K  +   +L  ++S+   S  P      ++G+E G++  CN K K+S+              E ++ T     G ++ +Q +     NF+     T  I+  +   +  I   +    YL D + SP+ P +  T+  +GTL + +F+      T  LK  D 
Sbjct:  220 RAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNKPELALKPSSPLVT------LEFNPKDSHVLLGGCYNGQIACWDTRKG--SLVAELSTIESSHRDPVYGTIW--LQSKTGTECF---SASTDGQVMWWDIRKMSEPTEV-------VILDITKKEQLENALG-AISLEFESTLPTK---FMVGTEQGIVISCNRKAKTSA--------------EKIVCTFPGHHGPIYALQRNPFYPKNFLTVGDWTARIWSED-SRESSIMWTKYHMAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDPTLSLKVCDE 510          
BLAST of WD repeat-containing protein 34 vs. Ensembl Fly
Match: Dnai2 (gene:FBgn0036195 transcript:FBtr0332765)

HSP 1 Score: 64.3142 bits (155), Expect = 1.479e-10
Identity = 61/220 (27.73%), Postives = 104/220 (47.27%), Query Frame = 3
Query:  417 VSQLSWNCNGTV-LAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFE----DKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKV-HQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSI 1058
            V  LSW+ +G + +A +  D+             G  S    N  I+E    ++P   LE      C++++    + +V+G +NG++  WD    +  +++   SE +V H++P+NS+LW+N    T        S G+DG ++ W+   RK T  PL+R  +   D  KS     S S  +S+L            + G+E+G+LF CN K K+ +  I
Sbjct:  161 VKHLSWSPDGGIKMAVSHCDMRFQ----------GDKSNQKCNSYIWEVENPNEPFLTLEPKVPCVCLEYNQKDPTSLVSGMYNGQVAAWDTRHGKLPVMI---SEREVCHRDPVNSVLWNNSKSGTE-----FFSGGSDGQVLWWD--TRKLTE-PLDRLLM---DPVKSDDQDLSRSYGISVL--EYETTIPTRFMAGTEMGMLFSCNRKGKTPTEKI 354          
BLAST of WD repeat-containing protein 34 vs. Ensembl Fly
Match: Dnai2 (gene:FBgn0036195 transcript:FBtr0301326)

HSP 1 Score: 64.3142 bits (155), Expect = 1.488e-10
Identity = 61/220 (27.73%), Postives = 104/220 (47.27%), Query Frame = 3
Query:  417 VSQLSWNCNGTV-LAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFE----DKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKV-HQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSI 1058
            V  LSW+ +G + +A +  D+             G  S    N  I+E    ++P   LE      C++++    + +V+G +NG++  WD    +  +++   SE +V H++P+NS+LW+N    T        S G+DG ++ W+   RK T  PL+R  +   D  KS     S S  +S+L            + G+E+G+LF CN K K+ +  I
Sbjct:  161 VKHLSWSPDGGIKMAVSHCDMRFQ----------GDKSNQKCNSYIWEVENPNEPFLTLEPKVPCVCLEYNQKDPTSLVSGMYNGQVAAWDTRHGKLPVMI---SEREVCHRDPVNSVLWNNSKSGTE-----FFSGGSDGQVLWWD--TRKLTE-PLDRLLM---DPVKSDDQDLSRSYGISVL--EYETTIPTRFMAGTEMGMLFSCNRKGKTPTEKI 354          
BLAST of WD repeat-containing protein 34 vs. Ensembl Fly
Match: sw (gene:FBgn0003654 transcript:FBtr0089406)

HSP 1 Score: 59.3066 bits (142), Expect = 5.517e-9
Identity = 70/343 (20.41%), Postives = 142/343 (41.40%), Query Frame = 3
Query:  540 NKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISG-AVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTE 1565
            N K  +  P+ +    +      F  +  +LI+ GT++G+IV+WD    +   I  +      H  P+  +    + G   + N  ++S+ +DG +  W+L M      P +   L  R            SK+++I   +   N+   LV+GSE G ++       +S   + + + E+    E  L  I+G + H  Q S    +     S    I +++++  + + + E    Y+ D++ SP+ P L      +G L              +L NL+ ++E     P  +++          +  +N V +    + +V   D  G +Y++ +++NL +
Sbjct:  351 NTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCL---QMVGTQNAHN--VISISSDGKLCSWSLDMLSQ---PQDTLELQQRQ-----------SKAIAITSMAFPANEINSLVMGSEDGYVY------SASRHGLRSGVNEV---YERHLGPITGISTHYNQLSPDFGHLFLTSSIDWTIKLWSLKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGSGRL--------------DLWNLNQDTE----VPTASIVVAG-------APALNRVSWTPSGL-HVCIGDEAGKLYVYDVAENLAQ 639          
BLAST of WD repeat-containing protein 34 vs. Ensembl Fly
Match: sw (gene:FBgn0003654 transcript:FBtr0089407)

HSP 1 Score: 59.3066 bits (142), Expect = 5.968e-9
Identity = 70/343 (20.41%), Postives = 142/343 (41.40%), Query Frame = 3
Query:  540 NKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISG-AVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTE 1565
            N K  +  P+ +    +      F  +  +LI+ GT++G+IV+WD    +   I  +      H  P+  +    + G   + N  ++S+ +DG +  W+L M      P +   L  R            SK+++I   +   N+   LV+GSE G ++       +S   + + + E+    E  L  I+G + H  Q S    +     S    I +++++  + + + E    Y+ D++ SP+ P L      +G L              +L NL+ ++E     P  +++          +  +N V +    + +V   D  G +Y++ +++NL +
Sbjct:  341 NTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCL---QMVGTQNAHN--VISISSDGKLCSWSLDMLSQ---PQDTLELQQRQ-----------SKAIAITSMAFPANEINSLVMGSEDGYVY------SASRHGLRSGVNEV---YERHLGPITGISTHYNQLSPDFGHLFLTSSIDWTIKLWSLKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGSGRL--------------DLWNLNQDTE----VPTASIVVAG-------APALNRVSWTPSGL-HVCIGDEAGKLYVYDVAENLAQ 629          
BLAST of WD repeat-containing protein 34 vs. Ensembl Fly
Match: sw (gene:FBgn0003654 transcript:FBtr0089401)

HSP 1 Score: 59.3066 bits (142), Expect = 6.676e-9
Identity = 70/343 (20.41%), Postives = 142/343 (41.40%), Query Frame = 3
Query:  540 NKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISG-AVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTE 1565
            N K  +  P+ +    +      F  +  +LI+ GT++G+IV+WD    +   I  +      H  P+  +    + G   + N  ++S+ +DG +  W+L M      P +   L  R            SK+++I   +   N+   LV+GSE G ++       +S   + + + E+    E  L  I+G + H  Q S    +     S    I +++++  + + + E    Y+ D++ SP+ P L      +G L              +L NL+ ++E     P  +++          +  +N V +    + +V   D  G +Y++ +++NL +
Sbjct:  330 NTKFKKSTPEDVFHCQSAVMSTCFAKFNPNLILGGTYSGQIVLWDNRVQKRTPIQRTPLSAAAHTHPVYCL---QMVGTQNAHN--VISISSDGKLCSWSLDMLSQ---PQDTLELQQRQ-----------SKAIAITSMAFPANEINSLVMGSEDGYVY------SASRHGLRSGVNEV---YERHLGPITGISTHYNQLSPDFGHLFLTSSIDWTIKLWSLKDTKPLYSFEDNSDYVMDVAWSPVHPALFAAVDGSGRL--------------DLWNLNQDTE----VPTASIVVAG-------APALNRVSWTPSGL-HVCIGDEAGKLYVYDVAENLAQ 618          
BLAST of WD repeat-containing protein 34 vs. Ensembl Zebrafish
Match: wdr34 (WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-070928-9])

HSP 1 Score: 169.474 bits (428), Expect = 5.193e-46
Identity = 119/516 (23.06%), Postives = 255/516 (49.42%), Query Frame = 3
Query:   96 RNCSTKEF-TTQTDTYKIIHRGLNIKKHRS-SECQTDSYLYVEEDIHPDVDESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTVNGDIKESM-CLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENK-VHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKS---IRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGN-ELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENRSKNPTKNSEIHNQFSN 1619
            R+C T+   TT+T+T     +  ++ ++ + ++ Q+   L ++ D+    D   L  F+++    + + L+ N +S+AF+  +    +  ES+ C+Y++++   +     V+ +SWNC G+V+A  FG +    W   +N    + + +   + +   +PD +++  T   C+ FH    S++  G ++GE+VVWD SR++ DLILA +  +   H+EP+  I W  V G      + ++S G+ G +++W +   ++ L+  + Y L  + +P+S    + RGSL  ++ +   +L+P D +  ++GSE G++  C+   +++++   + E   +++P +   +   G +H V +S    N   ++   G+ ++++V     + A+     Y++ +  SP  P +       G + + +    +L     +  +D N+     +P Y                  C+EFN ++   +A  + +G++ IWQLS  LTE  +K      ++ N+ ++
Sbjct:   27 RSCQTRPVHTTETET-----QAKDVSENGTQTQDQSGQTLSLDRDL---TDFPGLLDFMRRAEDVVIRELVKNSKSHAFDGFEVNWEEQNESVSCMYRLQHVDAQEKSLQVTSVSWNCTGSVIACGFGRVDDGDW---SNEKACVCTWNVDRQNLNPKRPDVIIDVATPVMCLCFHPVRPSVVAGGLYSGEVVVWDTSRSQ-DLILAQTGMSADTHREPVYQINW--VPGAR-RGEFSVLSAGSGGRVLLWTIDGSEAKLLLSSGYALVRQQMPQSGAASKTRGSL--TIGVTAVALSPWDLDTFLVGSEGGLVLKCSFSSETAAAVPSDGESVILRAPMQFSFSPRGGPIHSVHFSPFHRNLFVSVGTDGLAHLHSVLQPCPLLALRVSDSYVFGVRWSPTRPLVFAAVTGQGLVQMFDLGRRSL---RPVATIDQNAG---GQPAY------------------CLEFNPKHTNLLAVGNADGSVNIWQLSAELTEQGAKETAMLEQLANEVAD 501          
BLAST of WD repeat-containing protein 34 vs. Ensembl Zebrafish
Match: dync1i1 (dynein, cytoplasmic 1, intermediate chain 1 [Source:ZFIN;Acc:ZDB-GENE-061215-62])

HSP 1 Score: 70.4774 bits (171), Expect = 2.726e-12
Identity = 59/265 (22.26%), Postives = 110/265 (41.51%), Query Frame = 3
Query:  540 NKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNF 1334
            N K  +  P+ +    +    V F  +  +L++ GT++G+I +WD        +  +      H  P+  +   NV G   ++N  L+++  DG +  W+L M                   +S+    + SK +++ C +   +D    V+GSE G ++  +     S + IG      + P   +  +   AV  V +S L        S    + +++ +H + + + E    Y+YD+  SP+ P L  T   NG L L N 
Sbjct:  307 NMKFKKATPEYIFHCQSSVMSVGFAQFHPNLVIGGTYSGQIAMWDNRSHRRTPVQRTPLSATAHTHPVYCV---NVVGTQNANN--LITVSTDGKMCSWSLDMLSQPQ--------------ESMELIYNKSKPVAVTCMAFPASDVNNYVVGSEEGTVYTAS--RHGSKAGIGEIFDGHQGPVTGI--SCHNAVGPVDFSHLFTT----SSFDWTVKLWSTKHNKPLYSFEDNADYVYDVMWSPVHPALFATVDGNGRLDLWNL 544          
BLAST of WD repeat-containing protein 34 vs. Ensembl Zebrafish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 63.5438 bits (153), Expect = 3.344e-10
Identity = 65/314 (20.70%), Postives = 133/314 (42.36%), Query Frame = 3
Query:  411 KNVSQLSWNCNGT-VLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFL 1337
            +  + LSW+ +G   LA A+  +   +     N    I+ +   NK      P+  L+      C++++   + +++ G++NG+I  WD  +    + ++    +  H++P+   +W  +  KT +    + S   DG ++ W++  RK +  P  R  +           +G++  SL  +            ++G+E G++  CN K               K+P E ++ T S   G V+ +Q +     NF+     T  I+  +++ +  I   +    +L D   SP+ P +  T   +GTL + + L
Sbjct:  165 RTATSLSWHPDGNHKLAVAYSSLEFQRAPNDMNFDSYIWDIENPNK------PEMTLKPVCPLVCLEYNPKDSHILIGGSYNGQIAYWDTRKGSQPVEMSPIEFS--HRDPVYKAIW--LQSKTGTD---IFSASTDGQVLWWDI--RKMSE-PTERLVMDPTK-------KGNIDNSLGAISLEFETTMPTKFMVGTEQGLVVSCNRK--------------AKTPAEKIVCTYSGHHGPVYALQRNPFFPKNFLTVGDWTARIWSEDIK-ESSIMWTKYHIAHLLDGCWSPVRPSVFFTVKMDGTLDVWDIL 440          
BLAST of WD repeat-containing protein 34 vs. Ensembl Zebrafish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 63.5438 bits (153), Expect = 4.104e-10
Identity = 65/314 (20.70%), Postives = 133/314 (42.36%), Query Frame = 3
Query:  411 KNVSQLSWNCNGT-VLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFL 1337
            +  + LSW+ +G   LA A+  +   +     N    I+ +   NK      P+  L+      C++++   + +++ G++NG+I  WD  +    + ++    +  H++P+   +W  +  KT +    + S   DG ++ W++  RK +  P  R  +           +G++  SL  +            ++G+E G++  CN K               K+P E ++ T S   G V+ +Q +     NF+     T  I+  +++ +  I   +    +L D   SP+ P +  T   +GTL + + L
Sbjct:  165 RTATSLSWHPDGNHKLAVAYSSLEFQRAPNDMNFDSYIWDIENPNK------PEMTLKPVCPLVCLEYNPKDSHILIGGSYNGQIAYWDTRKGSQPVEMSPIEFS--HRDPVYKAIW--LQSKTGTD---IFSASTDGQVLWWDI--RKMSE-PTERLVMDPTK-------KGNIDNSLGAISLEFETTMPTKFMVGTEQGLVVSCNRK--------------AKTPAEKIVCTYSGHHGPVYALQRNPFFPKNFLTVGDWTARIWSEDIK-ESSIMWTKYHIAHLLDGCWSPVRPSVFFTVKMDGTLDVWDIL 440          
BLAST of WD repeat-containing protein 34 vs. Ensembl Zebrafish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 60.4622 bits (145), Expect = 2.568e-9
Identity = 64/314 (20.38%), Postives = 134/314 (42.68%), Query Frame = 3
Query:  411 KNVSQLSWNCNGT-VLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFL 1337
            +  + LSW+ +G   LA A+  +   +     N    I+ +   NK      P+  L+      C++++   + +++ G++NG+I  WD  +    + ++    +  H++P+   +W  +  KT +    + S   DG ++ W++  RK +  P  R  +           +G++  SL  +            ++G+E G++  CN              ++ K+P E ++ T S   G V+ +Q +     NF+     T  I+  +++ +  I   +    +L D   SP+ P +  T   +GTL + + L
Sbjct:   23 RTATSLSWHPDGNHKLAVAYSSLEFQRAPNDMNFDSYIWDIENPNK------PEMTLKPVCPLVCLEYNPKDSHILIGGSYNGQIAYWDTRKGSQPVEMSPIEFS--HRDPVYKAIW--LQSKTGTD---IFSASTDGQVLWWDI--RKMSE-PTERLVMDPTK-------KGNIDNSLGAISLEFETTMPTKFMVGTEQGLVVSCN--------------RKAKTPAEKIVCTYSGHHGPVYALQRNPFFPKNFLTVGDWTARIWSEDIK-ESSIMWTKYHIAHLLDGCWSPVRPSVFFTVKMDGTLDVWDIL 298          
BLAST of WD repeat-containing protein 34 vs. Ensembl Xenopus
Match: rwdd2b (RWD domain containing 2B [Source:Xenbase;Acc:XB-GENE-963133])

HSP 1 Score: 153.68 bits (387), Expect = 4.722e-40
Identity = 107/467 (22.91%), Postives = 216/467 (46.25%), Query Frame = 3
Query:  222 DIHPDVDESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTVNGDIKESM-CLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPK--SIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSS-SIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENRSKNPTKNSEIHNQ 1610
            D+ P +D  +L  F+K+V   + K L  N +S+AF+  +    +  E + CL+ ++          V+ +SWN  G+++A ++G      W    +  +  ++L  R      + PDT+L+  +   C+ +H    SLI  G  NG+++VWD SR ++ LI  +      H + +  + W  +  K+    + + S+ +DG I++W +  ++  L+ L+ + L A+ +P    I   G    ++ + C S +  D    ++G E G L  C+  +++ +  ++G+ +  +++P +   +   G V+ V  S    N   +    G  ++Y++   + + +++  Q YL+ +  SP+ P +   +  +G +VL++F +                  +  KP   +              + C+EFN      +AA D  GT+ IWQLS +  E R++      EI ++
Sbjct:   65 DLGPLLDYPDLGQFLKRVEGIMIKELNKNWKSHAFDGYEVNWEEQHEQVTCLHSLQYPDALEQQLQVTSVSWNSTGSIIACSYGRFGDGDWSTEKSY-VCTWNLDRRG--FNANNPDTVLDVPSSVMCLAWHPSQPSLIAGGLFNGDVLVWDTSRTDDPLIGRTGHVGDTHTDAVYQVGW--MQEKSQGHRHQVFSVSSDGKILVWQME-KEGHLVLLDGFALVAQQIPSNTKIHKPGRGDTAVGVTCLSYSHFDPSLFIVGVEGGYLLKCSSSVQTLAPINMGSSV-PLRAPAQFTFSPHGGPVYSVTCSPFHRNLFLSAGTDGHAHLYSMLQAKPLVSLQLSQKYLFSIRWSPVRPLVFAAASGDGEVVLVDFAK------------------SFQKPSLCI------KQTASGRPVYCLEFNHAQSQLLAAGDGTGTVKIWQLSSDFIEQRARETALLDEIASE 500          
BLAST of WD repeat-containing protein 34 vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 68.1662 bits (165), Expect = 1.876e-11
Identity = 68/323 (21.05%), Postives = 138/323 (42.72%), Query Frame = 3
Query:  411 KNVSQLSWNCNGTV-LAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFL--ENNLSFT 1358
            +  + LSW+ +G+  LA A+  +   +     +    I+ +   NK      P+  L+  +   C++++   + ++V G +NG+I  WD  +  N   + S+     H++P+  ++W  +  KT +  +   S   DG I+ W++   +    P  +  L        I  + +L  +L  +     P      ++G+E G++  CN K               K+P E ++ T     G ++ +Q +     NF+     T  I+  +   +  I   +    YL D   SP  P + +T+  +GTL + +++  +NN S +
Sbjct:  195 RTATHLSWHPDGSRKLAVAYSCLDFQRAPKDMSYESYIWDIEIPNK------PELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTRKGGNP--MESTVIEHSHRDPVYKVIW--LQSKTGTECF---SASTDGQILWWDI---RKLSEPTEKLIL-------DISKKENLDNALGAVSLEFEPTLPTKFMVGTEQGMIVSCNRK--------------AKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVGDWTARIWSEDC-RESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSLS 479          
BLAST of WD repeat-containing protein 34 vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 68.1662 bits (165), Expect = 2.003e-11
Identity = 68/323 (21.05%), Postives = 138/323 (42.72%), Query Frame = 3
Query:  411 KNVSQLSWNCNGTV-LAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFL--ENNLSFT 1358
            +  + LSW+ +G+  LA A+  +   +     +    I+ +   NK      P+  L+  +   C++++   + ++V G +NG+I  WD  +  N   + S+     H++P+  ++W  +  KT +  +   S   DG I+ W++   +    P  +  L        I  + +L  +L  +     P      ++G+E G++  CN K               K+P E ++ T     G ++ +Q +     NF+     T  I+  +   +  I   +    YL D   SP  P + +T+  +GTL + +++  +NN S +
Sbjct:  142 RTATHLSWHPDGSRKLAVAYSCLDFQRAPKDMSYESYIWDIEIPNK------PELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTRKGGNP--MESTVIEHSHRDPVYKVIW--LQSKTGTECF---SASTDGQILWWDI---RKLSEPTEKLIL-------DISKKENLDNALGAVSLEFEPTLPTKFMVGTEQGMIVSCNRK--------------AKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVGDWTARIWSEDC-RESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSLS 426          
BLAST of WD repeat-containing protein 34 vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 68.1662 bits (165), Expect = 2.068e-11
Identity = 68/323 (21.05%), Postives = 138/323 (42.72%), Query Frame = 3
Query:  411 KNVSQLSWNCNGTV-LAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFL--ENNLSFT 1358
            +  + LSW+ +G+  LA A+  +   +     +    I+ +   NK      P+  L+  +   C++++   + ++V G +NG+I  WD  +  N   + S+     H++P+  ++W  +  KT +  +   S   DG I+ W++   +    P  +  L        I  + +L  +L  +     P      ++G+E G++  CN K               K+P E ++ T     G ++ +Q +     NF+     T  I+  +   +  I   +    YL D   SP  P + +T+  +GTL + +++  +NN S +
Sbjct:  163 RTATHLSWHPDGSRKLAVAYSCLDFQRAPKDMSYESYIWDIEIPNK------PELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTRKGGNP--MESTVIEHSHRDPVYKVIW--LQSKTGTECF---SASTDGQILWWDI---RKLSEPTEKLIL-------DISKKENLDNALGAVSLEFEPTLPTKFMVGTEQGMIVSCNRK--------------AKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVGDWTARIWSEDC-RESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSLS 447          
BLAST of WD repeat-containing protein 34 vs. Ensembl Xenopus
Match: ogfod3 (2-oxoglutarate and iron-dependent oxygenase domain containing 3 [Source:Xenbase;Acc:XB-GENE-6457975])

HSP 1 Score: 68.1662 bits (165), Expect = 2.071e-11
Identity = 68/323 (21.05%), Postives = 138/323 (42.72%), Query Frame = 3
Query:  411 KNVSQLSWNCNGTV-LAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFL--ENNLSFT 1358
            +  + LSW+ +G+  LA A+  +   +     +    I+ +   NK      P+  L+  +   C++++   + ++V G +NG+I  WD  +  N   + S+     H++P+  ++W  +  KT +  +   S   DG I+ W++   +    P  +  L        I  + +L  +L  +     P      ++G+E G++  CN K               K+P E ++ T     G ++ +Q +     NF+     T  I+  +   +  I   +    YL D   SP  P + +T+  +GTL + +++  +NN S +
Sbjct:  169 RTATHLSWHPDGSRKLAVAYSCLDFQRAPKDMSYESYIWDIEIPNK------PELTLKPVSPLVCLEYNPKDSHVLVGGCYNGQIAYWDTRKGGNP--MESTVIEHSHRDPVYKVIW--LQSKTGTECF---SASTDGQILWWDI---RKLSEPTEKLIL-------DISKKENLDNALGAVSLEFEPTLPTKFMVGTEQGMIVSCNRK--------------AKTPPEKIVCTYGGHHGPIYSIQRNPFYPKNFLTVGDWTARIWSEDC-RESSIMWTKYHMSYLTDACWSPTRPTVFLTTKMDGTLDVWDYMYKQNNPSLS 453          
BLAST of WD repeat-containing protein 34 vs. Ensembl Mouse
Match: Wdr34 (WD repeat domain 34 [Source:MGI Symbol;Acc:MGI:1919070])

HSP 1 Score: 140.584 bits (353), Expect = 2.148e-35
Identity = 93/450 (20.67%), Postives = 202/450 (44.89%), Query Frame = 3
Query:  240 DESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTVNGDIKESM-CLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSL--SKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENRSKN 1580
            D   L  F+++V   + + L +N +S+AF+  +    + ++++ CL+ +     +    +V+ +SWN  G+VLA A+G +    W    +    + + +   + +   +P  ++E  +   C+ FH    S I  G ++GE++VWD SR E+ L+  +   +  H +P+  +LW  +     S  + ++S   DG +++W  S      +    + L  + LP+S + +        + +   + +  D+   V+G+E G    C++  + ++ +       +++P +   +   G V+ V  S    N   +    G +++Y++   Q +++++    YL+ +  SP+ P +   +   G + L +  +++                   KP  ++ +       +D   + C+EFN Q    +AA D  G + +WQLS   TE   + 
Sbjct:  105 DTLRLEAFLRRVEAMVIRELNNNWQSHAFDGYEVNWTEQQQTVSCLHTLVYPLAQGQGLHVTGISWNSTGSVLACAYGRLDDGDWSTLKSY---VCTWNLDRQGLNPQQPSVVVEVPSAVMCLAFHPTQPSHIAGGLYSGEVLVWDMSRPEDPLLWRTGLTDDTHTDPVYQVLW--LPEPRHSHRFQVLSAATDGKVLLWRGSGAGQLRL-TKGFALAVQQLPRSTKLKKPPRGETEVGVTSVAFSSFDSSLFVLGTEGGFPLKCSLASEVAALTRMPSSVPLRAPVQFTFSPHGGPVYSVSCSPFHRNLFLSAGTDGHVHLYSMLQAQPLTSLQLSHKYLFAVRWSPVRPLVFAAASGEGDVQLFDLQKSS------------------QKPTVSITQT------QDGSPVYCLEFNSQQTQLLAAGDAKGMVKVWQLSTAFTEQGPRE 524          
BLAST of WD repeat-containing protein 34 vs. Ensembl Mouse
Match: Dync1i1 (dynein cytoplasmic 1 intermediate chain 1 [Source:MGI Symbol;Acc:MGI:107743])

HSP 1 Score: 62.7734 bits (151), Expect = 8.108e-10
Identity = 60/266 (22.56%), Postives = 110/266 (41.35%), Query Frame = 3
Query:  540 NKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLF-LCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNF 1334
            N K  +  P+ +    +    V F  +  +L+V GT++G+IV+WD        +  +      H  P+  +   NV G   + N  L+++  DG +  W+L M  +                +S+    + SK +++   +    D    V+GSE G ++  C      S + IG   +  + P   +   +  AV  + +S L   FV + S    + ++  +H + + + E    Y+YD+  SP+ P L       G L L N 
Sbjct:  325 NMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCV---NVVGTQNAHN--LITVSTDGKMCSWSLDMLSTPQ--------------ESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACR---HGSKAGIGEVFEGHQGPVTGINCHM--AVGPIDFSHL---FVTS-SFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLWNL 562          
BLAST of WD repeat-containing protein 34 vs. Ensembl Mouse
Match: Dync1i1 (dynein cytoplasmic 1 intermediate chain 1 [Source:MGI Symbol;Acc:MGI:107743])

HSP 1 Score: 62.3882 bits (150), Expect = 1.006e-9
Identity = 60/266 (22.56%), Postives = 110/266 (41.35%), Query Frame = 3
Query:  540 NKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLF-LCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNF 1334
            N K  +  P+ +    +    V F  +  +L+V GT++G+IV+WD        +  +      H  P+  +   NV G   + N  L+++  DG +  W+L M  +                +S+    + SK +++   +    D    V+GSE G ++  C      S + IG   +  + P   +   +  AV  + +S L   FV + S    + ++  +H + + + E    Y+YD+  SP+ P L       G L L N 
Sbjct:  297 NMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCV---NVVGTQNAHN--LITVSTDGKMCSWSLDMLSTPQ--------------ESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACR---HGSKAGIGEVFEGHQGPVTGINCHM--AVGPIDFSHL---FVTS-SFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLWNL 534          
BLAST of WD repeat-containing protein 34 vs. Ensembl Mouse
Match: Dync1i1 (dynein cytoplasmic 1 intermediate chain 1 [Source:MGI Symbol;Acc:MGI:107743])

HSP 1 Score: 62.003 bits (149), Expect = 1.116e-9
Identity = 60/266 (22.56%), Postives = 110/266 (41.35%), Query Frame = 3
Query:  540 NKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLF-LCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNF 1334
            N K  +  P+ +    +    V F  +  +L+V GT++G+IV+WD        +  +      H  P+  +   NV G   + N  L+++  DG +  W+L M  +                +S+    + SK +++   +    D    V+GSE G ++  C      S + IG   +  + P   +   +  AV  + +S L   FV + S    + ++  +H + + + E    Y+YD+  SP+ P L       G L L N 
Sbjct:  288 NMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCV---NVVGTQNAHN--LITVSTDGKMCSWSLDMLSTPQ--------------ESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACR---HGSKAGIGEVFEGHQGPVTGINCHM--AVGPIDFSHL---FVTS-SFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLWNL 525          
BLAST of WD repeat-containing protein 34 vs. Ensembl Mouse
Match: Dync1i1 (dynein cytoplasmic 1 intermediate chain 1 [Source:MGI Symbol;Acc:MGI:107743])

HSP 1 Score: 62.003 bits (149), Expect = 1.343e-9
Identity = 60/266 (22.56%), Postives = 110/266 (41.35%), Query Frame = 3
Query:  540 NKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLF-LCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNF 1334
            N K  +  P+ +    +    V F  +  +L+V GT++G+IV+WD        +  +      H  P+  +   NV G   + N  L+++  DG +  W+L M  +                +S+    + SK +++   +    D    V+GSE G ++  C      S + IG   +  + P   +   +  AV  + +S L   FV + S    + ++  +H + + + E    Y+YD+  SP+ P L       G L L N 
Sbjct:  308 NMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCV---NVVGTQNAHN--LITVSTDGKMCSWSLDMLSTPQ--------------ESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACR---HGSKAGIGEVFEGHQGPVTGINCHM--AVGPIDFSHL---FVTS-SFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLWNL 545          
BLAST of WD repeat-containing protein 34 vs. UniProt/SwissProt
Match: sp|Q96EX3|WDR34_HUMAN (WD repeat-containing protein 34 OS=Homo sapiens OX=9606 GN=WDR34 PE=1 SV=2)

HSP 1 Score: 153.295 bits (386), Expect = 5.303e-39
Identity = 105/477 (22.01%), Postives = 216/477 (45.28%), Query Frame = 3
Query:  168 KKHRSSECQTDSYLYVEEDIHPDVDESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTVNGDIKESM--CLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRY----RGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENRSKN 1580
            + H  ++ QT++ + V        D   L  F+++V   + + L  N +S+AF+  + VN   ++ M  CLY +     +    +V+ +SWN  G+V+A A+G + H  W     + +  ++L  R+ +    +P  ++E  +   C+ FH    S +  G ++GE++VWD SR E+ L+  +   +  H +P++ ++W    G   S  + ++S+  DG +++W   +    L     + L  + LP+S +     RG      + +  + +  D    ++G+E G    C++    ++ +       +++P +   +   G ++ V  S    N   +    G +++Y++     +++++    YL+ +  SP+ P +   +   G + L +  +++                   KP  TVL    +   +D   + C+EFN Q    +AA D  GT+ +WQLS   TE   + 
Sbjct:   80 RNHVDAQVQTEAPVPVSVQPPSQYDIPRLAAFLRRVEAMVIRELNKNWQSHAFDGFE-VNWTEQQQMVSCLYTLGYPPAQAQGLHVTSISWNSTGSVVACAYGRLDHGDWST-LKSFVCAWNLDRRDLR--PQQPSAVVEVPSAVLCLAFHPTQPSHVAGGLYSGEVLVWDLSRLEDPLLWRTGLTDDTHTDPVSQVVWLPEPGH--SHRFQVLSVATDGKVLLWQ-GIGVGQLQLTEGFALVMQQLPRSTKLKKHPRGETEVGATAV--AFSSFDPRLFILGTEGGFPLKCSLAAGEAALTRMPSSVPLRAPAQFTFSPHGGPIYSVSCSPFHRNLFLSAGTDGHVHLYSMLQAPPLTSLQLSLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSS------------------QKP--TVL----IKQTQDESPVYCLEFNSQQTQLLAAGDAQGTVKVWQLSTEFTEQGPRE 523          
BLAST of WD repeat-containing protein 34 vs. UniProt/SwissProt
Match: sp|Q5U4F6|WDR34_MOUSE (WD repeat-containing protein 34 OS=Mus musculus OX=10090 GN=Wdr34 PE=1 SV=2)

HSP 1 Score: 140.584 bits (353), Expect = 1.236e-34
Identity = 93/450 (20.67%), Postives = 202/450 (44.89%), Query Frame = 3
Query:  240 DESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTVNGDIKESM-CLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSL--SKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENRSKN 1580
            D   L  F+++V   + + L +N +S+AF+  +    + ++++ CL+ +     +    +V+ +SWN  G+VLA A+G +    W    +    + + +   + +   +P  ++E  +   C+ FH    S I  G ++GE++VWD SR E+ L+  +   +  H +P+  +LW  +     S  + ++S   DG +++W  S      +    + L  + LP+S + +        + +   + +  D+   V+G+E G    C++  + ++ +       +++P +   +   G V+ V  S    N   +    G +++Y++   Q +++++    YL+ +  SP+ P +   +   G + L +  +++                   KP  ++ +       +D   + C+EFN Q    +AA D  G + +WQLS   TE   + 
Sbjct:  103 DTLRLEAFLRRVEAMVIRELNNNWQSHAFDGYEVNWTEQQQTVSCLHTLVYPLAQGQGLHVTGISWNSTGSVLACAYGRLDDGDWSTLKSY---VCTWNLDRQGLNPQQPSVVVEVPSAVMCLAFHPTQPSHIAGGLYSGEVLVWDMSRPEDPLLWRTGLTDDTHTDPVYQVLW--LPEPRHSHRFQVLSAATDGKVLLWRGSGAGQLRL-TKGFALAVQQLPRSTKLKKPPRGETEVGVTSVAFSSFDSSLFVLGTEGGFPLKCSLASEVAALTRMPSSVPLRAPVQFTFSPHGGPVYSVSCSPFHRNLFLSAGTDGHVHLYSMLQAQPLTSLQLSHKYLFAVRWSPVRPLVFAAASGEGDVQLFDLQKSS------------------QKPTVSITQT------QDGSPVYCLEFNSQQTQLLAAGDAKGMVKVWQLSTAFTEQGPRE 522          
BLAST of WD repeat-containing protein 34 vs. UniProt/SwissProt
Match: sp|Q16960|DYI3_HELCR (Dynein intermediate chain 3, ciliary OS=Heliocidaris crassispina OX=1043166 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.314e-10
Identity = 66/314 (21.02%), Postives = 131/314 (41.72%), Query Frame = 3
Query:  411 KNVSQLSWNCNGTV-LAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFL 1337
            +  + LSW  +G   LA A+  +   K    T+    I+ +   NK      P+ +L+  +   C++++     +++ G +NG++  WD +R  +  +  S  E+  H +P+   +W  +  KT +  +   S   DG ++ W+  MRK    P  +  +           +G +  +  ++     P      ++G+E G +  CN K               K+P E ++A      G V+ +Q +     NF+     T  I+  ++     I   +    YL D   SP+ P +  T+  +G+L + ++L
Sbjct:  162 RPATHLSWYPDGPKKLAVAYSSLEFQKTSAETSMDSYIWDIENPNK------PEFVLKPVSPLVCLEYNPKDVHVLIGGCYNGQVAFWD-TRKGSQAVEMSPVEHS-HHDPVYKTIW--LQSKTGTECF---SASTDGQVLWWD--MRKLGE-PTEKLIMDPSK-------KGKMENAQGVISLEYEPTIPTKFMVGTEQGTIISCNRK--------------AKTPPEKIVAIYKEHIGPVYSLQRNPFFPKNFLTVGDWTARIWSEDI-RDSSIMWTKYHMSYLTDGCWSPVRPAVFFTTKMDGSLDVWDYL 437          
BLAST of WD repeat-containing protein 34 vs. UniProt/SwissProt
Match: sp|Q9GZS0|DNAI2_HUMAN (Dynein intermediate chain 2, axonemal OS=Homo sapiens OX=9606 GN=DNAI2 PE=1 SV=2)

HSP 1 Score: 64.6994 bits (156), Expect = 1.310e-9
Identity = 72/330 (21.82%), Postives = 144/330 (43.64%), Query Frame = 3
Query:  411 KNVSQLSWNCNG-TVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNL-SMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDH 1382
            +  + LSW+ +G   LA A+  +   +  V  ++   I+ L   NK      P+  L+ ++    ++F+   + +++ G +NG+I  WD  +    L+   S+    H++P+   +W  +  KT +  +   S   DG ++ W++  M + T + +        D+ K  +   +L  ++S+   S  P      ++G+E G++  CN K K+S+              E ++ T     G ++ +Q +     NF+     T  I+  +   +  I   +    YL D + SP+ P +  T+  +GTL + +F+      T  LK  D 
Sbjct:  163 RAATHLSWHPDGNRKLAVAYSCLDFQRAPVGMSSDSYIWDLENPNK------PELALKPSSPLVTLEFNPKDSHVLLGGCYNGQIACWDTRKG--SLVAELSTIESSHRDPVYGTIW--LQSKTGTECF---SASTDGQVMWWDIRKMSEPTEVVI-------LDITKKEQLENALG-AISLEFESTLPTK---FMVGTEQGIVISCNRKAKTSA--------------EKIVCTFPGHHGPIYALQRNPFYPKNFLTVGDWTARIWSED-SRESSIMWTKYHMAYLTDAAWSPVRPTVFFTTRMDGTLDIWDFMFEQCDPTLSLKVCDE 453          
BLAST of WD repeat-containing protein 34 vs. UniProt/SwissProt
Match: sp|O14576|DC1I1_HUMAN (Cytoplasmic dynein 1 intermediate chain 1 OS=Homo sapiens OX=9606 GN=DYNC1I1 PE=1 SV=2)

HSP 1 Score: 62.7734 bits (151), Expect = 5.155e-9
Identity = 60/266 (22.56%), Postives = 110/266 (41.35%), Query Frame = 3
Query:  540 NKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLF-LCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNF 1334
            N K  +  P+ +    +    V F  +  +L+V GT++G+IV+WD        +  +      H  P+  +   NV G   + N  L+++  DG +  W+L M  +                +S+    + SK +++   +    D    V+GSE G ++  C      S + IG   +  + P   +   +  AV  + +S L   FV + S    + ++  +H + + + E    Y+YD+  SP+ P L       G L L N 
Sbjct:  325 NMKFKKTTPEYVFHCQSSVMSVCFARFHPNLVVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCV---NVVGTQNAHN--LITVSTDGKMCSWSLDMLSTPQ--------------ESMELVYNKSKPVAVTGMAFPTGDVNNFVVGSEEGTVYTACR---HGSKAGIGEVFEGHQGPVTGINCHM--AVGPIDFSHL---FVTS-SFDWTVKLWTTKHNKPLYSFEDNADYVYDVMWSPVHPALFACVDGMGRLDLWNL 562          
BLAST of WD repeat-containing protein 34 vs. TrEMBL
Match: A0A2C9K504 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106051570 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 1.027e-55
Identity = 141/496 (28.43%), Postives = 237/496 (47.78%), Query Frame = 3
Query:   90 WKRNCSTKEFTTQTDTYKIIHRGLNIKKHRSSECQTDSYLYVEE-DIHP-DVDESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTVNGDIKESMCLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSS-ENKVHQEPINSILW-SNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLS-KSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLT 1562
            WKR  S     +QT    +        K  + E Q  S+L  E   +H  ++D  +L  F++KV P + + L  N +S AF+    ++    +++      N  D      V+ LSWN  G+ LAA++G   H  WC H    I  ++L  R+ K  EDKPDT ++++ C   ++FH    + +  G  NGE+++WD SR E+DL+LA+S   ++ H+EP++ + W ++ S K    NY +VS+  DG I++W++ ++K  L  L  + L  +DLP+S++ RG  S K + + C S +  D +  V+GSE G LF C++    S+ S      +  SP         G VH V  SK   +   +      + +YN+     +  IEPG+GY+Y    SP  P +     E G L++ +    N++                          ++L    + + +  ++FN Q    +A  D  G I +++L + LT
Sbjct:   18 WKRERSLASNESQTKEISLQDAATQSFKTFNQEVQ--SHLKDERYSLHTVNLDHQKLAAFLQKVEPMVMRYLGKNLKSRAFDDVSDLSEKTLDTVTCVHTLNSNDLNLQFQVTGLSWNSTGSTLAASYGRFDHEDWCTH-KAAICTWNLDRRSVK--EDKPDTFIDSSCCLMSLEFHPANPAWLAGGNFNGEVILWDLSR-EDDLVLATSGIGDESHREPVSKVYWITDQSPKM--KNYNIVSVSGDGKILIWSIDLKKGKLRQLKSFLLMNKDLPRSMKVRGVRSDKEVGVTCISFSHEDPDLFVLGSESGCLFKCSLH---SNESHKKSSDQAYSPVTFTFNPHHGPVHSVDCSKFHRHAFLSSGMDQSLRLYNMLQAPPVLIIEPGEGYIYSSKWSPTRPAIFAAVSEKGNLLIYDLHSGNMT------------------------PMHKLEASPNKVPVYSLQFNSQQKRILATGDGQGYIRVYRLPEKLT 478          
BLAST of WD repeat-containing protein 34 vs. TrEMBL
Match: V4A149 (WD_REPEATS_REGION domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_233855 PE=4 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 1.122e-55
Identity = 142/526 (27.00%), Postives = 245/526 (46.58%), Query Frame = 3
Query:   87 NWKRNCSTKEFTTQTDTYKIIHRGLNIKKHRSSECQTDSYLYVEEDIH-PDVDESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTVNGDIKESMCLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSS-ENKVHQEPINSILW-SNVSGKTVSSNYC---------------------LVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRG-SLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNEL---QEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENRSKN 1580
            NWK+   T +   QT   K+    +  +++   E QT++      D    + D  +L  F++K+ P++ K++  N +S AF       G+   S+      +  +      ++ +SWN +G+VLAA +G   H  WC H  +G+  +SL  RN +   DKP T++++ +C  CV+FH    +LI  G  NGE++VWD S+ E+DL++A+S   +  H+EP+  + W  + S K    N C                     ++S+G DG I++W +S +K  L  ++ + L  + LP+S++ RG    K +   C S N  D +  ++GSE G +F CN  L S  +  G+++     ++SP         G VH V +S    N          I +YNV   Q    +EPG+GYLY    SP+ P L+    E+G +++ +     L    +++   +NS      P YT                  ++FN      +A  D  G + +++L + L+    ++
Sbjct:   15 NWKKERYTDDVGVQTKELKVDEVRVQSREYYDEETQTENE---GGDFQLAETDPEKLAKFLRKIEPELIKMIERNNKSVAFEGYVIAKGEESSSIACIHTFSHAELRQELQITGVSWNSSGSVLAATYGRYDHEDWCTH-KSGLCTWSLDRRNMQA--DKPQTVIDSPSCLMCVEFHPTNPALIAGGNFNGEVMVWDLSK-EDDLLVATSGIGDDAHREPVAKVYWLKDQSAKGRKYNNCWSGVVGLWTGLGSLLFGGTPVIMSVGADGKILIWTMSKKKPKLKLVDGFVLMNQSLPRSMKVRGVRADKEIGATCISFNSEDKDNFIVGSESGCIFKCN--LHSQGNPAGSQIVSSVPLRSPVTFTYNPHHGPVHSVDYSPFHRNAFITSGMDQCIRVYNVLQDQPTVIVEPGEGYLYSAKWSPVKPTLLAAVTESGYILIYDLKTGQLVPLHKIQAGVNNS------PVYT------------------LQFNRNKRNLIATGDGAGYVSVFKLGEELSSPTPRD 507          
BLAST of WD repeat-containing protein 34 vs. TrEMBL
Match: A0A210R242 (WD repeat-containing protein 34 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT17042 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 9.940e-55
Identity = 139/506 (27.47%), Postives = 243/506 (48.02%), Query Frame = 3
Query:   87 NWKRNCSTKEFTTQTDTYKIIHRGLNIKKHRSSECQTDSYLYVEEDIHPDVDESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTVNGDIKES--MCLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSL--SKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNEL---QEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENRSKNP 1583
            +WK+  S  +   QTD  +   R     K +  E QT+     +  +  D     L  F+ K+ P I + L     S+AF+    +  D +E+   C++K+ N  D     +++ ++WN  G V+AAA+G   H  WC H  + +  ++L  RN  I E+KPDT+++ +TC  CV FH    ++I  GT++GE+++WD SR ++ L+ +S   +  H+EP+  + W   +  +    Y LVS   DG I++W    +K  +   N + L A++LPK++R    +   K + + C S N  D +  +IGSE G +F C+  +++     G+++     + SP           V+ V++S    N   + S    I +Y++  KQ +  IEPG+G++     SP+ P LI  + E+G L+L                 D  SE  +           +L    +   ++  +FN      +A  D  G +++++LSQ+L   +S NP
Sbjct:   18 SWKKERSLADSGAQTDDLETFERASQSVKRKDKEVQTEDDGSHKTRLAQDT-VGRLGEFLSKIEPVILRELDKALTSHAFD-DFNIGWDNEEASVTCVHKLTNP-DLNEQLHITGITWNSTGAVIAAAYGRYDHEDWCTH-KSALCTWNLERRN--INENKPDTVIDLSTCLTCVAFHPKNPAIIAGGTYDGEVMMWDLSREDDMLVTSSGIGDDAHREPVTRVHWIPDNTTSKRDRYLLVSTSGDGKILVWKHDRKKDAIKLSNGFILMAQNLPKALRKSRGIRGDKEVGVTCLSYNCEDRDAFLIGSEPGAVFRCS--MQTHGEPAGSQVISSVPLHSPVTFTYNPHYAPVYSVEFSPFHRNAFLSSSMDQTIRLYSMLQKQPVLTIEPGEGFISSTKWSPIRPSLIAATTESGHLLLY----------------DLRSEQPVP--------IQKLEASINKTAVHTCQFNPNQFELLATGDGAGFVHVFRLSQDL---KSTNP 488          
BLAST of WD repeat-containing protein 34 vs. TrEMBL
Match: A0A433TII6 (WD_REPEATS_REGION domain-containing protein OS=Elysia chlorotica OX=188477 GN=EGW08_010845 PE=4 SV=1)

HSP 1 Score: 200.675 bits (509), Expect = 4.485e-54
Identity = 141/501 (28.14%), Postives = 238/501 (47.50%), Query Frame = 3
Query:   87 NWKRNCSTKEFTTQT-DTYKIIHRGLNIKKHRSSE--CQTDSYLYVEEDIHPDVDESELNTFIKKVVPKIYKVLLSNERSNAFN-IPQTVNGDIKESMCLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSS-ENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRG-SLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNEL---QEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLT 1562
            +WKR  S  E   QT D Y      + ++ H   +   QTD      E    D D   L  F+ +V P + + L  N +S AF+ I    +  ++   C++ + N   +  ++ V+ LSWN  G+ LAA FG   H  WC H    +  ++L  R+ K  EDKPDT++++  C  C++FH    + I  G  NGE+++WD S+  +DL+LASS   +  H+EP++ + W   S  +   +Y +VS+ +DG +++W + M+K  L     + + ++ LP++++ RG    K + +   S +  D++  V+GSE G +F CN+  K S +  G+ L     + SP         G VH V  S+   N          I IYN+   Q    IEPG+GYL+    SP+ P ++    E G L+L +    ++                        +  ++L    + + +  ++FN Q    +A  D  G I +++LS+  T
Sbjct:   18 SWKRERSVAEQGCQTRDVYT---NNVEVQSHEKFDQGVQTDYGGDSYESA--DSDSQALAEFLHRVEPMVMQCLNRNLKSKAFDGILDQRDSGLESITCMHTLHNAELQEKMQ-VTDLSWNATGSTLAATFGRFDHEDWCTHPAV-LCTWNLDRRSVK--EDKPDTIIDSPCCLMCLEFHPVNPAWIAGGNFNGEVILWDLSQ-NDDLVLASSGIGDDAHREPVSKVHWIK-SHSSKRRDYNIVSVSSDGKVLVWKVDMKKGRLKLSKGFVVMSQSLPRTMKVRGIRGDKEVGVTSLSFSHEDSDLFVLGSESGCIFKCNLHAKGSPA--GSHLISSVPLCSPVSFTFNPHHGPVHSVDCSRFHRNAFLTAGMDQSIRIYNMLQAQPALTIEPGEGYLFSAQWSPVRPAVLAAVTEKGNLLLYDLRTGHM------------------------VPTHKLEASPNKVPVYSMQFNPQMKQILATGDGQGYIRVFRLSEAFT 481          
BLAST of WD repeat-containing protein 34 vs. TrEMBL
Match: K1R5F1 (WD repeat-containing protein 34 OS=Crassostrea gigas OX=29159 GN=CGI_10028675 PE=4 SV=1)

HSP 1 Score: 196.052 bits (497), Expect = 2.714e-52
Identity = 138/509 (27.11%), Postives = 244/509 (47.94%), Query Frame = 3
Query:   87 NWKRNCSTKEFTTQTDTYKIIHRGLNIKKHRSSECQT----DSYLYVEEDIHPDVDESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTVNGDIKESMC-LYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSS-ENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPL-NRYTLTARDLPKSIRYRGSL--SKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQ--EIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENRSKN 1580
            NWK+  S      QT    +        K++S + QT    D +    +D     +   L  F+++V P ++K L  N +S+AF+  +    +   ++  ++K+ N   + G   ++ LSWN  G V+AA++G   H  WC H  T +  ++L  RN  + E+KPDT+LE ++C  C  FH    +LI  GT+NG ++VWD SR E+D++L SS   +  H+EP++ + W   +     + Y LVS+ +DG +++W +  RK+  I L + + L   +LP  +R   ++   K + + C S N  + +  +IGSE G +F C++       + GN +   ++KSP     A   G V+  ++S    N     S    + +Y++  KQ I  +EPG+G +Y    S   P L   + + G L+L +  +N                     P Y +     +     + ++ C +FN+     +A  D  G I ++++S +L    S++
Sbjct:   15 NWKKERSLASSGCQTSELVVEEVACQSVKYKSVKTQTEDDSDKFSGFADD-----NSGHLAEFLRRVEPAMHKQLEMNVKSHAFDDYEVTWDEGSSTISSIHKLTNAAHD-GQFQITGLSWNSTGAVIAASYGRFDHEDWCTH-KTSLCTWNLERRN--LDENKPDTVLEVSSCLMCTAFHPSNPALIAGGTYNGVVIVWDLSR-EDDMVLTSSGIGDDSHREPVSKVTWVPDTSSLKKNKYLLVSVSSDGKMLVWKMD-RKTKQIELHDGFVLMNMNLPTQLRKSRTMRGDKEVGVTCISYNNENKDSFIIGSEPGAVFKCSMSANGEQPA-GNIISSIQLKSPVTFTYAHHYGPVYSAEFSPFHRNAFLTSSMDQTLRLYSMLQKQPIMTLEPGEGVIYSTKWSFSRPALFAATTDTGLLLLYDLTQNQ------------------PVPVYKLEAGGLMGNNARAPVLTC-QFNQHQNNLIATGDATGCIQVFRISDSLKTPLSRD 492          
BLAST of WD repeat-containing protein 34 vs. Ensembl Cavefish
Match: wdr34 (WD repeat domain 34 [Source:NCBI gene;Acc:103022287])

HSP 1 Score: 152.525 bits (384), Expect = 5.332e-40
Identity = 108/483 (22.36%), Postives = 227/483 (47.00%), Query Frame = 3
Query:  183 SECQTDSYLYVEEDIHPDVDESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTVNGDIKESM-CLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSI---RYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGN-ELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENRSKNPTKNSEIHNQFS 1616
            S  QTD    + + +    D   L  F+++V   + + L+ N +S+AF+  +    D ++++ CL+ + +   +     V+ +SWNC G+V+A A+G + H  W    +    + + +    K+   +PD +++T T   CV FH    SLI  G ++GE++VWD S  ++ ++  +      H+EP+  + W  V G     +  ++S  + G I++W++   +  L   + Y L  + +P+S    + RG  +  ++ L  +L+P D +  ++GSE G++  C    ++ ++   N E   +++P +   +  +G VH + +S    N   ++   G+  I+++   + +  +     Y++ +  SP+ P +       G + + +    +L   +    +D N+     +P Y                  C+EF+ + +  +A  + +GT+ IWQLS  LT   S+      ++ N+ +
Sbjct:   49 SSTQTDPQEQISQ-LQLSADPPGLVEFLRRVEGVVIRELVKNAKSHAFDGFEVNWVDQQQAVTCLHCLGHPDAQQRGLQVTGVSWNCTGSVIACAYGRVDHGDWSTEKSC---VCTWNLDRSKLNPKQPDMVIDTATPVMCVSFHPLRPSLIAGGLYSGEVIVWDTSSTQDPVLAQTGISQDTHREPVYEVKW--VPGAR-RGDLAVLSACSGGRILLWSVEAAEGRLSLTSGYALVRQQVPQSSSSNKSRGGTNIGVTSL--TLSPWDLDSFLVGSEGGLVLKCAFSSQTVAAVPPNGESVALRAPAQFSFSARAGPVHSLHFSPFHRNLFVSVGTDGLAQIHSMLQPRALLTMRVSDSYVFGVRWSPVRPLVFAAVTGQGLVQVFDLGRRSLRPAA---TIDQNTG---GQPAY------------------CLEFSPRQL--LAVGNADGTVNIWQLSAELTVQSSRESVVLEQLANEVA 496          
BLAST of WD repeat-containing protein 34 vs. Ensembl Cavefish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 76.2554 bits (186), Expect = 3.222e-14
Identity = 68/314 (21.66%), Postives = 136/314 (43.31%), Query Frame = 3
Query:  411 KNVSQLSWNCNGTV-LAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFL 1337
            +  + LSW+ +G+  LA A+  +   K     +    I+ +   NK      P+  L+  +   C++++   + ++V G++NG+I  WD  +    + +++   +  H++P+  ++W  +  KT +      S   DG ++ W++  RK +  P  R  L           +G L ++L  +            ++G+E G++  CN K               K+P E ++ T S   G ++ +Q +     NF+     T  I+  ++  +  I   +    YL D   SP+ P +  T   +GTL + +FL
Sbjct:  163 RTATSLSWHPDGSQKLAVAYSSLEFQKVSKDMSYDSYIWDIEVSNK------PEMTLKPVSPLVCLEYNPKDSHILVGGSYNGQIAYWDTRKGSQPVEMSTIEHS--HRDPVYKVIW--LQSKTGTD---FFSASTDGQVLWWDI--RKMSE-PTERLVLDPSK-------KGKLDQALGAISLEFETTMPTKFMVGTEQGMVVSCNRK--------------AKTPAEKIVCTYSGHHGPIYSLQRNPFFPKNFLTVGDWTARIWSEDI-RESSIMWTKYQTAYLSDGCWSPVRPSVFFTVKMDGTLDVWDFL 438          
BLAST of WD repeat-containing protein 34 vs. Ensembl Cavefish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 75.0998 bits (183), Expect = 7.293e-14
Identity = 68/314 (21.66%), Postives = 137/314 (43.63%), Query Frame = 3
Query:  411 KNVSQLSWNCNGTV-LAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFL 1337
            +  + LSW+ +G+  LA A+  +   K     +    I+ +   NK      P+  L+  +   C++++   + ++V G++NG+I  WD  +    + +++   +  H++P+  ++W  +  KT +  +   S   DG ++ W++  RK +  P  R  L           +G L ++L  +            ++G+E G++  CN K               K+P E ++ T S   G ++ +Q +     NF+     T  I+  ++  +  I   +    YL D   SP+ P +  T   +GTL + +FL
Sbjct:  155 RTATSLSWHPDGSQKLAVAYSSLEFQKVSKDMSYDSYIWDIEVSNK------PEMTLKPVSPLVCLEYNPKDSHILVGGSYNGQIAYWDTRKGSQPVEMSTIEHS--HRDPVYKVIW--LQSKTGTDFF---SASTDGQVLWWDI--RKMSE-PTERLVLDPSK-------KGKLDQALGAISLEFETTMPTKFMVGTEQGMVVSCNRK--------------AKTPAEKIVCTYSGHHGPIYSLQRNPFFPKNFLTVGDWTARIWSEDI-RESSIMWTKYQTAYLSDGCWSPVRPSVFFTVKMDGTLDVWDFL 430          
BLAST of WD repeat-containing protein 34 vs. Ensembl Cavefish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 74.7146 bits (182), Expect = 8.984e-14
Identity = 68/314 (21.66%), Postives = 137/314 (43.63%), Query Frame = 3
Query:  411 KNVSQLSWNCNGTV-LAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFL 1337
            +  + LSW+ +G+  LA A+  +   K     +    I+ +   NK      P+  L+  +   C++++   + ++V G++NG+I  WD  +    + +++   +  H++P+  ++W  +  KT +  +   S   DG ++ W++  RK +  P  R  L           +G L ++L  +            ++G+E G++  CN K               K+P E ++ T S   G ++ +Q +     NF+     T  I+  ++  +  I   +    YL D   SP+ P +  T   +GTL + +FL
Sbjct:  164 RTATSLSWHPDGSQKLAVAYSSLEFQKVSKDMSYDSYIWDIEVSNK------PEMTLKPVSPLVCLEYNPKDSHILVGGSYNGQIAYWDTRKGSQPVEMSTIEHS--HRDPVYKVIW--LQSKTGTDFF---SASTDGQVLWWDI--RKMSE-PTERLVLDPSK-------KGKLDQALGAISLEFETTMPTKFMVGTEQGMVVSCNRK--------------AKTPAEKIVCTYSGHHGPIYSLQRNPFFPKNFLTVGDWTARIWSEDI-RESSIMWTKYQTAYLSDGCWSPVRPSVFFTVKMDGTLDVWDFL 439          
BLAST of WD repeat-containing protein 34 vs. Ensembl Cavefish
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 73.559 bits (179), Expect = 1.223e-13
Identity = 68/314 (21.66%), Postives = 137/314 (43.63%), Query Frame = 3
Query:  411 KNVSQLSWNCNGTV-LAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFL 1337
            +  + LSW+ +G+  LA A+  +   K     +    I+ +   NK      P+  L+  +   C++++   + ++V G++NG+I  WD  +    + +++   +  H++P+  ++W  +  KT +  +   S   DG ++ W++  RK +  P  R  L           +G L ++L  +            ++G+E G++  CN K               K+P E ++ T S   G ++ +Q +     NF+     T  I+  ++  +  I   +    YL D   SP+ P +  T   +GTL + +FL
Sbjct:   11 RTATSLSWHPDGSQKLAVAYSSLEFQKVSKDMSYDSYIWDIEVSNK------PEMTLKPVSPLVCLEYNPKDSHILVGGSYNGQIAYWDTRKGSQPVEMSTIEHS--HRDPVYKVIW--LQSKTGTDFF---SASTDGQVLWWDI--RKMSE-PTERLVLDPSK-------KGKLDQALGAISLEFETTMPTKFMVGTEQGMVVSCNRK--------------AKTPAEKIVCTYSGHHGPIYSLQRNPFFPKNFLTVGDWTARIWSEDI-RESSIMWTKYQTAYLSDGCWSPVRPSVFFTVKMDGTLDVWDFL 286          
BLAST of WD repeat-containing protein 34 vs. Ensembl Sea Lamprey
Match: wdr34 (WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-070928-9])

HSP 1 Score: 132.494 bits (332), Expect = 1.563e-33
Identity = 113/454 (24.89%), Postives = 188/454 (41.41%), Query Frame = 3
Query:  234 DVDESELNTFIKKVVPKIYKVLLSNERSNAFN--IPQTVNGDIKESMCLYKI---ENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSK------SLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISAT-GIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNL 1559
            D DE  L  F+  V P + + L  N  S AF+  +  T  G+  E  CL+++   E KT       V    W+C G ++  AFG +    W V  N+ I ++++  R   +  D PD  L+   C  C+ FH    ++I  G  +GE+ VWD S+ E+ L+  S      HQ+P+  + W +  G+  S    L+S G DG ++ W + +    + P NR  L A+ LP +     +LSK       L I   SL+  D+   V G E G +  C ++     +         KSP         G V+ V +S      V+  + T G + +++      +  +     Y+   + SP  P ++  S   G L+L +    +                  S P + +     L+       ++C+ FN +  G +A    +G   +W L   L
Sbjct:   76 DDDEGGLLAFLLAVEPVLSEQLRMNATSQAFDGEVAWTERGE--EISCLHELSCAEAKTRGLAATAVG---WSCTGAMIGVAFGRLNDGDWTVE-NSMICLWNVCRRG--LIPDMPDRTLDVPGCLLCLSFHPTWPAVIAGGASSGEVFVWDTSQEEDPLLAHSGVNATTHQQPVTQVQWVHSPGQ--SRVLLLMSAGLDGCVMTWRVELSTRKITPNNRVVLLAKHLPST----STLSKKVQSELPLGITAFSLS-EDSSMCVAGLEGGQVVRCLLEPLEQPTRKDQPPLNRKSPALFPFVKHQGPVYAVNFSPFNRRGVSVQAGTDGQVRVFSALLHDPVLVVRAATSYVLAAAWSPARPLVLAASTAEGELLLFDLAIKD------------------SGPVHCIQASPSLSP------VSCLAFNPKQPGLLAVGLQSGAARVWTLPSEL 490          
BLAST of WD repeat-containing protein 34 vs. Ensembl Sea Lamprey
Match: dync1i2a (dynein, cytoplasmic 1, intermediate chain 2a [Source:ZFIN;Acc:ZDB-GENE-060929-1086])

HSP 1 Score: 61.6178 bits (148), Expect = 2.476e-10
Identity = 72/345 (20.87%), Postives = 133/345 (38.55%), Query Frame = 3
Query:  540 NKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLF-LCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENR 1571
            N K  +  P+ +    +      F  +  +L+V GT++G+IV+WD        +  +      H  P+  +   NV G   + N  L+S+  DG +  W+L M      P +   L  +            SKS+++ C +    D    V+GSE G ++  C      S + I    +  + P   + +    A   + +S L   F+ + S    I ++  ++ + + + E    Y+YD+  SP+ P L  +    G L L N                 NS+  +     T+  C  LN       +       +    +A  D  G ++I+++ + L   R
Sbjct:  280 NTKFKKTTPEYVFHCQSAVMSASFARFHPNLVVGGTYSGQIVLWDNRSNRMTPVQRTPLSAAAHTHPVYCV---NVVGTQNAHN--LISVSTDGRMCSWSLDMLSQ---PQDSMELVHKQ-----------SKSIAVTCMTFPVGDVNNFVVGSEEGSVYTACR---HGSKAGISEVFEGHQGPVTGIHS--HSAAGPIDFSHL---FLTS-SFDWTIKLWTTKNNKPLYSFEDNSDYVYDVMWSPVHPSLFASVDGMGRLDLWNL----------------NSDTEVPAASVTIDGCPALNR------VRWTHSGRE----LAVGDSEGHLWIYEIGEQLALPR 570          
BLAST of WD repeat-containing protein 34 vs. Ensembl Sea Lamprey
Match: dnai2b (dynein, axonemal, intermediate chain 2b [Source:ZFIN;Acc:ZDB-GENE-131016-1])

HSP 1 Score: 55.0694 bits (131), Expect = 1.594e-8
Identity = 52/216 (24.07%), Postives = 87/216 (40.28%), Query Frame = 3
Query:  729 HQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMN--FLENNLSFT 1358
            H++P+  ++W      T        S   DG  V+W   +R+ T  P+ R  L   D  K    +G L  ++   C    P      ++G+E G++  CN K               K+P E ++ T S   G V+ +Q       NF+     T  I+   +     I   +    YL D   SP+ P +  T+  +G+L + +  F +NN + T
Sbjct:   22 HRDPVYKVIWQQSKTGTE-----FFSCSTDGQHVLW-WDVRRMTE-PMERLAL---DPAK----KGDLDNAMGATCLEFEPTMPTKFMVGTEQGMVVSCNRK--------------AKTPAEKIVGTYSGHHGPVYALQRHPFFPKNFLTIGDWTARIWSEEI-RDSSIMWTKYHMSYLTDGCWSPVRPAVFFTTKMDGSLDVWDLLFKQNNATLT 208          
BLAST of WD repeat-containing protein 34 vs. Ensembl Nematostella
Match: EDO43231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ65])

HSP 1 Score: 162.54 bits (410), Expect = 4.965e-44
Identity = 133/500 (26.60%), Postives = 230/500 (46.00%), Query Frame = 3
Query:   87 NWKRNCSTKEFTTQTDTYKIIHRGLNIKKHRSSECQTDSYLYVEEDIHPDVDESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTVNGDIKESM--CLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPL-NRYTLTARDLPKSIR---YRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIK--SPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLT 1562
            +WK     KE   QT         + +     + CQT+     E  I  D  ++ +N F+ +V P + K L +N  S+AF+    V+ + K S   C +++ N+     ++ ++ LSWN  G+V+AAA+G + H  WC H ++ +  ++L  R   +  +K DT ++ ++C   + FH    +LI  GT NGE+ +WD S  +  L+ +S   N  H+EP+N I+W  +   +    Y ++S   DG +++W +   +S  + L   Y L    +P+S+R    +G +   ++ L  S +  D    V+GSE G +F C++   S    +GN    +   SP     A   G V  V  S    N        G I +Y +   + + ++EP  GYL+ +  SP+ P +   +  +G L++ +   N+++  + +   D        KP +T                  +E+N      VA  D  G I IW+LS  LT
Sbjct:   15 SWKTERYVKESGAQTSEIITYEADVQVVNRADAGCQTEEETEQEMVIGHDNSQNLVN-FMLRVYPDVSKQLEANAISHAFD-GYDVDWEEKSSAVTCQHRLINQASGNQLQ-ITSLSWNSTGSVIAAAYGRLDHEDWCTHKSS-LCTWNLDRRGINV--NKADTTVDLSSCLLSLAFHPKSPALIAGGTFNGEVHLWDLSCEDEMLVASSGMGNDSHREPVNKIMWL-LDPDSKGKKYQILSASGDGKVLLWQVPPIESQDLRLVGGYILQTGAVPRSLRTSKAKGDMEMGVTTL--SFSHEDKTLFVLGSEAGGIFKCSV--NSRGPPVGNVTSSVPLGSPVTFAFAPHVGPVFSVNCSPYHRNLFLTCGTDGTIRLYTMLQAKPLLSLEPAAGYLFAIRWSPVRPLVFSVATGDGRLLIYDMKVNHINPVTTIDVSD-------KKPVHT------------------LEYNIHRRQLVATGDSEGVIKIWRLSDELT 478          
BLAST of WD repeat-containing protein 34 vs. Ensembl Nematostella
Match: EDO49079 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI29])

HSP 1 Score: 65.855 bits (159), Expect = 1.761e-11
Identity = 81/390 (20.77%), Postives = 156/390 (40.00%), Query Frame = 3
Query:  411 KNVSQLSW-NCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLF-LCNIKLKSSSSSIGNELQEIKSPTESV-LATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENR 1571
            + V+ L W N    +L A++ +   N+   H   G+ +      N K  +  P+ +    +      F  +  +LI+ GT++G+IV+WD   ++   +  +      H  P+  +   NV G   + N  L+S+  DG +  W+L M            L+       ++Y+   SKS+++ C S    D    V+GSE G ++  C      S + I +  +    P   +   + SG +         ++     S    + +++ +  +   + E    Y+YD+  SP+ P L  T    G L              +L NL+ ++E  I+               E    +N V++  Q+   ++  D +G +YI+ + + L   R
Sbjct:  133 RTVTCLDWSNQYPELLVASYNN---NEDAPHEPDGVALI----WNLKFAKTTPEYIFHCQSAVMSATFAKFHPNLIIGGTYSGQIVLWDNRSSKRTPVQRTPLSATAHTHPVYCV---NVVGTQNAHN--LISVSTDGKMCSWSLDM------------LSQPQDSMELQYK--QSKSVAVTCMSFLAGDVNNFVVGSEEGTVYTACR---HGSKAGISDVFEGHYGPVTGIDTHSASGPID-------FSHLFLTSSFDWTLKLWSHKSPRPYYSFEDNGDYIYDVKWSPIHPALFATVDGTGRL--------------DLWNLNSDTEVPIAS-----------TATESLTALNNVQWT-QSGQQISVGDDDGRVYIYDVGEQLATPR 460          
BLAST of WD repeat-containing protein 34 vs. Ensembl Nematostella
Match: EDO40075 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8B8])

HSP 1 Score: 58.9214 bits (141), Expect = 3.552e-9
Identity = 82/377 (21.75%), Postives = 158/377 (41.91%), Query Frame = 3
Query:  309 ERSNAFNIPQTVNGDIKESMCLYKIENKT-----DEFGVKN-VSQLSWNCNGTV-LAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSM----RKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMN--FLENNLSFTSELKNLDHNS 1388
            +++NA +I +    D++E         KT     DE  +K   + +SW  +GT  LA A+  +   K    T+  +  +     N      KPD +L+  +   C++++     L++ G +NG++  WD  +  + + +      K H++PI    +  +  ++ S   C  S   DG ++ W++       +S L+  N+         K  R  G +S           P      ++G+E G +  CN K               K+P + ++A+ +   G V+ VQ +     NF+        I+  ++  +  I   + G  YL D   SP  PG+  T+  +GTL + +  F +N  + + ++ ++  NS
Sbjct:  122 KQNNAIDIYEDYFPDLEEDQSCETPSAKTINVFRDENNIKRTATSISWYPDGTQKLAVAYSVLEFQK---STDICMDSYIWDIDNPT----KPDMVLKPVSPLICLEYNPKDPHLLIGGCYNGQLGFWDTRKGSHPVEMTPI--EKSHRDPI----YKTIFLQSKSGTDCF-STSTDGQVLWWDIRKLGEPTESLLLCPNK---------KDPRPLGGVSL-------EFEPTMPTKFMVGTEQGSVLSCNRK--------------AKTPADKIVASYAGHYGPVYSVQRNPFFPKNFLTIGDWQARIWSEDL-RESSIMWTKCGMSYLTDGCWSPSRPGVFFTTKMDGTLDVWDCMFKQNCPTLSIQVCDMSLNS 453          
BLAST of WD repeat-containing protein 34 vs. Ensembl Nematostella
Match: EDO36198 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJC7])

HSP 1 Score: 48.9062 bits (115), Expect = 4.707e-6
Identity = 47/223 (21.08%), Postives = 93/223 (41.70%), Query Frame = 3
Query:  564 PDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLP-KSIRYRGSLSKSLSILCGS---LNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISG---AVHGVQWSKLLANFVAAISATGIIYIYNVEH 1211
            P+  ++T +   C+  H     ++ AG ++G + V+  S   N  +  S+++   H +P+  + W       + +N    S+ +DG +V W +   +     L+   +   +LP KS    G+  KSL   CG+    +   N   ++G+E G +  C+                 K+ T + L T      +V+ V+W+        + SA   + I++  H
Sbjct:  345 PEYGIKTESGVMCLDIHPEHPHMLAAGFYDGSVAVYSISEKMNKPLHQSTAKTGKHTDPVWQVKWQK---DDLDNNLNFFSVSSDGRVVQWTIVKSE-----LSHTDIINLELPEKSEGPEGTQIKSLG--CGTSFDFHKTINYLFLVGTEEGKIHKCS-----------------KTYTSTYLDTFDAHHMSVYSVRWNPFHPKTFISCSADWTVKIWDHTH 540          
BLAST of WD repeat-containing protein 34 vs. Ensembl Nematostella
Match: EDO34474 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP67])

HSP 1 Score: 47.7506 bits (112), Expect = 5.345e-6
Identity = 49/244 (20.08%), Postives = 98/244 (40.16%), Query Frame = 3
Query:  564 PDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNV--SGKTVSSNYCLVSLGNDGTIVMWNL--SMRKSTLIPLNRYTLTARDLPKSIRYRGS---LSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSP 1274
            P+ +    T    + F     +L+  G ++G I +++    ++   L SS     H  P+  + W +    G     +  LVS+  DG +  W++      + L+ L R  +T +        R S   +S+  +  C   +PND    + G+E G +  C+           NE Q ++S         +G ++ V+W+ L        SA   + +++ + +  + +       + D+S SP
Sbjct:   10 PERVFHLNTGVTALDFSGAHPNLLAVGLYDGTIAIYNIRCTDDSPALDSSESVGKHTSPVWQLQWVDREQGGNGDEHDEILVSISADGRVTKWSIRKGFESADLMKLKRINVTKQKAGGGGSERKSDALISRFAAGFCFDFSPNDANIYLAGTEEGHVHKCSCSY--------NE-QYLES-----FHGHTGPIYQVKWNPLYPEAFLTCSADWSVRLWHCDRQFPVMSFLSSTKSVNDISWSP 239          
BLAST of WD repeat-containing protein 34 vs. Ensembl Medaka
Match: wdr34 (WD repeat domain 34 [Source:NCBI gene;Acc:101171758])

HSP 1 Score: 140.584 bits (353), Expect = 1.163e-35
Identity = 102/462 (22.08%), Postives = 210/462 (45.45%), Query Frame = 3
Query:  261 FIKKVVPKIYKVLLSNERSNAFNIPQTVNGD----IKESMCLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLET---TTCACCVQFH--YYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQ-EIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKN--LDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENRSKNPTKNSEIHNQ 1610
            F++KV  K+ + L+ N +S+AF+  Q    D    +    CL     +   F   +V+ +SW+C G+V+A A+G      W    +  + +++L  R   +  ++P+ +++     T  CC   H       L+  G +NGE+VVW+ S+ ++ +   +   +  H+EP+  + W  +  K    ++ ++S  + G +++W +   ++ L+  + Y L  + +P SI  RGS +  ++ L  +L+P D++  ++GSE G+   C+   +  ++     L   +K+P        SG V+ +  S    N   +    G+ +I+++     + ++     Y++ +  SP  P +   +   G + + +    +L   + +++   DH +                           C++FN      +A    NGT+ IWQLS +L E + +  T+  +I NQ
Sbjct:   76 FLQKVEDKVVRELVKNAKSHAFDGFQANWEDHSTGVSRLHCLQYPSAQEQGF---HVTSVSWSCTGSVVACAYGRTDDGDWSTERSC-VCLWNLEQRG--LQSNQPNLIIDAPSAVTALCCHPNHPSELWDVLVAGGLYNGEVVVWNTSQTQDPVWAQTGMSSDSHREPVYQVAWVPLQKK---GDFGILSACSGGRVLLWLVDSYRTRLVLNDGYALAKQQIPHSISGRGSNTVGVTSL--ALSPWDSDTFLVGSEGGLQLKCSFSSRMLAAVPSEGLSVALKAPAVFAFRPHSGPVYSLHCSPFHRNLFVSAGTDGLAHIHSLLQADPLLSLRVSDSYVFQVQWSPTRPLVFAAASGQGDVQIFDLGRRSLRPAASIQDGGADHAA--------------------------TCLDFNRHRPRVLAVGKTNGTVSIWQLSDDLVEQKPRECTQLEQIANQ 500          
BLAST of WD repeat-containing protein 34 vs. Ensembl Medaka
Match: dnai2 (dynein axonemal intermediate chain 2 [Source:NCBI gene;Acc:100500716])

HSP 1 Score: 70.8626 bits (172), Expect = 1.609e-12
Identity = 75/328 (22.87%), Postives = 143/328 (43.60%), Query Frame = 3
Query:  411 KNVSQLSWNCN-GTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATIS---GAVHGVQWSKLLA-NFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLD 1379
            + V+ LSW+ + G  LAAA+  ++  +     +T   I+ +   +       P+ +L+  +   C++++  ++  ++ G +NG++  WD  R      +A SS    H++P+  ++W  +  KT +  +   S   DG ++ W++   +    P  R  L   DL K     G+L ++L  +            ++G+E G++  CN K               K+P E ++ T     G+V+ VQ +  L  NF+        I+  +++    I+  + G   L D   SP+ P +  T   NG L + + L N    T  +K  D
Sbjct:  160 RTVTSLSWSPDRGRKLAAAYSSVVFQQ-TSQLSTDSYIWDVEKPSI------PEMVLKPPSPLVCLEYNPRVSYTLMGGCYNGQVAYWDTRRGCQ--TVAYSSVEHSHKDPVYKVIW--LQSKTGTDAF---SASTDGQVLWWDV---RKLSEPTERLIL---DLSKE----GNLGRALGGISLEFEITMPTKFMVGTEEGLIISCNRK--------------AKTPAEKIVCTYDGHRGSVYAVQRNPFLPKNFLTVGDWCARIWSEDIKESSIINT-KNGVSELMDACWSPVRPSVFFTVKMNGVLDIWDILFNQSDPTLSVKVCD 448          
BLAST of WD repeat-containing protein 34 vs. Ensembl Medaka
Match: DYNC1I1 (dynein cytoplasmic 1 intermediate chain 1 [Source:NCBI gene;Acc:101175663])

HSP 1 Score: 62.3882 bits (150), Expect = 8.213e-10
Identity = 61/265 (23.02%), Postives = 111/265 (41.89%), Query Frame = 3
Query:  540 NKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNF 1334
            N K  +  P+ +    +    V F  +  +L+V GT++G+IV+WD        +  +      H  P+  +   NV G   ++N  L++L  DG +  W+L M            L+       + Y  S SK +++   +    D    V+GSE G ++  N     S + I +  +  + P   +  +   AV  V +S L   F+ + S    + +++ +H + + + E    Y+YD+  SP+ P         G L L N 
Sbjct:  290 NIKFKKATPEYIFHCQSPVVSVGFARFHPNLLVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCV---NVVGTQNANN--LITLSTDGKMCSWSLDM------------LSQPQETMELVY--SKSKPVAVTGMAFPTGDVNNYVVGSEDGSVY--NASRHGSKAGICDMFEGHQGPVTGI--SCHSAVGPVDFSHL---FITS-SFDWTVKLWSTKHNKPLYSFEDNADYVYDVMWSPVHPATFAAVDGMGRLDLWNL 527          
BLAST of WD repeat-containing protein 34 vs. Ensembl Medaka
Match: DYNC1I1 (dynein cytoplasmic 1 intermediate chain 1 [Source:NCBI gene;Acc:101175663])

HSP 1 Score: 62.003 bits (149), Expect = 1.109e-9
Identity = 61/265 (23.02%), Postives = 111/265 (41.89%), Query Frame = 3
Query:  540 NKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNF 1334
            N K  +  P+ +    +    V F  +  +L+V GT++G+IV+WD        +  +      H  P+  +   NV G   ++N  L++L  DG +  W+L M            L+       + Y  S SK +++   +    D    V+GSE G ++  N     S + I +  +  + P   +  +   AV  V +S L   F+ + S    + +++ +H + + + E    Y+YD+  SP+ P         G L L N 
Sbjct:  313 NIKFKKATPEYIFHCQSPVVSVGFARFHPNLLVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCV---NVVGTQNANN--LITLSTDGKMCSWSLDM------------LSQPQETMELVY--SKSKPVAVTGMAFPTGDVNNYVVGSEDGSVY--NASRHGSKAGICDMFEGHQGPVTGI--SCHSAVGPVDFSHL---FITS-SFDWTVKLWSTKHNKPLYSFEDNADYVYDVMWSPVHPATFAAVDGMGRLDLWNL 550          
BLAST of WD repeat-containing protein 34 vs. Ensembl Medaka
Match: DYNC1I1 (dynein cytoplasmic 1 intermediate chain 1 [Source:NCBI gene;Acc:101175663])

HSP 1 Score: 61.6178 bits (148), Expect = 1.204e-9
Identity = 61/265 (23.02%), Postives = 111/265 (41.89%), Query Frame = 3
Query:  540 NKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNF 1334
            N K  +  P+ +    +    V F  +  +L+V GT++G+IV+WD        +  +      H  P+  +   NV G   ++N  L++L  DG +  W+L M            L+       + Y  S SK +++   +    D    V+GSE G ++  N     S + I +  +  + P   +  +   AV  V +S L   F+ + S    + +++ +H + + + E    Y+YD+  SP+ P         G L L N 
Sbjct:  327 NIKFKKATPEYIFHCQSPVVSVGFARFHPNLLVGGTYSGQIVLWDNRSHRRTPVQRTPLSAAAHTHPVYCV---NVVGTQNANN--LITLSTDGKMCSWSLDM------------LSQPQETMELVY--SKSKPVAVTGMAFPTGDVNNYVVGSEDGSVY--NASRHGSKAGICDMFEGHQGPVTGI--SCHSAVGPVDFSHL---FITS-SFDWTVKLWSTKHNKPLYSFEDNADYVYDVMWSPVHPATFAAVDGMGRLDLWNL 564          
BLAST of WD repeat-containing protein 34 vs. Planmine SMEST
Match: SMESG000051100.1 (SMESG000051100.1)

HSP 1 Score: 1052.74 bits (2721), Expect = 0.000e+0
Identity = 511/514 (99.42%), Postives = 513/514 (99.81%), Query Frame = 3
Query:   87 NWKRNCSTKEFTTQTDTYKIIHRGLNIKKHRSSECQTDSYLYVEEDIHPDVDESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTVNGDIKESMCLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNLTENRSKNPTKNSEIHNQFSNVKK 1628
            NWKRNCSTKEFTTQTDTYKIIHRGLNIKKHRSSECQTDSYLYVEEDIHPDVDESELNTFIKKVVP+IYKVLLSNERSNAFNIPQTVNGDIKESMCLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKK FEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASD+NGTIYIWQLSQNLTENRSKNPTKNSEIHNQFSNVKK
Sbjct:   15 NWKRNCSTKEFTTQTDTYKIIHRGLNIKKHRSSECQTDSYLYVEEDIHPDVDESELNTFIKKVVPRIYKVLLSNERSNAFNIPQTVNGDIKESMCLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKFFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDINGTIYIWQLSQNLTENRSKNPTKNSEIHNQFSNVKK 528          
BLAST of WD repeat-containing protein 34 vs. Planmine SMEST
Match: SMESG000047563.1 (SMESG000047563.1)

HSP 1 Score: 70.4774 bits (171), Expect = 1.752e-12
Identity = 82/350 (23.43%), Postives = 144/350 (41.14%), Query Frame = 3
Query:  411 KNVSQLSWN-CNGTVLAAAFGDIIHNKWCVHTNTGIGI---FSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWS-NVSGKTVSSNYCLVSLGNDGTIVMWNLSMRK----STLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISG---AVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVL 1424
            +NV+  +WN  N  +LA  +GD  +       N   G+   +SL    K I  D P+      + A  + +    ++L+  G  NG I V+D  +  ++ ++ +   +  H  P+  + W   VSG++   +  L+S+ +DG +  W  S+RK    S L+ L R         K  +    +S+  S  C + NP D    + G E G +  C+                  S  E  L    G    V+G++WS  + +   + SA   I ++++E +  +   +     +  ++ SP    +I      G + + N          +L  LD    +NI  PEYTVL
Sbjct:  441 RNVAAFAWNRQNPDILAVCYGDFDY------ANQKPGLVCCWSL----KNI--DYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQW--SVRKGFESSDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSC-----------------SYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPK-SSVIFACVNEGAVEVWNL---------QLSTLDPLIVENIC-PEYTVL 748          
BLAST of WD repeat-containing protein 34 vs. Planmine SMEST
Match: SMESG000047563.1 (SMESG000047563.1)

HSP 1 Score: 66.6254 bits (161), Expect = 2.661e-11
Identity = 81/356 (22.75%), Postives = 143/356 (40.17%), Query Frame = 3
Query:  411 KNVSQLSWN-CNGTVLAAAFGDIIHNKWCVHTNTGIGI---FSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWS-NVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKS----------TLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISG---AVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVL 1424
            +NV+  +WN  N  +LA  +GD  +       N   G+   +SL    K I  D P+      + A  + +    ++L+  G  NG I V+D  +  ++ ++ +   +  H  P+  + W   VSG++   +  L+S+ +DG +  W  S+RK            L+ L R         K  +    +S+  S  C + NP D    + G E G +  C+                  S  E  L    G    V+G++WS  + +   + SA   I ++++E +  +   +     +  ++ SP    +I      G + + N          +L  LD    +NI  PEYTVL
Sbjct:  434 RNVAAFAWNRQNPDILAVCYGDFDY------ANQKPGLVCCWSL----KNI--DYPERTFRLPSGATAISWSKTHSNLLAIGMFNGTISVFDVRKKSDESVVDTKHASGRHLGPVRQLEWVIRVSGRSEEHSEVLISISSDGRVTQW--SVRKGFESSESDFHHDLMKLKRIATRIPGAGKQKKTDALISQYASGSCFAFNPKDPNIYLAGVEEGHIHKCSC-----------------SYNEQYLDNFFGHTAPVYGIKWSPFMNDVFLSCSADWTIKLWHIERQNPVINFQSAVKSVNSIAWSPK-SSVIFACVNEGAVEVWNL---------QLSTLDPLIVENIC-PEYTVL 747          
BLAST of WD repeat-containing protein 34 vs. Planmine SMEST
Match: SMESG000045332.1 (SMESG000045332.1)

HSP 1 Score: 59.3066 bits (142), Expect = 4.535e-9
Identity = 66/277 (23.83%), Postives = 118/277 (42.60%), Query Frame = 3
Query:  564 PDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWD-----RSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVH-GVQWSKLLANFVAAISATGIIYI-----YNVE--------HKQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFL 1337
            P+ +L   +      F  +  SLIV GT++G+IV+WD     R+  +  L+ A++     H  P++S+     S     + + L+SL  DG +  W + M      P+  + L+            + SK ++  C     NDN++ V+G E G ++L        +S IG++      P E +  T+ GA H G   S     + +       +++     Y+V+            I  ++    Y+YD+  SP+ P +      +G L + NFL
Sbjct:  284 PENVLHYQSPIIAAMFAKHHNSLIVGGTYSGQIVIWDIRSNKRTPVQRTLLSATA-----HTHPVSSL-----STVGTHNAHSLLSLSTDGKMCTWRMEMLSQ---PIESFQLS-----------NTKSKEITSTCMEFLQNDNKF-VVGGEDGNVYL--------ASRIGSK------PGECL--TVEGASHDGPIMSVSTQKYSSPDHDCKDLFLTSSVDYSVKLWSNSESYSSNLIFTLDDRSDYVYDVDWSPIHPAVFCCVDGSGKLEVWNFL 519          
BLAST of WD repeat-containing protein 34 vs. Planmine SMEST
Match: SMESG000075110.1 (SMESG000075110.1)

HSP 1 Score: 59.3066 bits (142), Expect = 4.811e-9
Identity = 81/396 (20.45%), Postives = 153/396 (38.64%), Query Frame = 3
Query:  411 KNVSQLSWNCNG-TVLAAAFGDIIHNKWCVHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAGTHNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNYCLVSLGNDGTIVMWNL-SMRKSTLI----PLNRYTLTARDLPKSIRYRGSLSKSLSILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTESVLATISGAVHGVQWSKLLA-NFVAAISATGIIYIYNVEH------KQQISAIEPGQGYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSEDNISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQLSQNL 1559
            +  + +SW  +G T LA A+ +        +T+T   I+ +   NK      PD +L+  +   C++++   +  ++ G +NG++ +WDR R  +     S  EN  H++P   ++W  +  KT +  +   S   DG +  W++  M + T I    P  +  L       ++ Y  ++                   + G+E G +  CN K K+ +  I            ++     G V+ +Q +     NF+     T  I+  ++        K  +SA       L D   SP+ P +  T+  +GTL + + +                      +P   +  C+E         +NC+   EQ    +A    +GT  I +LS+  
Sbjct:  162 RTATHISWFPDGPTKLAVAYCNTEFQSSPPNTSTDSYIWDVMNPNK------PDLVLKPVSPLVCIEYNPKDSHTLIGGCYNGQLALWDR-RKGSQPTEVSPVENS-HRDPAWKVIW--IQSKTGTECF---SASTDGQVFWWDVRKMAEPTEIMILDPTKKQDLEKAQGAYALEYESTIPTK---------------FMAGTEQGSIMSCNRKGKTPADKIA-----------AIYPGHLGPVYALQRNPFFPKNFLTVGDWTARIWSEDIRDSSIMWTKYHLSA-------LTDGMWSPVRPAVFFTTKMDGTLDVWDIVFKQ------------------KEPTLRIQVCDES--------LNCLRVQEQG-RLIACGSHSGTTTILELSEGF 484          
The following BLAST results are available for this feature:
BLAST of WD repeat-containing protein 34 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WDR341.104e-3922.01WD repeat domain 34 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DNAI22.727e-1021.82dynein axonemal intermediate chain 2 [Source:HGNC ... [more]
DNAI22.727e-1021.82dynein axonemal intermediate chain 2 [Source:HGNC ... [more]
DNAI23.090e-1021.71dynein axonemal intermediate chain 2 [Source:HGNC ... [more]
DNAI24.346e-1022.42dynein axonemal intermediate chain 2 [Source:HGNC ... [more]
back to top
BLAST of WD repeat-containing protein 34 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 34 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dnai21.479e-1027.73gene:FBgn0036195 transcript:FBtr0332765[more]
Dnai21.488e-1027.73gene:FBgn0036195 transcript:FBtr0301326[more]
sw5.517e-920.41gene:FBgn0003654 transcript:FBtr0089406[more]
sw5.968e-920.41gene:FBgn0003654 transcript:FBtr0089407[more]
sw6.676e-920.41gene:FBgn0003654 transcript:FBtr0089401[more]
back to top
BLAST of WD repeat-containing protein 34 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr345.193e-4623.06WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
dync1i12.726e-1222.26dynein, cytoplasmic 1, intermediate chain 1 [Sourc... [more]
dnai2b3.344e-1020.70dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b4.104e-1020.70dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b2.568e-920.38dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
back to top
BLAST of WD repeat-containing protein 34 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rwdd2b4.722e-4022.91RWD domain containing 2B [Source:Xenbase;Acc:XB-GE... [more]
ogfod31.876e-1121.052-oxoglutarate and iron-dependent oxygenase domain... [more]
ogfod32.003e-1121.052-oxoglutarate and iron-dependent oxygenase domain... [more]
ogfod32.068e-1121.052-oxoglutarate and iron-dependent oxygenase domain... [more]
ogfod32.071e-1121.052-oxoglutarate and iron-dependent oxygenase domain... [more]
back to top
BLAST of WD repeat-containing protein 34 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wdr342.148e-3520.67WD repeat domain 34 [Source:MGI Symbol;Acc:MGI:191... [more]
Dync1i18.108e-1022.56dynein cytoplasmic 1 intermediate chain 1 [Source:... [more]
Dync1i11.006e-922.56dynein cytoplasmic 1 intermediate chain 1 [Source:... [more]
Dync1i11.116e-922.56dynein cytoplasmic 1 intermediate chain 1 [Source:... [more]
Dync1i11.343e-922.56dynein cytoplasmic 1 intermediate chain 1 [Source:... [more]
back to top
BLAST of WD repeat-containing protein 34 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96EX3|WDR34_HUMAN5.303e-3922.01WD repeat-containing protein 34 OS=Homo sapiens OX... [more]
sp|Q5U4F6|WDR34_MOUSE1.236e-3420.67WD repeat-containing protein 34 OS=Mus musculus OX... [more]
sp|Q16960|DYI3_HELCR2.314e-1021.02Dynein intermediate chain 3, ciliary OS=Heliocidar... [more]
sp|Q9GZS0|DNAI2_HUMAN1.310e-921.82Dynein intermediate chain 2, axonemal OS=Homo sapi... [more]
sp|O14576|DC1I1_HUMAN5.155e-922.56Cytoplasmic dynein 1 intermediate chain 1 OS=Homo ... [more]
back to top
BLAST of WD repeat-containing protein 34 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9K5041.027e-5528.43Uncharacterized protein OS=Biomphalaria glabrata O... [more]
V4A1491.122e-5527.00WD_REPEATS_REGION domain-containing protein OS=Lot... [more]
A0A210R2429.940e-5527.47WD repeat-containing protein 34 OS=Mizuhopecten ye... [more]
A0A433TII64.485e-5428.14WD_REPEATS_REGION domain-containing protein OS=Ely... [more]
K1R5F12.714e-5227.11WD repeat-containing protein 34 OS=Crassostrea gig... [more]
back to top
BLAST of WD repeat-containing protein 34 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr345.332e-4022.36WD repeat domain 34 [Source:NCBI gene;Acc:10302228... [more]
dnai2b3.222e-1421.66dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b7.293e-1421.66dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b8.984e-1421.66dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
dnai2b1.223e-1321.66dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
back to top
BLAST of WD repeat-containing protein 34 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
wdr341.563e-3324.89WD repeat domain 34 [Source:ZFIN;Acc:ZDB-GENE-0709... [more]
dync1i2a2.476e-1020.87dynein, cytoplasmic 1, intermediate chain 2a [Sour... [more]
dnai2b1.594e-824.07dynein, axonemal, intermediate chain 2b [Source:ZF... [more]
back to top
BLAST of WD repeat-containing protein 34 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of WD repeat-containing protein 34 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO432314.965e-4426.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490791.761e-1120.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO400753.552e-921.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361984.707e-621.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344745.345e-620.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of WD repeat-containing protein 34 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr341.163e-3522.08WD repeat domain 34 [Source:NCBI gene;Acc:10117175... [more]
dnai21.609e-1222.87dynein axonemal intermediate chain 2 [Source:NCBI ... [more]
DYNC1I18.213e-1023.02dynein cytoplasmic 1 intermediate chain 1 [Source:... [more]
DYNC1I11.109e-923.02dynein cytoplasmic 1 intermediate chain 1 [Source:... [more]
DYNC1I11.204e-923.02dynein cytoplasmic 1 intermediate chain 1 [Source:... [more]
back to top
BLAST of WD repeat-containing protein 34 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051100.10.000e+099.42SMESG000051100.1[more]
SMESG000047563.11.752e-1223.43SMESG000047563.1[more]
SMESG000047563.12.661e-1122.75SMESG000047563.1[more]
SMESG000045332.14.535e-923.83SMESG000045332.1[more]
SMESG000075110.14.811e-920.45SMESG000075110.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031755 ID=SMED30031755|Name=WD repeat-containing protein 34|organism=Schmidtea mediterranea sexual|type=transcript|length=1642bp
TAAAGTGTTTAAATAATTATTGCTAAGGACTCCAGTATTTTCAAATGTTT
TCCAGTGTAAGTTCTGAAGTTTATTCGTTTCAATCTAATTGGAAAAGAAA
TTGTTCTACTAAAGAATTTACAACCCAAACAGATACATATAAAATAATTC
ACCGTGGTCTGAATATTAAGAAACATCGCAGCAGTGAATGTCAAACTGAT
TCATATTTATATGTCGAGGAAGATATACACCCTGACGTTGATGAAAGTGA
ATTAAATACTTTTATCAAAAAAGTAGTTCCGAAAATTTATAAAGTACTTT
TGAGTAATGAGCGTTCTAATGCATTTAATATACCTCAAACCGTTAATGGA
GACATAAAAGAAAGCATGTGTCTGTATAAAATTGAAAATAAAACAGACGA
ATTTGGAGTGAAAAATGTATCTCAATTATCATGGAATTGTAATGGAACTG
TATTGGCAGCAGCATTTGGCGACATTATTCATAATAAATGGTGCGTTCAC
ACAAATACAGGAATCGGAATATTCAGTCTCAGTGCAAGAAATAAAAAAAT
TTTCGAAGACAAACCAGATACGATGCTGGAGACAACAACTTGTGCTTGCT
GTGTACAATTTCATTATTATATGACTTCGTTGATAGTTGCTGGAACTCAT
AATGGAGAAATTGTAGTTTGGGATAGATCTAGAGCGGAAAATGATTTAAT
TTTAGCAAGTAGTAGTGAAAATAAAGTGCATCAAGAACCTATTAATTCAA
TATTGTGGTCAAACGTTTCGGGAAAAACGGTCTCATCGAATTATTGCTTG
GTGTCTCTTGGCAATGATGGCACAATCGTTATGTGGAATCTTTCAATGAG
AAAGTCTACATTGATTCCATTAAATCGTTATACTTTGACAGCTCGAGATT
TACCAAAATCTATACGTTACAGAGGGAGTTTATCAAAAAGTCTTTCTATA
CTTTGTGGTAGCTTAAACCCGAACGATAACGAATATCTTGTAATTGGAAG
TGAAATTGGAGTTTTATTCCTTTGTAACATTAAATTGAAAAGCAGTTCGT
CGTCTATTGGGAATGAATTGCAAGAAATTAAATCACCGACAGAATCAGTT
TTAGCAACTATTTCCGGCGCCGTCCATGGCGTGCAATGGAGTAAACTTTT
AGCAAATTTCGTTGCAGCTATTTCAGCAACTGGGATAATCTATATCTACA
ATGTCGAACATAAACAGCAAATATCAGCAATCGAGCCCGGTCAAGGATAT
TTGTACGATTTGAGTTTATCCCCTTTAATTCCGGGACTTATAGTCACATC
GGGTGAAAATGGCACATTAGTTTTGATGAATTTTCTTGAAAACAATCTCA
GCTTTACAAGCGAATTGAAGAATCTAGATCATAATTCAGAAGATAACATT
TCCAAACCGGAATATACAGTATTAAAATGTAACGAACTCAATACGAGAGA
AGATTCCATGATTATAAATTGTGTAGAATTCAATGAACAAAATATTGGAT
ACGTCGCTGCGTCTGATGTAAACGGCACTATTTATATTTGGCAACTTAGT
CAGAATTTAACGGAAAACCGGTCGAAAAACCCAACGAAAAACTCAGAAAT
TCACAATCAATTTAGCAATGTAAAAAAATAATTGAAAAATAT
back to top

protein sequence of SMED30031755-orf-1

>SMED30031755-orf-1 ID=SMED30031755-orf-1|Name=SMED30031755-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=529bp
MFSSVSSEVYSFQSNWKRNCSTKEFTTQTDTYKIIHRGLNIKKHRSSECQ
TDSYLYVEEDIHPDVDESELNTFIKKVVPKIYKVLLSNERSNAFNIPQTV
NGDIKESMCLYKIENKTDEFGVKNVSQLSWNCNGTVLAAAFGDIIHNKWC
VHTNTGIGIFSLSARNKKIFEDKPDTMLETTTCACCVQFHYYMTSLIVAG
THNGEIVVWDRSRAENDLILASSSENKVHQEPINSILWSNVSGKTVSSNY
CLVSLGNDGTIVMWNLSMRKSTLIPLNRYTLTARDLPKSIRYRGSLSKSL
SILCGSLNPNDNEYLVIGSEIGVLFLCNIKLKSSSSSIGNELQEIKSPTE
SVLATISGAVHGVQWSKLLANFVAAISATGIIYIYNVEHKQQISAIEPGQ
GYLYDLSLSPLIPGLIVTSGENGTLVLMNFLENNLSFTSELKNLDHNSED
NISKPEYTVLKCNELNTREDSMIINCVEFNEQNIGYVAASDVNGTIYIWQ
LSQNLTENRSKNPTKNSEIHNQFSNVKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0000775chromosome, centromeric region
GO:0000776kinetochore
GO:0000777condensed chromosome kinetochore
GO:0000922spindle pole
GO:0005694chromosome
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005868cytoplasmic dynein complex
GO:0005874microtubule
GO:0030286dynein complex
GO:0031982vesicle
GO:0048471perinuclear region of cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006334nucleosome assembly
GO:0006810transport
GO:0007018microtubule-based movement
GO:0047496vesicle transport along microtubule
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003774motor activity
GO:0003777microtubule motor activity
GO:0008017microtubule binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 526..528
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 509..528
NoneNo IPR availablePANTHERPTHR12442:SF26WD REPEAT-CONTAINING PROTEIN 34coord: 9..512
NoneNo IPR availablePANTHERPTHR12442DYNEIN INTERMEDIATE CHAINcoord: 9..512
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 171..210
e-value: 3.2
score: 13.8
coord: 216..265
e-value: 0.62
score: 18.3
coord: 461..500
e-value: 2.1
score: 14.9
coord: 349..386
e-value: 6.6
score: 11.8
coord: 289..328
e-value: 130.0
score: 3.7
coord: 389..429
e-value: 20.0
score: 8.8
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 287..526
e-value: 3.8E-17
score: 64.4
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 82..286
e-value: 3.5E-13
score: 51.7
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 252..266
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 124..499