Fatty-acid amide hydrolase 1-like

Overview
NameFatty-acid amide hydrolase 1-like
Smed IDSMED30031745
Length (bp)2118
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fatty-acid amide hydrolase 1-like (SMED30031745) t-SNE clustered cells

Violin plots show distribution of expression levels for Fatty-acid amide hydrolase 1-like (SMED30031745) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fatty-acid amide hydrolase 1-like (SMED30031745) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fatty-acid amide hydrolase 1-like (SMED30031745) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031745

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031745h1SMcG0020150 dd_Smed_v4_4966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031745h1SMcG0020150 dd_Smed_v4_4966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031745h1SMcG0020150 dd_Smed_v4_4966_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031745h1SMcG0020150 dd_Smed_v4_4966_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Human
Match: FAAH (fatty acid amide hydrolase [Source:HGNC Symbol;Acc:HGNC:3553])

HSP 1 Score: 219.55 bits (558), Expect = 3.677e-62
Identity = 166/491 (33.81%), Postives = 253/491 (51.53%), Query Frame = 3
Query:  309 KIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICP-VAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEA--KSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            K+ S ++    VL  +   +   N   N +    Y AD  + +        +  +P+S+ +    +  DST GL      P + D VVV VL+  GA+P + T   Q        N   G+T++P  S  S GG+SG     + +  S +G+ TD+ G IR P+SFCG+ GLKPT  R+SK   K   + Q  +  S+GP+AR+V  L    R++  E MF LDP  PP+ F E +++S +PL +GYY     N +  +PA+ RAVLE K++LE  GH LV +   N+      + +  + SD G + + +  KG+ +D  L   V +LKLP  +K LL   V         ++ ++   S   +W+ +  I+ Y++ V+A W   +LD V+ P +AP  A+DL           Y+++YN LDFPAG +PVT V   D  ++   +        K   +   KSVGLPV VQCV LPW+EE+ LR M+ +
Sbjct:   85 KLHSRELAPEAVLFTYVGKAWEVNKGTNCVTS--YLADCETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCEDMFRLDPTVPPLPFREEVYTSSQPLRVGYYET--DNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQN-FKGDFVDPCLGDLVSILKLPQWLKGLLAFLVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAP--ALDLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREV 568          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Human
Match: FAAH2 (fatty acid amide hydrolase 2 [Source:HGNC Symbol;Acc:HGNC:26440])

HSP 1 Score: 81.2629 bits (199), Expect = 1.922e-15
Identity = 62/253 (24.51%), Postives = 114/253 (45.06%), Query Frame = 3
Query:  249 KRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLM-----VDPK------------NNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSIS 956
            K P    + +  L+G ++   IR   +  +DV++A+    + +  D+N + + I +      M     VD K            N    + +PL+V +   ++   ++ GL+       K D  VV +L+  GAIP  IT   +  +   + N   G++ +P + +   GG+SG     LA   S+IG+ +D+ G IR+PA F G++G KP+   +  +    L      +    GP+ R   DL  + + ++
Sbjct:   39 KTPRPVTEPLLLLSGMQLAKLIRQRKVKCIDVVQAY----INRIKDVNPMINGIVKYRFEEAMKEAHAVDQKLAEKQEDEATLENKWPFLGVPLTVKEAFQLQGMPNSSGLMNRRDAIAKTDATVVALLKGAGAIPLGITNCSELCMWYESSNKIYGRSNNPYDLQHIVGGSSGGEGCTLAAACSVIGVGSDIGGSIRMPAFFNGIFGHKPSPGVVPNKGQFPLAVGAQELFLCTGPMCRYAEDLAPMLKVMA 287          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Celegans
Match: faah-1 (Fatty acid amide hydrolase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q17449])

HSP 1 Score: 226.098 bits (575), Expect = 4.969e-65
Identity = 151/508 (29.72%), Postives = 274/508 (53.94%), Query Frame = 3
Query:  276 ICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNN------SGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFE--LDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLV-KCQSKKTCCQRKCDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            I  L   +++ +++   +  V+ + A+   +++ +   N +   I +A+  +  +D +          +  +PLS+ + L ++ YD+T G +++++HP  +D + V+  ++ G IP   T   Q  +     N   G T +P +S  +CGG+SG     +    S+IGI TD+ G +R+P  F G  G+KP+  R + R   +    + +ID + GP+A++V   +   R++  +  F+   DP+CPPV +NE+++SSEK L +GYY++ G      TPA++RAVLE+KK LE  GH ++ +  P +  V  +++   +  D GQ ++N ++K + I+ ++ + V L  +P  ++R+L   VSL     G  ++SL     + + +    I++Y+EE +     +NLD ++CP +   A        V++   Y+ +YN+LDF AG +PVT V++ D +KL+ +        Q        +VG+P+GVQ    P+REE VLR M+ I
Sbjct:   63 IGSLDFEQLRDELQRGHVTCVEAIRAYFHKAILAHEKTNAVTCFILDAERQAEELDEQAKLPYYVKPPLFGVPLSLKECLKVKGYDTTRGFVQDAYHPATEDSIQVEHYKKLGLIPFCQTNVPQSLLSYNCSNPLFGTTTNPYDSTRTCGGSSGGEGALIGAGGSLIGIGTDVGGSVRIPCHFTGTAGIKPSKMRFAHRGGGASVPGKPLIDANDGPMAKDVKTNVEFLRNVWGDIDFQSDRDPYCPPVHWNESVYSSEKKLRVGYYIDDGWFTP--TPALQRAVLESKKHLEAAGHTVIPFYPPRLPSVM-QLYFRAVCLDGGQYVLNKLLK-DIIEPTIRFQVTLWMVPVWIQRILSYPVSLVFPRMGMLMQSLT-RDTFELREAYADIEAYREEFVGLMMKDNLDVILCPASIMPAPQHDIPSKVVSGVSYTCLYNLLDFGAGVVPVTAVSKSDEEKLINEYPETDKWYQITKKATLGAVGMPIGVQVAAPPYREEAVLRTMREI 565          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Celegans
Match: faah-1 (Fatty acid amide hydrolase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q17449])

HSP 1 Score: 226.098 bits (575), Expect = 4.969e-65
Identity = 151/508 (29.72%), Postives = 274/508 (53.94%), Query Frame = 3
Query:  276 ICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNN------SGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFE--LDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLV-KCQSKKTCCQRKCDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            I  L   +++ +++   +  V+ + A+   +++ +   N +   I +A+  +  +D +          +  +PLS+ + L ++ YD+T G +++++HP  +D + V+  ++ G IP   T   Q  +     N   G T +P +S  +CGG+SG     +    S+IGI TD+ G +R+P  F G  G+KP+  R + R   +    + +ID + GP+A++V   +   R++  +  F+   DP+CPPV +NE+++SSEK L +GYY++ G      TPA++RAVLE+KK LE  GH ++ +  P +  V  +++   +  D GQ ++N ++K + I+ ++ + V L  +P  ++R+L   VSL     G  ++SL     + + +    I++Y+EE +     +NLD ++CP +   A        V++   Y+ +YN+LDF AG +PVT V++ D +KL+ +        Q        +VG+P+GVQ    P+REE VLR M+ I
Sbjct:   63 IGSLDFEQLRDELQRGHVTCVEAIRAYFHKAILAHEKTNAVTCFILDAERQAEELDEQAKLPYYVKPPLFGVPLSLKECLKVKGYDTTRGFVQDAYHPATEDSIQVEHYKKLGLIPFCQTNVPQSLLSYNCSNPLFGTTTNPYDSTRTCGGSSGGEGALIGAGGSLIGIGTDVGGSVRIPCHFTGTAGIKPSKMRFAHRGGGASVPGKPLIDANDGPMAKDVKTNVEFLRNVWGDIDFQSDRDPYCPPVHWNESVYSSEKKLRVGYYIDDGWFTP--TPALQRAVLESKKHLEAAGHTVIPFYPPRLPSVM-QLYFRAVCLDGGQYVLNKLLK-DIIEPTIRFQVTLWMVPVWIQRILSYPVSLVFPRMGMLMQSLT-RDTFELREAYADIEAYREEFVGLMMKDNLDVILCPASIMPAPQHDIPSKVVSGVSYTCLYNLLDFGAGVVPVTAVSKSDEEKLINEYPETDKWYQITKKATLGAVGMPIGVQVAAPPYREEAVLRTMREI 565          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Celegans
Match: faah-1 (Fatty acid amide hydrolase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q17449])

HSP 1 Score: 226.098 bits (575), Expect = 4.969e-65
Identity = 151/508 (29.72%), Postives = 274/508 (53.94%), Query Frame = 3
Query:  276 ICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNN------SGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFE--LDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLV-KCQSKKTCCQRKCDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            I  L   +++ +++   +  V+ + A+   +++ +   N +   I +A+  +  +D +          +  +PLS+ + L ++ YD+T G +++++HP  +D + V+  ++ G IP   T   Q  +     N   G T +P +S  +CGG+SG     +    S+IGI TD+ G +R+P  F G  G+KP+  R + R   +    + +ID + GP+A++V   +   R++  +  F+   DP+CPPV +NE+++SSEK L +GYY++ G      TPA++RAVLE+KK LE  GH ++ +  P +  V  +++   +  D GQ ++N ++K + I+ ++ + V L  +P  ++R+L   VSL     G  ++SL     + + +    I++Y+EE +     +NLD ++CP +   A        V++   Y+ +YN+LDF AG +PVT V++ D +KL+ +        Q        +VG+P+GVQ    P+REE VLR M+ I
Sbjct:   63 IGSLDFEQLRDELQRGHVTCVEAIRAYFHKAILAHEKTNAVTCFILDAERQAEELDEQAKLPYYVKPPLFGVPLSLKECLKVKGYDTTRGFVQDAYHPATEDSIQVEHYKKLGLIPFCQTNVPQSLLSYNCSNPLFGTTTNPYDSTRTCGGSSGGEGALIGAGGSLIGIGTDVGGSVRIPCHFTGTAGIKPSKMRFAHRGGGASVPGKPLIDANDGPMAKDVKTNVEFLRNVWGDIDFQSDRDPYCPPVHWNESVYSSEKKLRVGYYIDDGWFTP--TPALQRAVLESKKHLEAAGHTVIPFYPPRLPSVM-QLYFRAVCLDGGQYVLNKLLK-DIIEPTIRFQVTLWMVPVWIQRILSYPVSLVFPRMGMLMQSLT-RDTFELREAYADIEAYREEFVGLMMKDNLDVILCPASIMPAPQHDIPSKVVSGVSYTCLYNLLDFGAGVVPVTAVSKSDEEKLINEYPETDKWYQITKKATLGAVGMPIGVQVAAPPYREEAVLRTMREI 565          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Celegans
Match: faah-1 (Fatty acid amide hydrolase 1 [Source:UniProtKB/Swiss-Prot;Acc:Q17449])

HSP 1 Score: 226.098 bits (575), Expect = 4.969e-65
Identity = 151/508 (29.72%), Postives = 274/508 (53.94%), Query Frame = 3
Query:  276 ICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNN------SGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFE--LDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLV-KCQSKKTCCQRKCDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            I  L   +++ +++   +  V+ + A+   +++ +   N +   I +A+  +  +D +          +  +PLS+ + L ++ YD+T G +++++HP  +D + V+  ++ G IP   T   Q  +     N   G T +P +S  +CGG+SG     +    S+IGI TD+ G +R+P  F G  G+KP+  R + R   +    + +ID + GP+A++V   +   R++  +  F+   DP+CPPV +NE+++SSEK L +GYY++ G      TPA++RAVLE+KK LE  GH ++ +  P +  V  +++   +  D GQ ++N ++K + I+ ++ + V L  +P  ++R+L   VSL     G  ++SL     + + +    I++Y+EE +     +NLD ++CP +   A        V++   Y+ +YN+LDF AG +PVT V++ D +KL+ +        Q        +VG+P+GVQ    P+REE VLR M+ I
Sbjct:   63 IGSLDFEQLRDELQRGHVTCVEAIRAYFHKAILAHEKTNAVTCFILDAERQAEELDEQAKLPYYVKPPLFGVPLSLKECLKVKGYDTTRGFVQDAYHPATEDSIQVEHYKKLGLIPFCQTNVPQSLLSYNCSNPLFGTTTNPYDSTRTCGGSSGGEGALIGAGGSLIGIGTDVGGSVRIPCHFTGTAGIKPSKMRFAHRGGGASVPGKPLIDANDGPMAKDVKTNVEFLRNVWGDIDFQSDRDPYCPPVHWNESVYSSEKKLRVGYYIDDGWFTP--TPALQRAVLESKKHLEAAGHTVIPFYPPRLPSVM-QLYFRAVCLDGGQYVLNKLLK-DIIEPTIRFQVTLWMVPVWIQRILSYPVSLVFPRMGMLMQSLT-RDTFELREAYADIEAYREEFVGLMMKDNLDVILCPASIMPAPQHDIPSKVVSGVSYTCLYNLLDFGAGVVPVTAVSKSDEEKLINEYPETDKWYQITKKATLGAVGMPIGVQVAAPPYREEAVLRTMREI 565          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Celegans
Match: faah-2 (Fatty Acid Amide Hydrolase homolog [Source:UniProtKB/TrEMBL;Acc:Q17447])

HSP 1 Score: 199.904 bits (507), Expect = 1.581e-55
Identity = 148/513 (28.85%), Postives = 265/513 (51.66%), Query Frame = 3
Query:  276 ICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPK------NNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTER-MFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAG----QSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNV---NQLDLDKLVKCQSKKTCCQRKCDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            I  +  SE++  ++S  I  +D +  + A ++  N   N +   + EA+  ++  D K          +  LP+S+ + + +E YD T G ++++F P + D V+V+ L++ GAIP + T   Q  +     N   G T HP +   + GG+SG  +  ++ + S++GI  D+ G IR+P ++ G  G+KP+  R S R        + +I+ + GP++  V   +   R++  +  + E DP+ PPV +NE  + S+K L IGYYV+ G      TP  +RAV+EAK+ LE+ GH LV ++ P V +V  ++    +  DAG    + ++NDII        + W      +P  ++R L S + +F    G+ + ++  ++V  +      I++Y+ E+        +DA++CPV  + A+       +     Y+ I+N+LD+ AGS+ VT+V   ++LDL+   +        ++       ++G P+GVQ  T P++EE  LRIM+ I
Sbjct:   64 IAAMEYSELKDGLQSGKITCIDAVRTYYAKAISANEKTNSVCMFVKEAEKWAMDWDEKAKDPQFQKPPLFGLPMSLKECVPLEGYDQTRGFVQDTFRPTETDGVLVQQLKKLGAIPYVQTNVPQSLLSYNCSNPVYGTTNHPMDKTRTSGGSSGGESALISADGSLLGIGGDVGGSIRIPCAYTGTTGIKPSHLRFSHRGVCGSVPGRPLINSNDGPMSTRVETNVDFLRTVWADTWITEQDPYVPPVTWNEEAYKSDKKLKIGYYVDDGWFTP--TPVCQRAVMEAKQILEDSGHTLVPFRPPRVPEVL-RMFLRAVCVDAGTFLSKKLMNDIIDPLLYTQVVLW-----MVPVPIQRFLSSIIKVFFPRLGNLMDAMTLSTV-ELRNTYADIEAYRSEMAGLMVDQKIDALLCPVTVSPALPHVSPSKLFAGTSYTGIFNLLDYAAGSVNVTHVTKQDELDLEDYEESDPWYALAKKG---SRGTIGFPIGVQVATPPYKEETCLRIMREI 564          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Fly
Match: CG5112 (gene:FBgn0039341 transcript:FBtr0084878)

HSP 1 Score: 83.5741 bits (205), Expect = 2.101e-16
Identity = 71/302 (23.51%), Postives = 129/302 (42.72%), Query Frame = 3
Query:  297 EIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLAD-----VIYEADVSSLMVDPKNNSG-------VMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTP---AVERAVLEAKKALENVGHKLVKY 1157
            E+  +IR     + D+++A+       N DLN + D      + +A      +D K  S         + +P S  D   +     T GLL      +  D   V++++E+GAI    +   + +  + + N+  G T +P + + S GG+SG  A  +A   +  G+ TD+ G IR+PA  CG++G KPTS  ++         K+       GP++R+  DL+ + + +            P +     L        + Y+    +  ++C P     ER + + +K  E V  K V++
Sbjct:   55 ELAQQIRERRQRSYDIVKAYCERIESVNRDLNAVVDGPFPEALDQAREIDRKLDEKEYSDEDLRRLPFLGVPFSTKDSTAVAGRLHTLGLLARKSERSTTDAECVRLMKESGAIIIATSNVPEVNKWIESRNMLIGCTNNPYDLRRSVGGSSGGEAALIAACCTGFGLGTDIGGSIRIPAFNCGIFGHKPTSGAVNMAGCTFRTGKEKDTMVCAGPMSRSARDLLPMMQVLVE----------PSLKAKLKLDQKVDLKRLRYFYVSSNGMAQCNPINRETERVMYKIRKHFEAVSGKDVRH 346          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Fly
Match: CG7910 (gene:FBgn0037547 transcript:FBtr0081790)

HSP 1 Score: 82.8037 bits (203), Expect = 3.307e-16
Identity = 66/276 (23.91%), Postives = 124/276 (44.93%), Query Frame = 3
Query:  234 KFQGMKRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPK---------------NNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKR--FTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNE 1010
            KF G++ P     V+      E+ +++R  +I +V+++ A+ A     N  LN + +  +EA +    +  +                   ++ +P +V +   ++      G L        +D  VV+++R  G IP +++   +  +   T N   G+ ++P + + +  G+SG  A      ++  G+ +D+ G IR+PA FCGV+G KPT    S +  F  SL  K+      IGP+ R   DL  L   ++ ++  +L     PVA  +
Sbjct:   33 KFSGIRNPLLKKSVV------ELVTQLRRGEITSVELVSAYIARVQEVNPSLNAVVEDRFEAALQDAKLADQFIEKASSEFDRVALYTKYPILGVPFTVKESCGLKGLSFAVGSLARKNMKAPQDGDVVELVRAAGGIPLLVSANPEFCMSFETSNNIQGRCLNPYDLQRTSAGSSGGEASLNGCGATTFGVGSDISGSIRLPALFCGVFGHKPTGGLTSVKGHFPYSLTDKKFSEMLQIGPITRFARDLPLLLEIMAGDKKHKLK-MSEPVALKD 301          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Fly
Match: CG7910 (gene:FBgn0037547 transcript:FBtr0339720)

HSP 1 Score: 82.8037 bits (203), Expect = 3.307e-16
Identity = 66/276 (23.91%), Postives = 124/276 (44.93%), Query Frame = 3
Query:  234 KFQGMKRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPK---------------NNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKR--FTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNE 1010
            KF G++ P     V+      E+ +++R  +I +V+++ A+ A     N  LN + +  +EA +    +  +                   ++ +P +V +   ++      G L        +D  VV+++R  G IP +++   +  +   T N   G+ ++P + + +  G+SG  A      ++  G+ +D+ G IR+PA FCGV+G KPT    S +  F  SL  K+      IGP+ R   DL  L   ++ ++  +L     PVA  +
Sbjct:   33 KFSGIRNPLLKKSVV------ELVTQLRRGEITSVELVSAYIARVQEVNPSLNAVVEDRFEAALQDAKLADQFIEKASSEFDRVALYTKYPILGVPFTVKESCGLKGLSFAVGSLARKNMKAPQDGDVVELVRAAGGIPLLVSANPEFCMSFETSNNIQGRCLNPYDLQRTSAGSSGGEASLNGCGATTFGVGSDISGSIRLPALFCGVFGHKPTGGLTSVKGHFPYSLTDKKFSEMLQIGPITRFARDLPLLLEIMAGDKKHKLK-MSEPVALKD 301          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Fly
Match: CG5191 (gene:FBgn0038803 transcript:FBtr0083907)

HSP 1 Score: 80.8777 bits (198), Expect = 1.447e-15
Identity = 66/278 (23.74%), Postives = 135/278 (48.56%), Query Frame = 3
Query:  258 FENIKVI-----------CELTGSEIQSKIRSHDILAVDVLEAF-----QANSLMKNNDLNFLADVIYEA-DVSSLMVDPKNN-------SGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIID-YSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEAL 1016
            + NIKVI            E+   ++   IR+  I + +V+EA+     Q N L+     +   + + EA ++ +++    N+       + ++ +P++V + + ++   +  G + ++    K D  VV+ ++ +G I  +++ T +  ++  T N  +G+T +P + K + GG+SG  A  LA+ +S++G+ +D+ G  R+PA F G++G KPT   +S +            D ++I P+ R   DL  L + +S       DP  P +  +  +
Sbjct:   22 YTNIKVIRRKLPPIRSHLLEIPAVDLAKLIRTRKIKSEEVVEAYIERCRQVNPLINAIVQDRFEEALEEAREIDNVIAMGINSVESMEELTPLLGIPVTVKESIAVKGMTNQAGRVFKTPQIAKSDAPVVEQIKRSGGIILLVSNTPELCLLWETYNNVTGQTKNPYDLKRTPGGSSGGEAALLASGASLLGLTSDIGGSSRLPAMFSGIWGHKPTPYAVSFKGHHPTSDFPKWGDFFTIAPMTRYAKDLPLLLKCMS-------DPTGPKLTLDRPI 292          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Fly
Match: CG5191 (gene:FBgn0038803 transcript:FBtr0345213)

HSP 1 Score: 80.8777 bits (198), Expect = 1.447e-15
Identity = 66/278 (23.74%), Postives = 135/278 (48.56%), Query Frame = 3
Query:  258 FENIKVI-----------CELTGSEIQSKIRSHDILAVDVLEAF-----QANSLMKNNDLNFLADVIYEA-DVSSLMVDPKNN-------SGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIID-YSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEAL 1016
            + NIKVI            E+   ++   IR+  I + +V+EA+     Q N L+     +   + + EA ++ +++    N+       + ++ +P++V + + ++   +  G + ++    K D  VV+ ++ +G I  +++ T +  ++  T N  +G+T +P + K + GG+SG  A  LA+ +S++G+ +D+ G  R+PA F G++G KPT   +S +            D ++I P+ R   DL  L + +S       DP  P +  +  +
Sbjct:   22 YTNIKVIRRKLPPIRSHLLEIPAVDLAKLIRTRKIKSEEVVEAYIERCRQVNPLINAIVQDRFEEALEEAREIDNVIAMGINSVESMEELTPLLGIPVTVKESIAVKGMTNQAGRVFKTPQIAKSDAPVVEQIKRSGGIILLVSNTPELCLLWETYNNVTGQTKNPYDLKRTPGGSSGGEAALLASGASLLGLTSDIGGSSRLPAMFSGIWGHKPTPYAVSFKGHHPTSDFPKWGDFFTIAPMTRYAKDLPLLLKCMS-------DPTGPKLTLDRPI 292          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Zebrafish
Match: faah (fatty acid amide hydrolase [Source:ZFIN;Acc:ZDB-GENE-070619-3])

HSP 1 Score: 221.861 bits (564), Expect = 3.470e-63
Identity = 172/550 (31.27%), Postives = 281/550 (51.09%), Query Frame = 3
Query:  159 QWRRIKKKIAKKCNDTDSRKIGLFQKFQGMKR-----PFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIK-SLAG----ASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEA--KSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            +WR  +K   K  N    R   L Q  Q ++R     P      I  L+ SE+  K++   +    VL AF   +L  N +LN   +++ E+      ++ +    +  +P+S+ D    + +DS+ G++ +   P   D V+V VL++ GAIP I T   QG +    GN   G+T++P N + + GG+SG     +    SI+G+ TD+ G IR+P++FCG+ G KPT++R+S R   +    Q  +  SIGPLAR+V  L    R++  + MF LDP  PP+ FN+ ++ S KPL IGYY   G  Q   +P++ RAV E K+ LE  GH  V +Q   +  +F+++    +  D G+++ +  +K   +D  L        +     R +   +S   KP    I  SL G     SV  +W+    ++ Y +EV+A W   ++D ++CP+    A +      + +   Y+ +YN+L+FPAG + V+ V + D  +L +          K   +A    VGLPV VQCV+LPW++E+ LR M+ +
Sbjct:   36 KWRNNQKIQNKILNARRRRDKSLEQAEQAVQRFKIQNPGFQSSSIVSLSLSELTGKLQDGSLQPDAVLYAFMEKTLEVNRNLNCGTEMLMESVAQLKDMNTQKKGLLYGVPISIKDNFGYKGHDSSCGVVSKLDQPAVMDSVIVTVLKKQGAIPFIKTNIPQGLLNYDCGNPIFGQTLNPYNLQKTSGGSSGGEGALIGGGGSILGLGTDIGGSIRIPSAFCGICGFKPTARRLSTRGIDTCVKGQKSVLSSIGPLARDVESLALCMRALLCQDMFSLDPTIPPLPFNQEVYESSKPLRIGYYETDGYLQP--SPSMARAVRETKELLERAGHTFVPFQPLRLYNIFHELALRGILGDGGETLFSH-LKAGPLDPCL----CSQPVTLGSPRFIRKMLSFLIKPFFPRISASLHGTCGLGSVAELWRQHANVEEYIQEVIAEWRRLDVDVLLCPIL-GPAFNFHYCGRLNSALSYTTLYNLLNFPAGVVCVSAVTEDDEAQLRQYTGAHGDPWDKLFQQAVKGGVGLPVAVQCVSLPWQDEMCLRFMREV 577          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Zebrafish
Match: faah2a (fatty acid amide hydrolase 2a [Source:NCBI gene;Acc:436973])

HSP 1 Score: 71.2478 bits (173), Expect = 1.965e-12
Identity = 82/351 (23.36%), Postives = 156/351 (44.44%), Query Frame = 3
Query:  231 QKFQGMKR--PFENIKVICELTGSEIQSKIRSHDILAVDVLEAF---------QANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVM-------ALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKAL-----ENVGHKLVKYQLPNVEKVFNKVHSTIMAS 1214
            Q+  G+ R  P  N  ++  L+  ++  KIR  ++ +V+V++A+           N+++K+    F A +   A V  L+ +      V+        +P++V +   ++   ++ GLL      +  D   V +L+  GAIP  +T   +  + + + N   G T +P + +   GG+SG     L   SS+IGI +D+ G IR+P  F G++G KP+   ++          Q +     GP+ R   DLI +   +             P A   +LF+      + ++    +  S     VE  +L A+K +      ++G K+ +  +P ++  F ++  T+MAS
Sbjct:   31 QQRHGVSRLPPITNPLLL--LSAMQLARKIRRKEVTSVEVVQAYIDRIQEVNPLINAMVKDR---FSAALQEAAQVDKLIEEETGGEDVLEDRLPLLGVPITVKEAFALQGMPNSTGLLTRRDLVSGADAPSVALLKRAGAIPLGVTNCSELCMWLESHNHLYGITNNPYDFERIVGGSSGGEGSILGAGSSVIGIGSDIGGSIRIPCFFNGIFGHKPSVGIVNNEGQYPPASGQQMGFLCTGPMCRYAEDLIPMLSIMGG-----------PNAEKLSLFTEVDLKKLRFFSVPHNGGSHLVSPVEPQLLHAQKMVVKRLEADLGVKVQELLIPQLKYSF-QIWGTMMAS 364          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Zebrafish
Match: faah2a (fatty acid amide hydrolase 2a [Source:NCBI gene;Acc:436973])

HSP 1 Score: 71.2478 bits (173), Expect = 1.965e-12
Identity = 82/351 (23.36%), Postives = 156/351 (44.44%), Query Frame = 3
Query:  231 QKFQGMKR--PFENIKVICELTGSEIQSKIRSHDILAVDVLEAF---------QANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVM-------ALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKAL-----ENVGHKLVKYQLPNVEKVFNKVHSTIMAS 1214
            Q+  G+ R  P  N  ++  L+  ++  KIR  ++ +V+V++A+           N+++K+    F A +   A V  L+ +      V+        +P++V +   ++   ++ GLL      +  D   V +L+  GAIP  +T   +  + + + N   G T +P + +   GG+SG     L   SS+IGI +D+ G IR+P  F G++G KP+   ++          Q +     GP+ R   DLI +   +             P A   +LF+      + ++    +  S     VE  +L A+K +      ++G K+ +  +P ++  F ++  T+MAS
Sbjct:   31 QQRHGVSRLPPITNPLLL--LSAMQLARKIRRKEVTSVEVVQAYIDRIQEVNPLINAMVKDR---FSAALQEAAQVDKLIEEETGGEDVLEDRLPLLGVPITVKEAFALQGMPNSTGLLTRRDLVSGADAPSVALLKRAGAIPLGVTNCSELCMWLESHNHLYGITNNPYDFERIVGGSSGGEGSILGAGSSVIGIGSDIGGSIRIPCFFNGIFGHKPSVGIVNNEGQYPPASGQQMGFLCTGPMCRYAEDLIPMLSIMGG-----------PNAEKLSLFTEVDLKKLRFFSVPHNGGSHLVSPVEPQLLHAQKMVVKRLEADLGVKVQELLIPQLKYSF-QIWGTMMAS 364          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Zebrafish
Match: faah2b (fatty acid amide hydrolase 2b [Source:NCBI gene;Acc:768298])

HSP 1 Score: 68.5514 bits (166), Expect = 1.526e-11
Identity = 78/314 (24.84%), Postives = 142/314 (45.22%), Query Frame = 3
Query:  243 GMKRPFENIKV---ICELTGSEIQSKIRSHDILAVDVLEAF---------QANSLMKNNDLNFLADVIYEADVSSLMVDP-------KNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRIS--KRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKK 1121
            G KRP     +   +  L+  ++  KIR  ++ +V+V++A+           N+L+K+    F A ++  A    L+ +        +N   ++ +P+SV +   ++   ++ GL          D   V +L+  GAIP  +T T +  + M + N   G T +P N +  CGG+SG     +   +S+ GI +D+ G IR+P  F G++G KP+   +S   +F +  G  QN    S GP+ R   DL+ L + ++            P A    L  +     + ++  +    S  T  V+R ++E +K
Sbjct:   31 GTKRPKHLPPITNPLLTLSAVQLAEKIRRREVSSVEVVQAYIDRIQEVNPLLNALIKDR---FSAALLEAARADKLIKEENGGEEVLRNQFPLLGVPMSVKESFGLQGMPNSGGLKSRGKVLASVDAPPVALLKRAGAIPLGVTNTSELCMWMESNNHLYGITSNPYNLERICGGSSGGEGSIIGGGASVFGIGSDIGGSIRMPCFFNGIFGHKPSRGVVSNDNQFPRCSG-LQNEYTGS-GPMCRYAEDLLPLLKIMAG-----------PTADKLTLSKAVDLKKLRFFTIVDDGGSPLTSPVDRQLVEVQK 328          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Zebrafish
Match: faah2b (fatty acid amide hydrolase 2b [Source:NCBI gene;Acc:768298])

HSP 1 Score: 68.5514 bits (166), Expect = 1.526e-11
Identity = 78/314 (24.84%), Postives = 142/314 (45.22%), Query Frame = 3
Query:  243 GMKRPFENIKV---ICELTGSEIQSKIRSHDILAVDVLEAF---------QANSLMKNNDLNFLADVIYEADVSSLMVDP-------KNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRIS--KRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKK 1121
            G KRP     +   +  L+  ++  KIR  ++ +V+V++A+           N+L+K+    F A ++  A    L+ +        +N   ++ +P+SV +   ++   ++ GL          D   V +L+  GAIP  +T T +  + M + N   G T +P N +  CGG+SG     +   +S+ GI +D+ G IR+P  F G++G KP+   +S   +F +  G  QN    S GP+ R   DL+ L + ++            P A    L  +     + ++  +    S  T  V+R ++E +K
Sbjct:   31 GTKRPKHLPPITNPLLTLSAVQLAEKIRRREVSSVEVVQAYIDRIQEVNPLLNALIKDR---FSAALLEAARADKLIKEENGGEEVLRNQFPLLGVPMSVKESFGLQGMPNSGGLKSRGKVLASVDAPPVALLKRAGAIPLGVTNTSELCMWMESNNHLYGITSNPYNLERICGGSSGGEGSIIGGGASVFGIGSDIGGSIRMPCFFNGIFGHKPSRGVVSNDNQFPRCSG-LQNEYTGS-GPMCRYAEDLLPLLKIMAG-----------PTADKLTLSKAVDLKKLRFFTIVDDGGSPLTSPVDRQLVEVQK 328          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Xenopus
Match: faah.2 (fatty acid amide hydrolase, gene 2 [Source:NCBI gene;Acc:496823])

HSP 1 Score: 252.292 bits (643), Expect = 1.958e-74
Identity = 171/512 (33.40%), Postives = 281/512 (54.88%), Query Frame = 3
Query:  249 KRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVM-ALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPV-APTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEA--KSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            + P  + + I  L+  E+ SK++   +    VL ++   +L   ++LN + D + E +   + +  +   G++  +P+S+ D      +DST GLL +   P  +D V+ KVL+  GA+P + T   Q  +     N   G+T++P N K + GG+SG     +A   SI+GI +D+ G IR P++FCG+ G KPT+ R+SK   K+    Q  +   IGPLAR+V  L+   R++  E MF+LDP  PP+ FNE ++SS +PL IGYY     + +  TP+++RAV E K+ LE  GHK+V +  P+VEK   ++    + +D G + +++  KG+ +D +L            +   L  F+S   KP       +   SV ++WK+   +++Y++E ++ W+   +DAV+CP+ +P   +   G   +     Y+I+YN++DFP G +PVT V + D + L   +  K     K   EA   S+GLPV VQCV LPW+EE  LR+M+ +
Sbjct:   63 EHPVADPEGILSLSLPELASKLKDGSLSPEMVLHSYMRKALDVTSELNCVTDYLPECETQLVHLRGQKTKGLLYGVPISLKDNFNYTGHDSTLGLLNQLNRPACEDSVIAKVLKVQGALPFMKTNIPQSMLNYDCSNPIYGRTLNPLNHKKTPGGSSGGEGSLIAAGGSILGIGSDIGGSIRFPSAFCGICGFKPTANRLSKLGVKTSSAGQKSVAAMIGPLARDVDSLVLCMRALLCEEMFQLDPTIPPLPFNEEIYSSTRPLRIGYYET--DDATMATPSMKRAVHETKELLERAGHKMVPFTPPSVEKSMFELIVKGLLADGGSTFLDN-FKGDQVDPNLK----TQVSTYGLPYWLKIFISFIVKP-------VVSISVKDLWKHHLEVEAYRQEFISQWKKLEIDAVLCPILSPALTIGYPGK--LSTAVSYTILYNLVDFPVGVVPVTTVTKDDEEGLKAYKGHKKDYWDKLLKEALTDSIGLPVSVQCVALPWQEEQCLRLMKEV 558          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Xenopus
Match: faah.2 (fatty acid amide hydrolase, gene 2 [Source:NCBI gene;Acc:496823])

HSP 1 Score: 250.366 bits (638), Expect = 1.243e-73
Identity = 172/517 (33.27%), Postives = 285/517 (55.13%), Query Frame = 3
Query:  249 KRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVM-ALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPG----GDWIKSLAG-ASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPV-APTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEA--KSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            + P  + + I  L+  E+ SK++   +    VL ++   +L   ++LN + D + E +   + +  +   G++  +P+S+ D      +DST GLL +   P  +D V+ KVL+  GA+P + T   Q  +     N   G+T++P N K + GG+SG     +A   SI+GI +D+ G IR P++FCG+ G KPT+ R+SK   K+    Q  +   IGPLAR+V  L+   R++  E MF+LDP  PP+ FNE ++SS +PL IGYY     + +  TP+++RAV E K+ LE  GHK+V +  P+VEK   ++    + +D G + +++  KG+ +D +L            +   L  F+S   KP        ++++ G  SV ++WK+   +++Y++E ++ W+   +DAV+CP+ +P   +   G   +     Y+I+YN++DFP G +PVT V + D + L   +  K     K   EA   S+GLPV VQCV LPW+EE  LR+M+ +
Sbjct:   63 EHPVADPEGILSLSLPELASKLKDGSLSPEMVLHSYMRKALDVTSELNCVTDYLPECETQLVHLRGQKTKGLLYGVPISLKDNFNYTGHDSTLGLLNQLNRPACEDSVIAKVLKVQGALPFMKTNIPQSMLNYDCSNPIYGRTLNPLNHKKTPGGSSGGEGSLIAAGGSILGIGSDIGGSIRFPSAFCGICGFKPTANRLSKLGVKTSSAGQKSVAAMIGPLARDVDSLVLCMRALLCEEMFQLDPTIPPLPFNEEIYSSTRPLRIGYYET--DDATMATPSMKRAVHETKELLERAGHKMVPFTPPSVEKSMFELIVKGLLADGGSTFLDN-FKGDQVDPNLK----TQVSTYGLPYWLKIFISFIVKPVFPRLSKLLQNIKGIRSVKDLWKHHLEVEAYRQEFISQWKKLEIDAVLCPILSPALTIGYPGK--LSTAVSYTILYNLVDFPVGVVPVTTVTKDDEEGLKAYKGHKKDYWDKLLKEALTDSIGLPVSVQCVALPWQEEQCLRLMKEV 570          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Xenopus
Match: wdr78 (WD repeat domain 78 [Source:Xenbase;Acc:XB-GENE-5890871])

HSP 1 Score: 239.965 bits (611), Expect = 1.133e-69
Identity = 173/558 (31.00%), Postives = 290/558 (51.97%), Query Frame = 3
Query:  144 AKKLLQWRRIKKKIAKKCNDTDSRKIGLFQKFQGMKRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVM-ALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKR-FTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGA-----SVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICP-VAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEA-----KSVGLPVGVQCVTLPWREEIVLRIMQNISD 1778
             ++ L+ RR+++  A    D   + I  F+K    + P  +   I  LT S++  +++   + A   L A+   +L  N +LN L D + E +     V  +   G++  +P+++ D +  + +DS  GL++     +++D V+V+VL++ GA+P + T   Q  I     N   G+T++P N K +CGG+SG  A  +A   +++G+ TD+ G IR+P SFCG+ GLKP+  R+S   F+  +   ++ +    GP+AR+V  L    +++  + MF+LDP  PPV F + +++S KPLTIG+Y   G      TP ++RA+ E K  LE  GHKLV +  P +E   N++      +D G +++      + +D +L        L   V  L+   +S F +P    I +   A     SV  +WK+   I  Y+ E +  W+  NLDA++CP + P   +   G   +     +++++NIL+FPAG LPVT V   D ++L   +  K       D E         GLP+ VQCV LPW+EE  LR+M+ + +
Sbjct:   41 VRQKLRCRRLQRLHAL---DLMQKTISQFKK----QHPDVDTGHIVSLTLSQLVDQLKKGSLTAESALIAYTEKALEVNKELNCLTDFLSECEAQLQEVKKQKEKGLLYGVPITLKDNVGYKGHDSHCGLVQFLGIVDQEDSVIVQVLKKQGAVPFVKTNIPQSMINFDCSNSIFGQTLNPHNHKKTCGGSSGGEAALIAGGGAVLGVGTDVLGSIRMPCSFCGICGLKPSGNRLSSLGFSTPVSGMKSAVMMP-GPMARDVDSLALFMKAVLCDDMFQLDPTVPPVPFRDEIYNSSKPLTIGFYDTDGYFLP--TPGMKRAIQETKALLEEAGHKLVPFSPPRIEYALNELCIRGFFADGGSTLVEK-FNADIVDPNLK----QQMLLYKVPTLVKKIISFFMRPIFPRIANHVDAHCGVGSVKQLWKHNTAIKEYRCEYINEWKKLNLDALLCPMLGPAFNIGCPGK--LFAGFCFTMLFNILNFPAGVLPVTTVTPEDEEEL---KHYKGYYNDLWDKEVIMGMQDGAGLPLAVQCVALPWQEEQCLRLMKEVEN 578          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Xenopus
Match: faah.2 (fatty acid amide hydrolase, gene 2 [Source:NCBI gene;Acc:496823])

HSP 1 Score: 173.326 bits (438), Expect = 8.453e-47
Identity = 100/274 (36.50%), Postives = 155/274 (56.57%), Query Frame = 3
Query:  342 VLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVM-ALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQ 1160
            +L      +L   ++LN + D + E +   + +  +   G++  +P+S+ D      +DST GLL +   P  +D V+ KVL+  GA+P + T   Q  +     N   G+T++P N K + GG+SG     +A   SI+GI +D+ G IR P++FCG+ G KPT+ R+SK   K+    Q  +   IGPLAR+V  L+   R++  E MF+LDP  PP+ FNE ++SS +PL IGYY     + +  TP+++RAV E K+ LE  GHK+   Q
Sbjct:   21 LLPPILPQALDVTSELNCVTDYLPECETQLVHLRGQKTKGLLYGVPISLKDNFNYTGHDSTLGLLNQLNRPACEDSVIAKVLKVQGALPFMKTNIPQSMLNYDCSNPIYGRTLNPLNHKKTPGGSSGGEGSLIAAGGSILGIGSDIGGSIRFPSAFCGICGFKPTANRLSKLGVKTSSAGQKSVAAMIGPLARDVDSLVLCMRALLCEEMFQLDPTIPPLPFNEEIYSSTRPLRIGYYET--DDATMATPSMKRAVHETKELLERAGHKVCWMQ 292          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Xenopus
Match: ENSXETT00000052483.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:80974999:80987053:1 gene:ENSXETG00000020082.1 transcript:ENSXETT00000052483.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.895 bits (359), Expect = 1.792e-36
Identity = 103/336 (30.65%), Postives = 165/336 (49.11%), Query Frame = 3
Query:  156 LQWRRIKKKIAKKCNDTDSRKIGLFQKFQGMKRPFE------NIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVM-ALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGH 1142
            L+W R K++I K+ N    R+    Q  + +   F+      + + I  ++  E+  K+R   +    VL  +   +L    D N +   + + +     V  +   G++  +P+S+ + +  + + ST GL++      ++D V+VKVL++ GAI    T   Q  I   T N   G T +P N      G+SG     +    SI+G  TD+ G IR+P+SFCG+ GLKPT  R+              +   IGP+AR+V  L+   +++  + MF+LDP  PP+ FNE ++S+ +PL IGYY   G       PA+ R  LE KK LE  GH
Sbjct:   34 LKWIR-KRRILKRINQEKKRRDMSLQLMEKLAEKFKKQNPGVDSRRILSMSLQELTEKLRDGSLSPESVLYPYVKKALEVTRDTNCITVFMNDCETQLQEVKKQKQKGLLYGVPVSIKEHVGYQGHPSTCGLVQYLDELEEEDSVIVKVLKKQGAIIFAKTNVPQTLICYETSNPIYGLTTNPHNHTKGAAGSSGGEGALIGGGGSILGFGTDIGGSIRLPSSFCGIAGLKPTPNRL------------RYLLLCIGPMARDVDSLVLCMKALLCDEMFKLDPRVPPLPFNEEVYSTSQPLRIGYYETDGYTLP--NPAMRRVFLETKKLLEEAGH 354          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Mouse
Match: Faah (fatty acid amide hydrolase [Source:MGI Symbol;Acc:MGI:109609])

HSP 1 Score: 214.157 bits (544), Expect = 2.369e-60
Identity = 168/567 (29.63%), Postives = 273/567 (48.15%), Query Frame = 3
Query:  144 AKKLLQWRRIKKKIAKKCNDTDSRKIGL------FQKFQGMKRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKP----GGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLD--------------LDKLVKCQSKKTCCQRKCDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            A  +L+W R +            ++ GL       Q+F+ ++ P  + + +  L   ++  K++S ++    VL  +   +   N   N +    Y  D  + +        +  +P+S+ +    + + ST GL       ++ DCVVV+VL+  GA+P + T   Q  +     N   G+T++P     S GG+SG     + +  S +G+ TD+ G IR P++FCG+ GLKPT  R+SK   KS  + Q  +  S+GP+AR+V  L    +++  E +F LD   PP+ F E ++ S +PL +GYY     N +  TPA+ RAV+E K++LE  GH LV +   N+      + +  + SD G S + +  KG+ +D  L      L L   + R     +S   KP       ++ S+   S   +W+ +  I+ Y++ V+A W+  NLD V+ P+    A+DL           Y+++YN LDFPAG +PVT V   D               D ++K   K            K +GLPV VQCV LPW+EE+ LR M+ +
Sbjct:   25 AAVVLRWTRSQTARGAVTRARQKQRAGLETMDKAVQRFR-LQNPDLDSEALLALPLLQLVQKLQSGELSPEAVLFTYLGKAWEVNKGTNCVTS--YLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHASTLGLSLNEGVTSESDCVVVQVLKLQGAVPFVHTNVPQSMLSYDCSNPLFGQTMNPWKPSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKSCVYGQTAVQLSVGPMARDVDSLALCMKALLCEDLFRLDSTIPPLPFREEIYRSSRPLRVGYYET--DNYTMPTPAMRRAVMETKQSLEAAGHTLVPFLPNNIPYALEVLSAGGLFSDGGCSFLQN-FKGDFVDPCLG----DLVLVLKLPRWFKKLLSFLLKPLFPRLAAFLNSMCPRSAEKLWELQHEIEMYRQSVIAQWKAMNLDVVLTPML-GPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMEHYKGYFGDMWDNILKKGMK------------KGIGLPVAVQCVALPWQEELCLRFMREV 568          
BLAST of Fatty-acid amide hydrolase 1-like vs. UniProt/SwissProt
Match: sp|Q9TUI8|FAAH1_PIG (Fatty-acid amide hydrolase 1 OS=Sus scrofa OX=9823 GN=FAAH PE=1 SV=1)

HSP 1 Score: 242.662 bits (618), Expect = 5.367e-70
Identity = 169/516 (32.75%), Postives = 274/516 (53.10%), Query Frame = 3
Query:  231 QKFQGMKRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEA--KSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            Q+F+ ++ P  + +++  L   ++  K+RS ++    VL ++   +   N   N +    Y AD  + +        +  +P+S+ +    + +DST GL +    P + DCVVV+VL+  GA+P + T   Q        N   G+T +P  S  S GG+SG     +A   S +G+ TD+ G IR P++FCG+ G+KPT  RISK   K   + Q  +  S+GP+AR+V  L    R++  E MF LDP  PP+ FNE +++S +PL +GYY     N +  TPA+ RA+LE K++LE  GH L+ +   N+      + +  + SD G+ ++ +  +G+ +DS L   + +L+LP  +K LL   +         ++ SL   S   +W+ +  I+ Y+  V+A W   +LD V+ P+  + A+DL           Y+++YN LDFPAG +PVT V   D  ++   +        K   +A  +SVGLPV VQCV LPW+EE+ LR M+ +
Sbjct:   60 QRFR-LQNPDLDSEMLLALPLPQLVQKVRSGELSPEAVLFSYLQKAWEVNRGTNCV--TTYLADCEAQLCQAPGQGLLYGVPVSLKECFSCKGHDSTLGLSRNQGTPAECDCVVVQVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTTNPWMSSKSPGGSSGGEGALIAAGGSPLGLGTDIGGSIRFPSAFCGICGIKPTGNRISKSGLKGSVYGQVAVQLSVGPMARDVESLALCLRALLCEDMFRLDPTVPPLPFNEEVYASSRPLRVGYYET--DNYTMPTPAMRRALLETKRSLEAAGHTLIPFLPANIPHALEALSTGGLFSDGGKRLLQN-FEGDYVDSCLGDLISILRLPKWLKGLLAFMLRPLLPRLAGFLSSLRPRSAGKLWELQHEIEMYRHSVIAQWRALDLDVVLTPML-SPALDLNAPGKATGAVSYTLLYNCLDFPAGVVPVTTVTAEDEAQMEHYKGYFGDIWDKVVQKAMKRSVGLPVAVQCVALPWQEELCLRFMREV 568          
BLAST of Fatty-acid amide hydrolase 1-like vs. UniProt/SwissProt
Match: sp|Q17449|FAAH1_CAEEL (Fatty acid amide hydrolase 1 OS=Caenorhabditis elegans OX=6239 GN=faah-1 PE=1 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 6.320e-64
Identity = 151/508 (29.72%), Postives = 274/508 (53.94%), Query Frame = 3
Query:  276 ICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNN------SGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFE--LDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLV-KCQSKKTCCQRKCDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            I  L   +++ +++   +  V+ + A+   +++ +   N +   I +A+  +  +D +          +  +PLS+ + L ++ YD+T G +++++HP  +D + V+  ++ G IP   T   Q  +     N   G T +P +S  +CGG+SG     +    S+IGI TD+ G +R+P  F G  G+KP+  R + R   +    + +ID + GP+A++V   +   R++  +  F+   DP+CPPV +NE+++SSEK L +GYY++ G      TPA++RAVLE+KK LE  GH ++ +  P +  V  +++   +  D GQ ++N ++K + I+ ++ + V L  +P  ++R+L   VSL     G  ++SL     + + +    I++Y+EE +     +NLD ++CP +   A        V++   Y+ +YN+LDF AG +PVT V++ D +KL+ +        Q        +VG+P+GVQ    P+REE VLR M+ I
Sbjct:   63 IGSLDFEQLRDELQRGHVTCVEAIRAYFHKAILAHEKTNAVTCFILDAERQAEELDEQAKLPYYVKPPLFGVPLSLKECLKVKGYDTTRGFVQDAYHPATEDSIQVEHYKKLGLIPFCQTNVPQSLLSYNCSNPLFGTTTNPYDSTRTCGGSSGGEGALIGAGGSLIGIGTDVGGSVRIPCHFTGTAGIKPSKMRFAHRGGGASVPGKPLIDANDGPMAKDVKTNVEFLRNVWGDIDFQSDRDPYCPPVHWNESVYSSEKKLRVGYYIDDGWFTP--TPALQRAVLESKKHLEAAGHTVIPFYPPRLPSVM-QLYFRAVCLDGGQYVLNKLLK-DIIEPTIRFQVTLWMVPVWIQRILSYPVSLVFPRMGMLMQSLT-RDTFELREAYADIEAYREEFVGLMMKDNLDVILCPASIMPAPQHDIPSKVVSGVSYTCLYNLLDFGAGVVPVTAVSKSDEEKLINEYPETDKWYQITKKATLGAVGMPIGVQVAAPPYREEAVLRTMREI 565          
BLAST of Fatty-acid amide hydrolase 1-like vs. UniProt/SwissProt
Match: sp|O00519|FAAH1_HUMAN (Fatty-acid amide hydrolase 1 OS=Homo sapiens OX=9606 GN=FAAH PE=1 SV=2)

HSP 1 Score: 219.55 bits (558), Expect = 1.766e-61
Identity = 166/491 (33.81%), Postives = 253/491 (51.53%), Query Frame = 3
Query:  309 KIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICP-VAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEA--KSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            K+ S ++    VL  +   +   N   N +    Y AD  + +        +  +P+S+ +    +  DST GL      P + D VVV VL+  GA+P + T   Q        N   G+T++P  S  S GG+SG     + +  S +G+ TD+ G IR P+SFCG+ GLKPT  R+SK   K   + Q  +  S+GP+AR+V  L    R++  E MF LDP  PP+ F E +++S +PL +GYY     N +  +PA+ RAVLE K++LE  GH LV +   N+      + +  + SD G + + +  KG+ +D  L   V +LKLP  +K LL   V         ++ ++   S   +W+ +  I+ Y++ V+A W   +LD V+ P +AP  A+DL           Y+++YN LDFPAG +PVT V   D  ++   +        K   +   KSVGLPV VQCV LPW+EE+ LR M+ +
Sbjct:   85 KLHSRELAPEAVLFTYVGKAWEVNKGTNCVTS--YLADCETQLSQAPRQGLLYGVPVSLKECFTYKGQDSTLGLSLNEGVPAECDSVVVHVLKLQGAVPFVHTNVPQSMFSYDCSNPLFGQTVNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSSFCGICGLKPTGNRLSKSGLKGCVYGQEAVRLSVGPMARDVESLALCLRALLCEDMFRLDPTVPPLPFREEVYTSSQPLRVGYYET--DNYTMPSPAMRRAVLETKQSLEAAGHTLVPFLPSNIPHALETLSTGGLFSDGGHTFLQN-FKGDFVDPCLGDLVSILKLPQWLKGLLAFLVKPLLPRLSAFLSNMKSRSAGKLWELQHEIEVYRKTVIAQWRALDLDVVLTPMLAP--ALDLNAPGRATGAVSYTMLYNCLDFPAGVVPVTTVTAEDEAQMEHYRGYFGDIWDKMLQKGMKKSVGLPVAVQCVALPWQEELCLRFMREV 568          
BLAST of Fatty-acid amide hydrolase 1-like vs. UniProt/SwissProt
Match: sp|P97612|FAAH1_RAT (Fatty-acid amide hydrolase 1 OS=Rattus norvegicus OX=10116 GN=Faah PE=1 SV=1)

HSP 1 Score: 215.698 bits (548), Expect = 4.549e-60
Identity = 153/459 (33.33%), Postives = 244/459 (53.16%), Query Frame = 3
Query:  411 YEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVN-----QLDLDKLVKCQSKKTCCQRKCDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            Y  D  + +        +  +P+S+ +    + +DST GL      P++ DCVVV+VL+  GA+P + T   Q  +     N   G+T++P  S  S GG+SG     + +  S +G+ TD+ G IR P++FCG+ GLKPT  R+SK   K   + Q  +  S+GP+AR+V  L    +++  E +F LDP  PP+ F E ++ S +PL +GYY     N +  +PA+ RA++E K+ LE  GH L+ +   N+      + +  + SD G+S + +  KG+ +D  L   + +L+LP+  KRLL   +         ++ S+   S   +WK +  I+ Y++ V+A W+  NLD ++ P+    A+DL           Y+++YN LDFPAG +PVT V      Q++L K           ++       SVGLPV VQCV LPW+EE+ LR M+ +
Sbjct:  117 YLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHDSTLGLSLNEGMPSESDCVVVQVLKLQGAVPFVHTNVPQSMLSFDCSNPLFGQTMNPWKSSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSLGPMARDVESLALCLKALLCEHLFTLDPTVPPLPFREEVYRSSRPLRVGYYET--DNYTMPSPAMRRALIETKQRLEAAGHTLIPFLPNNIPYALEVLSAGGLFSDGGRSFLQN-FKGDFVDPCLGDLILILRLPSWFKRLLSLLLKPLFPRLAAFLNSMRPRSAEKLWKLQHEIEMYRQSVIAQWKAMNLDVLLTPML-GPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMELYKGYFGDIWDIILKKAMK---NSVGLPVAVQCVALPWQEELCLRFMREV 568          
BLAST of Fatty-acid amide hydrolase 1-like vs. UniProt/SwissProt
Match: sp|O08914|FAAH1_MOUSE (Fatty-acid amide hydrolase 1 OS=Mus musculus OX=10090 GN=Faah PE=1 SV=1)

HSP 1 Score: 214.157 bits (544), Expect = 1.657e-59
Identity = 168/567 (29.63%), Postives = 273/567 (48.15%), Query Frame = 3
Query:  144 AKKLLQWRRIKKKIAKKCNDTDSRKIGL------FQKFQGMKRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKP----GGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLD--------------LDKLVKCQSKKTCCQRKCDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            A  +L+W R +            ++ GL       Q+F+ ++ P  + + +  L   ++  K++S ++    VL  +   +   N   N +    Y  D  + +        +  +P+S+ +    + + ST GL       ++ DCVVV+VL+  GA+P + T   Q  +     N   G+T++P     S GG+SG     + +  S +G+ TD+ G IR P++FCG+ GLKPT  R+SK   KS  + Q  +  S+GP+AR+V  L    +++  E +F LD   PP+ F E ++ S +PL +GYY     N +  TPA+ RAV+E K++LE  GH LV +   N+      + +  + SD G S + +  KG+ +D  L      L L   + R     +S   KP       ++ S+   S   +W+ +  I+ Y++ V+A W+  NLD V+ P+    A+DL           Y+++YN LDFPAG +PVT V   D               D ++K   K            K +GLPV VQCV LPW+EE+ LR M+ +
Sbjct:   25 AAVVLRWTRSQTARGAVTRARQKQRAGLETMDKAVQRFR-LQNPDLDSEALLALPLLQLVQKLQSGELSPEAVLFTYLGKAWEVNKGTNCVTS--YLTDCETQLSQAPRQGLLYGVPVSLKECFSYKGHASTLGLSLNEGVTSESDCVVVQVLKLQGAVPFVHTNVPQSMLSYDCSNPLFGQTMNPWKPSKSPGGSSGGEGALIGSGGSPLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKSCVYGQTAVQLSVGPMARDVDSLALCMKALLCEDLFRLDSTIPPLPFREEIYRSSRPLRVGYYET--DNYTMPTPAMRRAVMETKQSLEAAGHTLVPFLPNNIPYALEVLSAGGLFSDGGCSFLQN-FKGDFVDPCLG----DLVLVLKLPRWFKKLLSFLLKPLFPRLAAFLNSMCPRSAEKLWELQHEIEMYRQSVIAQWKAMNLDVVLTPML-GPALDLNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMEHYKGYFGDMWDNILKKGMK------------KGIGLPVAVQCVALPWQEELCLRFMREV 568          
BLAST of Fatty-acid amide hydrolase 1-like vs. TrEMBL
Match: G1KA95 (Fatty acid amide hydrolase OS=Anolis carolinensis OX=28377 GN=FAAH PE=4 SV=2)

HSP 1 Score: 277.715 bits (709), Expect = 9.481e-81
Identity = 185/514 (35.99%), Postives = 285/514 (55.45%), Query Frame = 3
Query:  249 KRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVM-ALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKR-FTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEK-VFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICP-VAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEA--KSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            + P    + I  L+  E+  K+R   +L   VL  +   +L    D+N L D + +++   L V  + N G++  +P+S+ D +  + +DST G +K   HP  +D V+V+VL+  GAIP + T   Q  +     NL  G+T+HP +   + GG+SG  A  + +  SI+GI TD+ G IR+P+ FCG+ GLK T  RISKR   +SLG +++++   +GP+AR+V  L    RS+  E MF LDP  PP+ FNE ++SS  PL IGYYV    +    TP+++RA+LE K+ LE  GH LV ++L N++  V+N       A   G +   +  KGE +D S+   + L K+PN ++RLL   V          +K++   SV  +W+    I+ Y  + +A W+   LD ++CP ++P   +   G   +    IY+++YN LDFPAG +PVT V + D ++L   +        K   +A    VGLPV VQCV LPW+EE+ LR M+ I
Sbjct:   56 QNPSHRPESILSLSLPELCRKLRDGLLLPESVLYTYMDKALKVTKDVNCLTDYLEDSESQLLQVKSQGNKGLLYGVPVSIKDSIDCKGFDSTLGFVKRLNHPAAEDAVLVQVLKHQGAIPFVKTNVPQSLMNFDCSNLIFGQTVHPLDHTKTPGGSSGGEASLIKSGGSILGIGTDIGGSIRIPSGFCGICGLKTTGDRISKRGVIRSLGGQKSVVA-GVGPMARDVESLAICLRSLLCEEMFRLDPKVPPLPFNEQVYSSSHPLRIGYYVT--DSFLMPTPSMKRAILETKELLEKAGHVLVPFKLINMDYFVYNLCIGGTFAD--GSATYLEHFKGELVDPSIKDLLLLAKVPNWMRRLLSWIVRPISPRASKLVKNMTERSVKELWELHFEIEEYCYKFIAEWKKLQLDVMLCPALSPAYKIGYPGK--ISMGAIYTMLYNYLDFPAGVVPVTTVTKEDEEELKNFRGYYNDIWDKIFAKAVEGGVGLPVTVQCVALPWQEELCLRFMKEI 562          
BLAST of Fatty-acid amide hydrolase 1-like vs. TrEMBL
Match: A0A1S3KC66 (fatty-acid amide hydrolase 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106180697 PE=4 SV=1)

HSP 1 Score: 264.233 bits (674), Expect = 1.322e-75
Identity = 180/555 (32.43%), Postives = 300/555 (54.05%), Query Frame = 3
Query:  141 FAKKLLQWRRIKK---KIAKKCNDTDSRKIGLFQKFQGMKRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVM--ALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAG-ASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKG--SHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDME-AKSVGLPVGVQCVTLPWREEIVLRIMQNISD 1778
            F K   + +R++    K+AK+C         + ++    K   E +  I EL+ SE+ + +++  + AVDVL A+Q+ ++ +N   NF+   + EA+ ++L +D  +    M   +P+S+ D   ++ YD+T G+ +    P  +DCVVVKVL+  GAIP + T   Q ++     N   G+T++P + + + GG+SG  A A+A  SSI+G+ +D+ G IR+PA FCG+ G+KPT  RISK+    +   +N++  S+GP+ R+V  + ++ +++    MFELDP  PP+ FN   + S +PL IG+Y+    + S   PA  RAV  A   L++ GH++V Y     ++++   +     +D GQ ++  +      D ++   V +LKLP +++  L   +          I  L G  S+ +M + K  I  ++ ++L  WE   LDAV+CPVAP  AV L G  + C+   +  +      DFPAG +PVT V   D   L    +      +   M    ++GLPVGVQCVT PW EE+ LR+M+++ +
Sbjct:   32 FIKSNARRKRVRSNRCKVAKQCVKYKKTISTVAERITEKKFSPEQVDSITELSLSELVASLKNGRLKAVDVLNAYQSKAIEQNEQYNFITTFLEEAEDAALALDESDKPKGMLHGVPVSLKDFFTVKGYDTTLGMARYVDSPWAEDCVVVKVLKYQGAIPFMKTNIPQTNLHFDCSNPIFGRTLNPWSKQRTPGGSSGGEAAAIAAGSSIVGMGSDIGGSIRIPAHFCGICGIKPTVGRISKK-GLHMFKGENLLAASMGPMGRDVDSVATMMKALLVPYMFELDPMTPPLTFNTEEYESNRPLKIGFYLE--DDWSVPIPACNRAVELAVATLKSQGHEVVPYSPTRAQEMYLDYYMRFCMADGGQELLKSLEDEPVFDPTIKGQVSVLKLPKILRTTLAILLKPMMPLLSRMILCLNGFRSIKDMNEKKCDIQEWQLKILQDWERLGLDAVVCPVAPCVAV-LNGYPAKCLGALSYTAYYNLA-DFPAGVVPVTTVTAEDDQNLKSYYNYDVLWMKNMKMGCVDAIGLPVGVQCVTKPWHEELCLRVMRDVEN 581          
BLAST of Fatty-acid amide hydrolase 1-like vs. TrEMBL
Match: A0A401S9L7 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0005519 PE=4 SV=1)

HSP 1 Score: 263.077 bits (671), Expect = 1.899e-74
Identity = 168/486 (34.57%), Postives = 267/486 (54.94%), Query Frame = 3
Query:  342 VLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTP--AVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGA-SVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICP-VAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEAK-----SVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            VL A+   +L     LN + + + E       +  K    +  +P+S+ D +  + +DST GL K    P  KD V+V+VL++ GAIP + T   Q  +     N   G+T++P + K + GG+SG     +A   SI+GI +D+ G IRVPA+FCG+ G KPT  R+S +  ++    Q  +D ++GP+ARNV  L    R++  E MF LDP  PP+ FN+ +FSS KPL IGYY     +     P  +++RAV+E K+ LE  GH LV ++    +  FN++    MA+D G +++ + +KG+ IDS+L     +  +P ++K++L  F+  F     + +K L G  S+Y +W+      +Y +E + +W+   LD ++CP + P       G   V     Y II+N+L+FPAG +PV+ V + D + L   +S    C    D   K     +VGLP+ VQCV LPW++E+ LR+M+ +
Sbjct:  166 VLFAYMEKALEVTKLLNCITEFLPECQTQLKNLSGKKKGLLYGIPVSIKDNVNYKGHDSTCGLRKFFHQPATKDSVLVQVLKKQGAIPFVKTNVPQSLLSYECSNPIFGQTLNPHDHKRTPGGSSGGEGALIAAGGSILGIGSDIGGSIRVPAAFCGICGFKPTGNRLSSQGIRASLPGQKTVDAAVGPMARNVDSLALCMRALLCEDMFLLDPTVPPIPFNDEVFSSSKPLRIGYY----ESDEFWIPNASMKRAVMETKQLLEEAGHTLVPFKPLRTQSAFNELVINGMAADGGSTLL-ERLKGDIIDSTLKDLFFVNTVPKVLKKILCMFLKPFSPRISEALKYLGGVRSIYELWEQHIARQAYCDEYIDAWKSAELDVLLCPALGPALTAGYAGK--VTATASYKIIFNLLNFPAGVVPVSTVTEQDEEDL---KSYVGYCNDLWDRTFKKGVSGAVGLPLAVQCVALPWQDELCLRLMREV 641          
BLAST of Fatty-acid amide hydrolase 1-like vs. TrEMBL
Match: A0A2D0QJ73 (fatty-acid amide hydrolase 1-like OS=Ictalurus punctatus OX=7998 GN=LOC108261604 PE=4 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 1.248e-73
Identity = 180/557 (32.32%), Postives = 283/557 (50.81%), Query Frame = 3
Query:  153 LLQWRR---IKKKIAKKCNDTDSRKIGLFQKFQGM---KRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIM---ASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKP----GGDWIKSLAG-ASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICP-VAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEA--KSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            LL+WR    +K+K+ ++  +   +++G  +K  G    +    ++  I  L  +E+  +IR   +    VL A+   +L  N  LN    V+ E+      ++   +  +  +P+S+ D L  E YDST G+L +   P  KD V+V VL++ GAIP I T   QG +     N   G+T++P N + +CGG+SG     +A   SI+G+ +D+ G +R+PA+FCG+  LKPT+ RIS     S          ++GP+AR+V  L    R++    MF LDP  PP+ FN+ ++ S +PL IGYY N G  Q   +P++ RA+LE K+ LE  GH L+ +   N  + F   H  ++    +D G +++    KG  +D SL        L           VSL  +P        I ++ G   V  +WK  + +  Y  E +A W    LD ++CP + P    +  G     +   Y+ +YN+L+FPAG +PVT V   D D+L   +        K  +EA    VGLP+ VQCV LPW+EE+ LR+M+ +
Sbjct:   22 LLKWREHQTVKRKL-QRAREKREKELGQAEKAVGYFKTRNAGVDLSSIVTLPLAELSKRIRDGSLQPDAVLHAYMEKALEANRKLNCSTAVLMESLEQLEDIESHKDGLLYGIPISIKDNLDYEGYDSTCGVLTKLDDPAVKDSVLVSVLKKQGAIPFIKTNIPQGLLNYECSNPIYGRTVNPCNVEKTCGGSSGGEGALIAGGGSILGLGSDIGGSVRIPAAFCGICALKPTNNRISVHGLNSCAKGGKTALTAVGPMARDVESLALCMRALLCPDMFTLDPTVPPIPFNQQVYESSEPLRIGYYENDGYFQP--SPSMSRALLETKELLEKAGHTLIPF---NPLRTFTAFHEFVLRGNVADGGATLLQHFKKG-PVDPSLK----HQVLYCAFPLFGKRLVSLLLRPISPRMAASIHAICGVGGVEELWKQHNEVQVYIHETIAEWRKLELDVLLCPMLGPAYNFNYTGKQ--SSALSYTALYNVLNFPAGVVPVTEVTAEDEDQLKHYRGYFGDGWDKTFVEAVRGGVGLPIAVQCVALPWQEEMCLRLMREV 565          
BLAST of Fatty-acid amide hydrolase 1-like vs. TrEMBL
Match: A0A5N5PW95 (Uncharacterized protein OS=Pangasianodon hypophthalmus OX=310915 GN=PHYPO_G00100070 PE=4 SV=1)

HSP 1 Score: 256.144 bits (653), Expect = 1.396e-72
Identity = 176/553 (31.83%), Postives = 284/553 (51.36%), Query Frame = 3
Query:  153 LLQW---RRIKKKIAKKCNDTDSRKIGLFQK----FQGMKRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGA-SVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICP-VAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEA--KSVGLPVGVQCVTLPWREEIVLRIMQNISD 1778
            LL+W   +++K+K+ ++  +   +++G  +K    F+  +    ++  I  L  +E+  +IR   +    VL A+   +L  N  LN    V+ E+      ++   +  +  +P S+ D +  E YDS+ G+L +   P  KD VVV VL++ GAIP I T   QG +     N   G+T++P N + +CGG+SG     +A   SI+G+ TDL G IR+PA+FCG+ GLKPT+KRIS     S          SIGP+AR+V  L    R++    MF LDP  PP+ FN+ ++ S +PL IGYY N G  Q   +P++ RA+ E K+ LE  GH L+ +  P+V   F++       +D   + +    +G  +D  +        LP  +K+++   +         +I +  G  S  ++W        Y  E+LA W    LD ++CP + P  + +  G   + +   Y+ +YN+L+FP G +PVT V   D D+L            K  ++A    VGLP+ VQCV LPW+EE+ LR+M+ + +
Sbjct:   22 LLKWTEQQKVKRKL-QRAREKREKELGQAEKAVSCFK-TQNAGVDLSSIVTLPLAELSKRIRGGSLQPDAVLHAYMEKALEVNKKLNCATAVLTESLKQLENIESHKDGLLYGIPFSIKDNVDYEGYDSSCGVLTKLDDPAVKDSVVVSVLKKQGAIPFIKTNIPQGLLNYECSNPIYGRTVNPCNLEKTCGGSSGGEGALIAGGGSILGLGTDLGGSIRIPAAFCGICGLKPTNKRISMLGLSSCVKGVKTALSSIGPMARDVESLALCMRALLCTDMFTLDPTVPPIPFNQEVYESSEPLRIGYYENDGYLQP--SPSMSRALRETKELLEKAGHTLIPFNPPHVFTAFHEFVVRGNIADGAGTFLKHFKEG-PVDPCMQHQASSWALPKFMKKMISVLLRPIYPRMAAFIHATCGVDSPADLWNQHKEAGDYVHEMLAEWSKLELDVLLCPMLGPAYSFNYSGK--LFSALSYAALYNVLNFPVGVVPVTEVTAEDEDQLKHYTGVFGDVWDKLFVKAIRGGVGLPIAVQCVALPWQEEMCLRLMREVEE 567          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Cavefish
Match: faah (fatty acid amide hydrolase [Source:NCBI gene;Acc:103026083])

HSP 1 Score: 236.113 bits (601), Expect = 1.377e-68
Identity = 180/554 (32.49%), Postives = 282/554 (50.90%), Query Frame = 3
Query:  153 LLQWRRIKKKIAKKCNDTDSRKIGLF-------QKFQGMKRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGA-----SVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEA--KSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            L++W R   ++ KK     SR+   F       Q F+  K P  ++  I  L+  ++  +I++  +    VL A+   +L     LN    V+ E+      ++   +  +  +P+S+ + +  + +DST GLL +   P   D VVV VL++ GAIP I T   QG +     N   G  ++P N K +CGG+SG     +    SI+G+ TD+ G IR+PASFCG+ GLKPTS RIS R   S       +  SIGP+ R+V  L    +++  + MF LDP  PP+ FN+ ++ S  PL IGYY N G  Q   +P++ RA+ E KK LE  GH LV ++ P +    N   +    +D G +++  ++KG  +D  L        LP  +   +  F+S+  +P    I     A     S+  +WK+   I++Y  EV+  W    LDA++CP A   A +      + +   Y+ +YN+L+FPAG +PV+ V   D  +L   +        K  ++A     GLPV VQCV+LPW+EE+ LR+M+ +
Sbjct:   22 LVKWVR-HHQVQKKIQRARSRRDAGFSQARRAVQDFKE-KNPGLDLNPIMGLSLDQLTKEIKAGSLKPAAVLHAYMDKALELGKTLNCNTGVLMESLTQLSEIESHKDGLLYGIPISIKENIGYKGHDSTCGLLCKLDDPELLDSVVVTVLKKQGAIPFIKTNVPQGLLNYECSNPIYGMAVNPRNLKKTCGGSSGGEGSLIGGGGSILGLGTDIGGSIRIPASFCGICGLKPTSNRISMRGVSSSVKGIKSVHSSIGPMGRDVESLALCMKALLCKDMFSLDPTVPPIPFNQQVYESSDPLRIGYYENDGFMQP--SPSMARALRETKKLLEQAGHTLVPFKPPEIYNAMNDYITKGALADGGGTLLK-MLKGGPVDPCLQ----PQILPYSLPNFVKKFLSIVLRPIYPRIAKAMDATRGFKSIEELWKHHFDIENYVHEVMTQWNALELDALLCP-ALGPAYNFYFCGKLNSALSYTAMYNLLNFPAGVVPVSTVTAADEAQLNDYKGNFGDIWDKLFVKAVRGGEGLPVAVQCVSLPWQEEMCLRLMREV 565          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Cavefish
Match: faah2b (fatty-acid amide hydrolase 2-B-like [Source:NCBI gene;Acc:103041685])

HSP 1 Score: 72.4034 bits (176), Expect = 7.026e-13
Identity = 72/316 (22.78%), Postives = 145/316 (45.89%), Query Frame = 3
Query:  297 EIQSKIRSHDILAVDVLEAF-----QANSLMKNNDLNFLADVIYEADVSSLMVDPK--------NNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPL-TIGYYVNIGSNQSECTPAVERAVLEAKKAL-----ENVGHKLVKYQLPNVEKVFN 1187
             +  KIR  ++ +VDV++AF     + N L+     +  +  + EA     +++ +        +   ++ +P+SV +   ++    + GL+  +      D   + +L+  GAIP  +T T +  + M + N   G T +P + +  CGG+SG     L +  ++IGI +D+ G IR+P+ F GV+G K T+  +S          ++    S GP+ R   DL+ + R ++     + D  C          S+E  L  + ++  +  + S  T  V++ ++EA++ +      + G K+ +   P ++  F 
Sbjct:   53 RLAEKIRRREVTSVDVVQAFIDRIQEVNPLLNAMVKDRFSAALSEAAHVDRLIEEEGRCEEALADRLPLLGVPMSVKESFFLQGMPCSTGLISRARFLASGDAPSLALLKRAGAIPLGVTNTPELCMWMESSNNVYGITNNPYDLQRMCGGSSGGEGSILGSGGAVIGIGSDIGGSIRMPSFFNGVFGHKGTTGIVSNHGQHPAISGRHDEYVSTGPMCRYAEDLLPMLRIMAGA---DADKLC---------LSTEVDLKKLRFFTVVDDSGSPLTSPVDKQLVEAQRKVAQQLEADFGVKVKEISFPQLKYAFQ 356          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Cavefish
Match: faah2a (fatty-acid amide hydrolase 2-A-like [Source:NCBI gene;Acc:103040673])

HSP 1 Score: 66.2402 bits (160), Expect = 6.314e-11
Identity = 62/244 (25.41%), Postives = 114/244 (46.72%), Query Frame = 3
Query:  285 LTGSEIQ--SKIRSHDILAVDVLEAF---------QANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVM-------ALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISK--RFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSIS 956
            LT   IQ    IR  ++ +V+V++A+           N+L+K+    F A +   A V  L+ +      V+        +P +V +   ++   ++ GLL      +  D   V +L+  GAIP  +T   +  + + + N   G T +P N     GG+SG     +A+ +S+IG+ +D+ G IR+P  F G++G KPT   +S   ++    G +   +    GP+ R   DL+ + + ++
Sbjct:   48 LTAPAIQLARLIRRKEVTSVEVVQAYIDRIQEVNPLINALVKDR---FAAALQEAAQVDKLIEEETGGEDVLEDRLPLLGVPFTVKEAFALQGMPNSTGLLSRRAVVSGVDAPSVALLKRAGAIPLGVTNCSELCMWLESHNHLYGITRNPYNLSRIVGGSSGGEGSIIASGASVIGVGSDIGGSIRMPCFFNGIFGHKPTVGIVSNAGQYPPPSGQQPGFL--CTGPMCRYAGDLVPMLKIMA 286          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Sea Lamprey
Match: faah (fatty acid amide hydrolase [Source:ZFIN;Acc:ZDB-GENE-070619-3])

HSP 1 Score: 204.527 bits (519), Expect = 3.791e-58
Identity = 151/506 (29.84%), Postives = 263/506 (51.98%), Query Frame = 3
Query:  276 ICELTGSEIQSKIRSHDILAVDVLEAFQANSL----MKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICP-VAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKC--DMEAKSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            I  L+  E+  +++ + +L  DVL+ +   +L      N+ + FL + + +A      V+  N   +  +P+S+ +   I+   ST GL+    +   +DCV+ KVLR  GA+    T   Q  +     N   G+T HP ++  S GG+SG     +    SI+GI +D+ G IR+PASFCG+ GLKPT  R+S +  +S    Q  +  S GP+AR+V  L     ++   ++F LDP  PP+ F+  ++ ++ P+ +GYY   G  Q    P++ R+V EA+  LEN GHKLV ++ P +E    ++    + +D  ++++     G+ +D +L++ + + ++P L+  LL      F       ++   G +V  +WK    I++Y+ E +++W    ++ ++CP + P   +   G   +    ++ I+YN+L+FPAG +P+  V   D  +L   +        K      A  VGLP+ VQCV LPW+EE  LR+M+ +
Sbjct:   22 ILGLSLQELTQRLQDNQLLPSDVLQTYLLKALEVDEKTNSVVQFLPESLTQAQALE-KVNASNRGLLHGVPVSIKENFDIQGCYSTCGLICGVENLAAEDCVIAKVLRHQGAVIFAKTNVPQSLLSFECSNPIFGQTSHPMDATRSPGGSSGGEGALIGGGGSILGIGSDIGGSIRIPASFCGICGLKPTGGRLSNKGGQSSISGQKGVIPSAGPIARDVDGLALCMEALLCPKLFALDPTVPPLPFDRKIYENKSPMVVGYYEGDGFIQP--NPSMRRSVREARALLENNGHKLVPFEPPRLEYCLTELVMKALFADGAETLLGK-FAGDVVDPNLHYQISMYRIPKLLSWLLSVLTKPFTPRQSKALRMQGGRNVAALWKLHAAIEAYRTEFISAWRVAGIEVLLCPALGPALKIGHGGK--LSALTVFHILYNLLNFPAGVVPMGTVTVQDEQELSDYRGHYGDIWEKAFPKAVAGGVGLPLSVQCVALPWQEEQCLRLMREV 521          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Sea Lamprey
Match: faah2b (fatty acid amide hydrolase 2b [Source:NCBI gene;Acc:768298])

HSP 1 Score: 75.0998 bits (183), Expect = 1.961e-14
Identity = 64/239 (26.78%), Postives = 113/239 (47.28%), Query Frame = 3
Query:  285 LTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLN-FLADVIYEADVSSLMVDPK------------NNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISK--RFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSIS 956
            L  +E+  +IR  ++ +V VL A        N  +N  +AD   EA   +  VD +              + ++ +P +  +   I+   ++ GLL  +   +++D   V  LR  GAIP  +T   +  +   + NL  G T +P +++   GG+SG     LA     IGI +D+ G IR+PA F G++G KPT+  +    +F  + G +  ++    GP+ R   DL+ + R ++
Sbjct:   53 LPATELAGRIRRREVRSVAVLNACIDRIRAINPVVNAVVADRFVEALAEAARVDERLASTTGDEKKLEEETPLLGVPFTAKEAFAIQGLPNSSGLLSRNGVRSQQDAAAVAALRRAGAIPLGVTNCSELCMWYESSNLVYGLTRNPYDTRRIVGGSSGGEGAVLAAAGCAIGIGSDIGGSIRMPAFFNGIFGHKPTAGVVPNGGQFPNASGAQGELL--VTGPMCRYAQDLLPVLRIMA 289          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Yeast
Match: AMD2 (Putative amidase [Source:SGD;Acc:S000002650])

HSP 1 Score: 80.1073 bits (196), Expect = 3.620e-16
Identity = 94/339 (27.73%), Postives = 163/339 (48.08%), Query Frame = 3
Query:  300 IQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVM----ALPLSVSDGLCIEKYDSTFGLLKESFHPNKK--DCVVVKVLRENGAIPSIITCTGQGDIMMGT---GNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRS--ISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNI--GSNQSECTPAVERAVLEAKKALENV-GHKLVKYQLPNVE---KVFNKVHSTIMASDAGQSIINDI-IKGESI 1262
            ++  + + ++   ++  AF   + + +  +N L+++++   +        N   ++     +P+S+ D   +E  D++ G L  +F P  K  + ++V  LR+ GAI  I   T     MM T    N F G T +  N   S GG+SG     +  + S++G+ TD+ G IR+P+S+ G++GLKPT  R+      +    +  I   IGPLAR++SDL   F S  I+  + +  D  C P  F+    SS   L   Y V I  G    +  P+  RA+   +  +    G K VK++ P+ E   ++F+  +   +A D+G  I N+  I GE +
Sbjct:   66 LRQALEAKELSCHEITAAFCHRAALIHQVVNCLSEIMFSEALRLADYYDSNRPAILPPLYGIPISLKDQCNVEGVDTSLGYLCRTFKPKTKNEESLIVSFLRDLGAI--IFVKTTVPSSMMATDTQSNTF-GYTYNSINLSFSSGGSSGGEGSLIGAHGSLLGLGTDIGGSIRIPSSYQGLFGLKPTFGRVPYLRVDNSFEGRETIPSVIGPLARDLSDL-RYFMSCVINICQPWVQDVKCIPYHFD----SSTSKLHDNYVVGIWYGDGVIDPPPSDIRALKTCEDLVNKTKGMKAVKWE-PSSELSRELFDLANEADVA-DSGNEIKNEFEISGEPL 394          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Yeast
Match: HER2 (Subunit of the trimeric GatFAB AmidoTransferase(AdT) complex; involved in the formation of Q-tRNAQ; required for remodeling of ER caused by Hmg2p overexpression; similar to bacterial GatA glutamyl-tRNA amidotransferase [Source:SGD;Acc:S000004907])

HSP 1 Score: 46.9802 bits (110), Expect = 7.146e-6
Identity = 59/233 (25.32%), Postives = 111/233 (47.64%), Query Frame = 3
Query:  561 DCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGK-----TIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEK---PLTIGYYVNIGSNQSECTP-AVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSI 1232
            D  VVK+L++ G    I+  T   +  MG+G + S +      ++P   K   GG+S  AA ++A +     + TD  G +R+PA +  V G KP+  R+S RF   + + Q++   ++G L++ ++ L  +F ++    M   DP    V   E +  ++K   PL +G    +     E  P    R  L   + L N+G ++    +P+V+     ++ T+  ++A  ++
Sbjct:   77 DATVVKLLKQAGV--HILGKTNLDEFGMGSGGVHSIRGPVINPLYPHEDKKIMGGSSSGAAASVACDLVDFALGTDTGGSVRLPACYGSVLGFKPSYGRLS-RFG-VIAYSQSLD--TVGILSKKINVLRKVFHTLDKYDM--KDPTSLSVELRELIEGNKKVRRPLKVGI---VKEFSHESMPIGFHRLYLSLLEKLINLGLEIYPVSIPSVKNCL-PIYYTLSPAEAASNL 297          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Nematostella
Match: EDO36046 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJR6])

HSP 1 Score: 73.559 bits (179), Expect = 1.129e-13
Identity = 51/173 (29.48%), Postives = 90/173 (52.02%), Query Frame = 3
Query:  462 VMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDY-SIGPLARNVSDLISLFRSISTERMFEL 977
            ++ +P++V + +       + GL++     ++ D  VV+ LR+NGAIP  +T   +  +   T N   G+T +P ++    GG+SG     +A   S+ G+ +D+ G IR+PA F G+ G KP+   +        G  +   +Y SIGPL R  SDL ++ +++S    + L
Sbjct:   83 LLGVPITVKESISCRGMPHSSGLVERKNVISEHDSEVVENLRQNGAIPMAVTNCSELCMWWETVNNVYGRTRNPYDTSRVAGGSSGGEGAIIAAAGSLCGVGSDVGGSIRMPAFFNGISGHKPSPGIVPNHGHYPYGTSEAFHEYLSIGPLCRYASDLSTMLKAMSGPNAYRL 255          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Nematostella
Match: EDO26044 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TD12])

HSP 1 Score: 65.0846 bits (157), Expect = 3.311e-12
Identity = 55/160 (34.38%), Postives = 88/160 (55.00%), Query Frame = 3
Query:  471 LPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNL--FSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDL-ISL 941
            +P+++ D + I   ++T G          KD  +VK L+E  AI  II  T   ++ MG      F+G+  +P ++  + GG+S  AA +++ N ++I I TD  G IR+PA+F G+YG++PT   IS      +G+    ID + G + R V+DL ISL
Sbjct:   24 IPITIKDNIDIIGMETTSGSYALKGTLPIKDAKLVKKLKEENAI--IIAKTTMDELAMGMNGFSSFNGRAGNPYDTTKNPGGSSAGAAASISANFAVIAIGTDNSGSIRIPAAFNGIYGIRPTQNSISSDGIFPMGN----IDGTAGVMTRTVTDLAISL 177          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Nematostella
Match: EDO30796 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZS0])

HSP 1 Score: 65.4698 bits (158), Expect = 3.523e-11
Identity = 62/245 (25.31%), Postives = 114/245 (46.53%), Query Frame = 3
Query:  276 ICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLAD-----VIYEA-DVSSLMV----DPKNNSG----VMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRI--SKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTE 962
            +  L+ +++  KIR  ++ + +V+E +       N  +N + D      I EA DV  L+     D +   G    ++ +P +  +    +   +  GL+        +D  VV+ LR  GAI   +T   +  +   + N   G+T +P ++    GG+SG     L    S+IGI  D+ G IR+P+ F GV+G KP+   +  + +F  + G + + +    GP+ R   DL+ L + ++ E
Sbjct:    4 LLHLSATKLAKKIRELEVSSEEVIEIYIKRIREINTKINAVVDDCFREAIDEARDVDELLKNMGKDEREKMGKRKPLLGVPFTAKESFSAKGMPNCSGLMARKDFRAAEDAPVVERLRLAGAILIAVTNCSELCMWWESANRVYGRTCNPFDTARIAGGSSGGEGAVLGGAGSVIGIGADIGGSIRMPSFFNGVFGHKPSPDVVPNAGQFPNAEGQEVHFL--CTGPMCRYAEDLLPLLQIMAGE 246          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Nematostella
Match: EDO38240 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDJ7])

HSP 1 Score: 59.3066 bits (142), Expect = 2.907e-9
Identity = 48/168 (28.57%), Postives = 77/168 (45.83%), Query Frame = 3
Query:  537 ESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFS---GKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCP-----PVAFNEAL 1016
            E + P+    VV +VL   G I     C    +    +G  +S   G  ++P ++  S GG+S   A  +A+ +  + +  D  G IR+PA+ CG+ GLKPT   +      S+   +  +D+  GP+A+ V D   L  +I+      LDP  P     P  + E L
Sbjct:  137 EGYIPDVDATVVARVLDAGGRILGKSVC----EDFCCSGESYSNATGPVLNPLDTTRSAGGSSSGNAALIASGAVDMALGGDQGGSIRIPAAACGIVGLKPTYGLVPYTAISSM---ETSLDH-CGPMAKTVRDAALLLEAIAGLDEEGLDPRQPREMPVPPVYTEKL 296          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Nematostella
Match: EDO43781 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXI7])

HSP 1 Score: 50.0618 bits (118), Expect = 2.232e-6
Identity = 41/159 (25.79%), Postives = 75/159 (47.17%), Query Frame = 3
Query:  483 VSDGLCIEKYDSTFGLLK-ESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSIS 956
            + D +C+     + G      + P++   VV +VL   G I     C  +  I   +    +G  ++P +++   GG+       LA+    + I  D  G +R P+S CG+ GLKPT   +   +T +   + + +D+ +GP+AR+V D+  L   I+
Sbjct:  101 IKDNICVAGIPMSMGSHSLPGYVPDEDATVVTRVLDAGGTIVGKAVCE-ELSISGSSFTAATGPVMNPLDNRRETGGSFSGCGALLASGEVDMAIGGDQGGSVRHPSSRCGLVGLKPTYGLVP--YTGACPCEVS-LDH-LGPMARSVKDVSLLLEVIA 254          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Medaka
Match: faah (fatty acid amide hydrolase [Source:NCBI gene;Acc:101174015])

HSP 1 Score: 226.483 bits (576), Expect = 6.089e-65
Identity = 155/482 (32.16%), Postives = 261/482 (54.15%), Query Frame = 3
Query:  339 DVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVM-ALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGAS-VYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLD--KLVKCQSKKTCCQRKCDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            +V   +   +L  +  LN  ++++ E+    L     N  G++  +P+S+ + L  + +D++ G++     P K+  V+V+VL+  GA+P + T   Q  +     N   G+T++P N + + GG+SG     +    S++GI +D+ G IR+PASFCG+ G KPTS R+S +    +   Q  +  S GP+AR+V  L+   R++  + MF LDP  PP+ FN+ ++ S +PLTIG+  N G   +E +PA+ R+V E K  LE  GH LV +  P + +V  ++    + +D   S++   ++G  ID  L   +RL  LP  +K+ L   +  F       +++L+G S V ++W++   ++ Y  E +A+W  +NLD ++CPV    A +            Y++IYN+L+FPAG +PV+ V   D +  KL K   +    +          GLPVGVQCV LPW++E+ LR M+ +
Sbjct:  100 EVFYFYMEKTLAAHKKLNCCSEILPES-FDQLKTLASNKDGLLYGVPVSIKENLEYKDHDTSCGVVVNLDRPAKRHSVIVEVLKRQGAVPFVKTNLPQALLSYDCSNPIYGQTLNPHNLQKTSGGSSGGEGALIGAGGSLLGIGSDIGGSIRIPASFCGICGFKPTSGRLSLQGLVPIYRGQKSVPSSPGPMARDVDSLVLCMRALLCDHMFALDPTVPPLPFNDQIYQSSRPLTIGFLENDG--YTEGSPAMVRSVREVKALLEQAGHTLVPFCPPRISQVLPELLLKGVFADGATSMLRK-LEGGPIDPCLAPQIRLYSLPLWLKKTLSFLLKPFTPRLPAVLRALSGISCVSDLWEHHAAVEDYISETIAAWRRSNLDVLLCPVL-GPAFNFLYCGRFSGGISYTMIYNLLNFPAGVVPVSRVTAADEENLKLYKGNFQDYMDKLLPQAARGGQGLPVGVQCVALPWQDELCLRFMKEV 576          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Medaka
Match: faah (fatty acid amide hydrolase [Source:NCBI gene;Acc:101174015])

HSP 1 Score: 226.483 bits (576), Expect = 6.089e-65
Identity = 155/482 (32.16%), Postives = 261/482 (54.15%), Query Frame = 3
Query:  339 DVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVM-ALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGAS-VYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLD--KLVKCQSKKTCCQRKCDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            +V   +   +L  +  LN  ++++ E+    L     N  G++  +P+S+ + L  + +D++ G++     P K+  V+V+VL+  GA+P + T   Q  +     N   G+T++P N + + GG+SG     +    S++GI +D+ G IR+PASFCG+ G KPTS R+S +    +   Q  +  S GP+AR+V  L+   R++  + MF LDP  PP+ FN+ ++ S +PLTIG+  N G   +E +PA+ R+V E K  LE  GH LV +  P + +V  ++    + +D   S++   ++G  ID  L   +RL  LP  +K+ L   +  F       +++L+G S V ++W++   ++ Y  E +A+W  +NLD ++CPV    A +            Y++IYN+L+FPAG +PV+ V   D +  KL K   +    +          GLPVGVQCV LPW++E+ LR M+ +
Sbjct:  100 EVFYFYMEKTLAAHKKLNCCSEILPES-FDQLKTLASNKDGLLYGVPVSIKENLEYKDHDTSCGVVVNLDRPAKRHSVIVEVLKRQGAVPFVKTNLPQALLSYDCSNPIYGQTLNPHNLQKTSGGSSGGEGALIGAGGSLLGIGSDIGGSIRIPASFCGICGFKPTSGRLSLQGLVPIYRGQKSVPSSPGPMARDVDSLVLCMRALLCDHMFALDPTVPPLPFNDQIYQSSRPLTIGFLENDG--YTEGSPAMVRSVREVKALLEQAGHTLVPFCPPRISQVLPELLLKGVFADGATSMLRK-LEGGPIDPCLAPQIRLYSLPLWLKKTLSFLLKPFTPRLPAVLRALSGISCVSDLWEHHAAVEDYISETIAAWRRSNLDVLLCPVL-GPAFNFLYCGRFSGGISYTMIYNLLNFPAGVVPVSRVTAADEENLKLYKGNFQDYMDKLLPQAARGGQGLPVGVQCVALPWQDELCLRFMKEV 576          
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Medaka
Match: faah2b (fatty acid amide hydrolase 2 [Source:NCBI gene;Acc:101174537])

HSP 1 Score: 62.003 bits (149), Expect = 1.254e-9
Identity = 61/239 (25.52%), Postives = 109/239 (45.61%), Query Frame = 3
Query:  285 LTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLN------FLADVIYEADVSSLMVDPKNNSGVM-------ALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRIS--KRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSIS 956
            L  +++  KIR  ++ +V+V++ F       N  LN      F A +   A V  L+ +      V+        +PLSV +   ++    T GL+         D   V +L+  GAIP  +T   +  +   + N   G T +P + +   GG+SG     LA   ++IG+ +D+ G IR+P+ F G++G K T   +S   ++  + G     +  S GP+ R   DL+ + + ++
Sbjct:   49 LPATQLARKIRRKEVTSVEVVQTFIDRIQEVNPFLNAVVKDRFAAALQEAAQVDKLIEEETGGEEVLEDRLPFLGVPLSVKESYSLQGMPFTTGLVSRRGIVATVDAPPVALLKRAGAIPLGVTNISELCMWSESHNHLYGITSNPYDLERIPGGSSGGEGSILAAAGAVIGVGSDIGGSIRMPSFFNGIFGHKTTPGVVSCENQYPPTSGRWSEYL--SSGPMCRYAEDLLPMLKIMA 285          
BLAST of Fatty-acid amide hydrolase 1-like vs. Planmine SMEST
Match: SMESG000034791.1 (SMESG000034791.1)

HSP 1 Score: 1077.39 bits (2785), Expect = 0.000e+0
Identity = 578/583 (99.14%), Postives = 581/583 (99.66%), Query Frame = 3
Query:   33 MNILNELDFWKNYLITSYLNDCXXXXXXXXXXXXXYFAKKLLQWRRIKKKIAKKCNDTDSRKIGLFQKFQGMKRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNISDK 1781
            MNILNELDFWKNYLITSYLNDCSSILIVIAIISSVYFAKKLLQWRRIKKKIAKKCNDTDSRKIGLFQKFQGMK+PFENIKVICELTGSEIQSKIRSHD LAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIIND+IKGESIDSSLNWYVRLLKLPNLVKRLLGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTA+VDLKGSHCVINENIYSIIYNILDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDME KSVGLPVGVQCVTLPWREEIVLRIMQNISDK
Sbjct:    1 MNILNELDFWKNYLITSYLNDCSSILIVIAIISSVYFAKKLLQWRRIKKKIAKKCNDTDSRKIGLFQKFQGMKKPFENIKVICELTGSEIQSKIRSHDFLAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDVIKGESIDSSLNWYVRLLKLPNLVKRLLGSFVSLFCKPGGDWIKSLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTASVDLKGSHCVINENIYSIIYNILDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMENKSVGLPVGVQCVTLPWREEIVLRIMQNISDK 583          
BLAST of Fatty-acid amide hydrolase 1-like vs. Planmine SMEST
Match: SMESG000034806.1 (SMESG000034806.1)

HSP 1 Score: 369.392 bits (947), Expect = 3.491e-119
Identity = 201/542 (37.08%), Postives = 326/542 (60.15%), Query Frame = 3
Query:  162 WRRIKKK--IAKKCNDTDSRKIGLFQKFQGMKRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIKSLAGA-SVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRK-CDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNIS 1775
            +R+IK    I KK  + + +K  L  K + +  PF N+  I  L+ +++   I +  +  VD+L+++QA +L+ + + NF+ D+   ADV  L  +      +  +P+S+ +   ++  DST G+    F P++KD ++V+ L   G IP + T   Q    + + N   G T++P N   +CGG+SG     L   +S++G+ +D+ G IRVPA +CGVYGLKPT+ R S+R  K     QNII+ S+GP+AR + DL+++F++++   ++ LDP+CPP+ FN+ ++  ++PL IGYYV++G NQ    PAV RAV  AK ALE+ GH LV++ +P+++    +++   + +D G   +   I    +DSS+++   +LK+PN +KR +   +  F K     + ++AG  SVY +W+  + I  Y+E+VL  W+   LD +ICPV P  A  L  S  +++   Y+ IYN+LD+PAGS PVT VNQ D+D L+K   + T   RK  + +  S+G+PVGVQ V++ WREE  LRIM++IS
Sbjct:   36 FRKIKTANLIQKKRKELEQKKNDLITKLEDIGSPFINMDKITNLSLNDLLKAIENGTLTPVDILQSYQAKALVLDKEYNFITDLNPNADVDVLGGETSKRGILKGIPVSIKESFMVKGCDSTMGMPDRMFQPSEKDDMMVRTLHLQGMIPFVTTNVCQTGYSLESSNPIYGVTLNPFNKSRTCGGSSGGEGAILGCGASLVGLGSDIGGSIRVPAYYCGVYGLKPTAMRFSRRHGKLRYPTQNIINVSVGPMARRIDDLVTVFKAMACGDLYHLDPYCPPLCFNDKIYEKKRPLRIGYYVHLGGNQITPVPAVARAVEMAKNALESAGHTLVEFDIPDIDYAIFELYFRCLFTDGGVGFVEKYIADNPVDSSISFTTNVLKVPNFLKRFVSYIIYPFDKNQSHALYAIAGVPSVYGIWELNEKIKDYREKVLTKWQEEKLDGLICPVLPICAPPLNTSGYIMDIISYTAIYNLLDYPAGSSPVTTVNQNDIDLLLKSYPRNTRTHRKIIEYQKDSIGMPVGVQSVSMLWREETCLRIMRDIS 577          
BLAST of Fatty-acid amide hydrolase 1-like vs. Planmine SMEST
Match: SMESG000052378.1 (SMESG000052378.1)

HSP 1 Score: 337.421 bits (864), Expect = 8.335e-107
Identity = 199/543 (36.65%), Postives = 329/543 (60.59%), Query Frame = 3
Query:  168 RIKKKIAKKCNDTDSRKIGLFQKFQGMKRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVI--YEADVS--SLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIK-SLAGASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVK--CQSKKTCCQRKCDMEAKSVGLPVGVQCVTLPWREEIVLRIMQNIS 1775
            RIK+K  + C+    +K  L +K Q +  P  N+  I  L  S++   +   +  ++D+L+A+QA +L+ + + NF+ D+    E D+S  S++    NN     +P+SV +   ++  D T G+L +  +P K+D +V+++L+ NG IP + T   QG + + + N   G+T++P N   + GG+SG     L   +S+IG+ +D+ G IR+P+ +CG+YG KP+S RISKR +K +    NI+  S GP+AR++ DL+++++ ++    F+LDP+CPP+ F+  +F  ++PL IGYY+++G +Q    PAVERAVL AK ALE  GHKLV++QLP ++   + +    + +D  +    + +K   +D  +   V L K+PNL+K+ LG  +  F K     +  ++A  SVY +W+  + + SY+E+VLA W+   LD +ICPV P  A  +  S  +     Y+ IYN+LD+PAGS PVT VNQ D+D+L+    ++ K  C +  D +  S G+P+GVQ V++ WREE+ LRIM++I+
Sbjct:   51 RIKEKQKELCH----KKSELLKKLQALGTPINNMDKITNLKLSDLLEALEKGEFTSLDILQAYQAKALIMDKEYNFITDLNPNAELDISCESIVKKTMNN-----IPISVKECFMLKHCDCTNGMLDQISNPAKEDEIVIQILKLNGFIPFVTTNLSQGCLAIESSNPIYGETLNPFNKGRTSGGSSGGEGAILGCGASLIGLGSDIGGSIRIPSHYCGIYGFKPSSPRISKRISKCMFPYPNIVCESFGPMARHIDDLVAVYKMMTNRDSFQLDPYCPPLCFDTNVFEDKRPLKIGYYIHLGGSQVTPVPAVERAVLMAKTALETAGHKLVEFQLPEIDFAVSDLFFRSLLNDGAEGFKKECLKNNPVDPCIRNIVMLFKMPNLIKKCLGFLLYPFDKSSSLLLNVTMAIPSVYKLWQFNEKVISYREKVLAHWQKEQLDGIICPVLPICAPPIHKSQELDGIIAYTSIYNLLDYPAGSTPVTTVNQGDIDRLLADYPRNNKLHC-KILDYQKDSTGMPIGVQSVSMMWREEVCLRIMKDIA 583          
BLAST of Fatty-acid amide hydrolase 1-like vs. Planmine SMEST
Match: SMESG000052360.1 (SMESG000052360.1)

HSP 1 Score: 319.701 bits (818), Expect = 3.988e-100
Identity = 201/543 (37.02%), Postives = 325/543 (59.85%), Query Frame = 3
Query:  168 RIKKKIAKKCNDTDSRKIGLFQKFQGMKRPFENIKVICELTGSEIQSKIRSHDILAVDVLEAFQANSLMKNNDLNFLADVI--YEADVS--SLMVDPKNNSGVMALPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSLNWYXXXXXXXXXXXXXXGSFVSLFCKPGGDWIK-SLAGASVYNMWK-NKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKC-DMEAKSVGLPVGVQCVTLPWREEIVLRIMQNIS 1775
            RIK+K  + C+    +K  L +K Q +  P  N+  I  L  S++   +   +  ++DVL+A+QA +L+ + + NF+ D+    E D+S  S++    NN     +P+SV +   ++  D T G+L +  +P K+D +V+++L+ NG IP + T   QG + + + N   G+T++P N   + GG+SG     L   +S+IG+ +D+ G IR+P+ +CG+YG KP S RISKR  K +    NI+  S G +AR++ DL+++++ ++    F+LDP+CPP+ F+  +F  ++PL IGYY+++  +Q    PAVERAVL AK ALE  GHKLV++QLP  +    ++    +  D G+  I++ +K   +D  +   V+L K+PNL+K+ L   +  F K     +  ++A  SVY +W+ NK VI SY+E+VLA W+   LD +ICPV P  A  +  S  +     Y+ IYN+LD+PAGS PVT VNQ D+D+L+    +      K  + +  S G+P+GVQ V++ WREE+ LRIM++I+
Sbjct:   51 RIKEKQKELCH----KKSELLKKLQALGTPINNMDKITNLKLSDLLEALEKGEFTSLDVLQAYQAKALIMDKEYNFITDLNPNAELDISCESIVKKTMNN-----IPISVKECFMLKHCDCTNGMLDQISNPAKEDEIVIQILKLNGFIPFVTTNLSQGCLAIESSNPIYGETLNPFNKGRTSGGSSGGEGAILGCGASLIGLGSDIGGSIRIPSHYCGIYGFKPCSPRISKRNYKDMFLYPNIVCDSYGLMARHIDDLVAVYKMMTNRDSFQLDPYCPPLCFDTNVFEDKRPLKIGYYIHLDGSQVTPVPAVERAVLMAKTALEAAGHKLVEFQLPEPDCDITEMFLRSLFFDGGEWFISNWVKNNPVDPCIRNIVKLFKMPNLLKKCLRFLLYPFDKSSSLLLNVTMAIPSVYKLWQFNKKVI-SYREKVLAYWQKEQLDGIICPVLPICAPPIHKSQELDGIIAYTSIYNLLDYPAGSTPVTTVNQGDIDRLLADYPRNNKLHCKIFEHQKDSTGMPIGVQSVSMMWREEVCLRIMKDIA 583          
BLAST of Fatty-acid amide hydrolase 1-like vs. Planmine SMEST
Match: SMESG000049753.1 (SMESG000049753.1)

HSP 1 Score: 197.978 bits (502), Expect = 6.686e-55
Identity = 154/490 (31.43%), Postives = 248/490 (50.61%), Query Frame = 3
Query:  339 DVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMA-LPLSVSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQGDIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQGEIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDLISLFRSISTERMF-ELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSECTPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSIINDIIKGESIDSSL-NWYXXXXXXXXXXXXXXGSFVSLF-CKPGGD-----WIKSLAG-ASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHCVXXXXXXXXXXXXLDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDMEAK--SVGLPVGVQCVTLPWREEIVLRIMQNI 1772
            +VL A+Q  +   N+ LN + D I   D S +     N +G +A LP+SV D   ++ Y S  G       P+  + V+V V+++ G +P + T   Q  +   + N   G T++P ++  S GG+S   A  +  + SI+GI TD+ G IR+PA+FCG+ GLKPT  R+SK+    L  K +II+   G L R+V  +  LF  I+  +   +LDP   P+ FN  +F S   L IGY+  I      C PA+ERAV E  K LE  GH++++++ P   + + ++   +++ D  +  I  I + +  D ++ N Y                 + LF     G+     W+K+  G +S     +    I   +E +L  W+   +D V+CP +   AV LK    +     Y  ++N++DFP+G++PV+ V Q D+  L K   K+          A+  S+ +PV VQCV+ PW EEI LR+M+ +
Sbjct:   97 EVLIAYQKKAFNVNSKLNCVVDFI-NVDKSEI-----NFNGPLAGLPVSVKDNFRVKDYFSCAGCSYFLNKPSSSNSVLVDVIKQLGGVPFVRTTVPQSMMSFLSSNPIDGITLNPIDTSKSPGGSSSGEAALIGGHGSIVGIGTDMGGSIRIPAAFCGIVGLKPTHGRLSKKGLLPLA-KFSIINGVCGILGRDVDAVTCLFEQITNSQFHRDLDPTVVPMDFNRKVFKSTTKLKIGYF--IFDESYRCVPAIERAVSETVKRLEKSGHQIIQWKPPITGERWLELFLRVLSCDRLKE-IRSICQYDKKDFTIRNLYKLFEMNYFQY------LIKLFQATLDGNNESIIWLKATRGISSGAKFMEALSEIKHIREIILEDWQKCGIDMVVCPTSGFTAVPLKPVGSLTGMLSYENLWNLVDFPSGTVPVSKVTQEDVTNLFKKYPKELSTWHFNTFTAQKDSLNMPVSVQCVSKPWHEEICLRVMKEL 570          
The following BLAST results are available for this feature:
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
FAAH3.677e-6233.81fatty acid amide hydrolase [Source:HGNC Symbol;Acc... [more]
FAAH21.922e-1524.51fatty acid amide hydrolase 2 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
faah-14.969e-6529.72Fatty acid amide hydrolase 1 [Source:UniProtKB/Sw... [more]
faah-14.969e-6529.72Fatty acid amide hydrolase 1 [Source:UniProtKB/Sw... [more]
faah-14.969e-6529.72Fatty acid amide hydrolase 1 [Source:UniProtKB/Sw... [more]
faah-14.969e-6529.72Fatty acid amide hydrolase 1 [Source:UniProtKB/Sw... [more]
faah-21.581e-5528.85Fatty Acid Amide Hydrolase homolog [Source:UniPro... [more]
back to top
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG51122.101e-1623.51gene:FBgn0039341 transcript:FBtr0084878[more]
CG79103.307e-1623.91gene:FBgn0037547 transcript:FBtr0081790[more]
CG79103.307e-1623.91gene:FBgn0037547 transcript:FBtr0339720[more]
CG51911.447e-1523.74gene:FBgn0038803 transcript:FBtr0083907[more]
CG51911.447e-1523.74gene:FBgn0038803 transcript:FBtr0345213[more]
back to top
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
faah3.470e-6331.27fatty acid amide hydrolase [Source:ZFIN;Acc:ZDB-GE... [more]
faah2a1.965e-1223.36fatty acid amide hydrolase 2a [Source:NCBI gene;Ac... [more]
faah2a1.965e-1223.36fatty acid amide hydrolase 2a [Source:NCBI gene;Ac... [more]
faah2b1.526e-1124.84fatty acid amide hydrolase 2b [Source:NCBI gene;Ac... [more]
faah2b1.526e-1124.84fatty acid amide hydrolase 2b [Source:NCBI gene;Ac... [more]
back to top
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
faah.21.958e-7433.40fatty acid amide hydrolase, gene 2 [Source:NCBI ge... [more]
faah.21.243e-7333.27fatty acid amide hydrolase, gene 2 [Source:NCBI ge... [more]
wdr781.133e-6931.00WD repeat domain 78 [Source:Xenbase;Acc:XB-GENE-58... [more]
faah.28.453e-4736.50fatty acid amide hydrolase, gene 2 [Source:NCBI ge... [more]
ENSXETT00000052483.11.792e-3630.65pep primary_assembly:Xenopus_tropicalis_v9.1:4:809... [more]
back to top
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Faah2.369e-6029.63fatty acid amide hydrolase [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Fatty-acid amide hydrolase 1-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9TUI8|FAAH1_PIG5.367e-7032.75Fatty-acid amide hydrolase 1 OS=Sus scrofa OX=9823... [more]
sp|Q17449|FAAH1_CAEEL6.320e-6429.72Fatty acid amide hydrolase 1 OS=Caenorhabditis ele... [more]
sp|O00519|FAAH1_HUMAN1.766e-6133.81Fatty-acid amide hydrolase 1 OS=Homo sapiens OX=96... [more]
sp|P97612|FAAH1_RAT4.549e-6033.33Fatty-acid amide hydrolase 1 OS=Rattus norvegicus ... [more]
sp|O08914|FAAH1_MOUSE1.657e-5929.63Fatty-acid amide hydrolase 1 OS=Mus musculus OX=10... [more]
back to top
BLAST of Fatty-acid amide hydrolase 1-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G1KA959.481e-8135.99Fatty acid amide hydrolase OS=Anolis carolinensis ... [more]
A0A1S3KC661.322e-7532.43fatty-acid amide hydrolase 1 isoform X1 OS=Lingula... [more]
A0A401S9L71.899e-7434.57Uncharacterized protein OS=Chiloscyllium punctatum... [more]
A0A2D0QJ731.248e-7332.32fatty-acid amide hydrolase 1-like OS=Ictalurus pun... [more]
A0A5N5PW951.396e-7231.83Uncharacterized protein OS=Pangasianodon hypophtha... [more]
back to top
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
faah1.377e-6832.49fatty acid amide hydrolase [Source:NCBI gene;Acc:1... [more]
faah2b7.026e-1322.78fatty-acid amide hydrolase 2-B-like [Source:NCBI g... [more]
faah2a6.314e-1125.41fatty-acid amide hydrolase 2-A-like [Source:NCBI g... [more]
back to top
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
faah3.791e-5829.84fatty acid amide hydrolase [Source:ZFIN;Acc:ZDB-GE... [more]
faah2b1.961e-1426.78fatty acid amide hydrolase 2b [Source:NCBI gene;Ac... [more]
back to top
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
AMD23.620e-1627.73Putative amidase [Source:SGD;Acc:S000002650][more]
HER27.146e-625.32Subunit of the trimeric GatFAB AmidoTransferase(Ad... [more]
back to top
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO360461.129e-1329.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO260443.311e-1234.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307963.523e-1125.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382402.907e-928.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437812.232e-625.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fatty-acid amide hydrolase 1-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
faah6.089e-6532.16fatty acid amide hydrolase [Source:NCBI gene;Acc:1... [more]
faah6.089e-6532.16fatty acid amide hydrolase [Source:NCBI gene;Acc:1... [more]
faah2b1.254e-925.52fatty acid amide hydrolase 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Fatty-acid amide hydrolase 1-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034791.10.000e+099.14SMESG000034791.1[more]
SMESG000034806.13.491e-11937.08SMESG000034806.1[more]
SMESG000052378.18.335e-10736.65SMESG000052378.1[more]
SMESG000052360.13.988e-10037.02SMESG000052360.1[more]
SMESG000049753.16.686e-5531.43SMESG000049753.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031745 ID=SMED30031745|Name=Fatty-acid amide hydrolase 1-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2118bp
GTTTTTTAACTTTTAGATATTTTTAATAGAAAATGAATATTTTAAATGAA
TTAGATTTTTGGAAAAATTATTTAATTACTTCATATTTAAATGACTGCTC
AAGTATTTTAATTGTCATTGCAATAATCAGTTCAGTATATTTTGCTAAAA
AGCTCTTACAGTGGCGACGAATTAAAAAGAAAATAGCAAAAAAATGTAAC
GACACTGACAGCCGGAAGATCGGACTGTTTCAGAAATTCCAGGGAATGAA
AAGGCCTTTTGAAAACATTAAAGTTATTTGTGAATTAACCGGCAGCGAGA
TTCAGTCGAAAATTAGATCACATGATATTTTGGCTGTCGACGTTTTAGAA
GCTTTCCAAGCTAATTCACTGATGAAAAATAATGATTTAAATTTTCTAGC
TGATGTTATTTATGAAGCTGACGTTTCATCGCTAATGGTTGATCCCAAGA
ATAATAGCGGCGTAATGGCGCTTCCGTTGAGTGTATCTGATGGGTTATGT
ATTGAAAAATATGACAGTACATTTGGGTTATTGAAAGAATCATTTCATCC
TAATAAAAAGGATTGTGTAGTAGTCAAAGTATTGAGAGAAAATGGTGCCA
TTCCATCTATTATTACTTGCACTGGACAGGGGGATATTATGATGGGAACT
GGTAACCTATTCTCCGGGAAAACGATTCACCCCGGTAACAGTAAATTATC
CTGCGGTGGTAATTCCGGATCTGCTGCCGTAGCCCTGGCAACGAATTCGT
CGATTATTGGTATTGCTACCGATTTACAAGGTGAAATTAGAGTGCCGGCG
TCATTTTGTGGAGTTTACGGTTTGAAACCAACTTCAAAACGAATTTCCAA
ACGTTTCACTAAATCTTTGGGTCATAAACAGAATATTATCGATTATTCAA
TTGGACCATTGGCAAGAAACGTCTCCGATTTGATAAGTCTATTTAGATCG
ATCTCAACTGAAAGAATGTTTGAGTTAGACCCTTTTTGTCCGCCTGTCGC
TTTTAATGAAGCGTTATTTTCCTCCGAAAAACCCCTGACAATAGGTTATT
ACGTAAATATAGGATCTAACCAATCAGAGTGTACCCCAGCCGTAGAACGT
GCGGTTTTAGAGGCAAAGAAAGCCTTGGAAAATGTTGGACATAAATTAGT
GAAATATCAATTGCCCAATGTTGAGAAAGTTTTCAATAAAGTTCATTCGA
CGATTATGGCGTCAGATGCGGGACAGTCTATAATTAATGACATTATTAAA
GGAGAATCCATTGATTCATCGCTGAATTGGTACGTGAGATTGTTGAAATT
ACCAAATCTTGTCAAAAGGTTGTTAGGATCATTTGTAAGCCTGTTCTGTA
AGCCAGGAGGCGATTGGATAAAAAGTTTAGCAGGAGCGTCAGTGTATAAT
ATGTGGAAAAATAAGGATGTGATTGATTCATATAAAGAGGAGGTTTTGGC
GAGTTGGGAGCATAATAACCTGGACGCCGTAATCTGTCCTGTAGCACCAA
CTGCTGCAGTGGATTTAAAAGGTTCCCATTGTGTGATCAATGAAAATATC
TATTCTATTATTTATAACATTCTCGATTTCCCGGCGGGATCTTTACCTGT
GACAAATGTCAATCAACTCGACCTAGACAAACTGGTTAAATGTCAATCAA
AAAAAACTTGTTGTCAAAGAAAATGTGACATGGAAGCTAAAAGTGTAGGC
TTGCCGGTCGGTGTACAGTGCGTTACGTTGCCGTGGCGTGAAGAAATTGT
GCTGCGCATAATGCAGAATATCTCTGACAAAATCTAATTTACAACATTTA
CTATAGAAAATATTTTTTCAAAGATTGAATTGAAATTGTTTAGAAAACTA
TTTGAATTATTATTAAAAATTTATTGACGCAGTGTCGCTTGAATATGCGC
TTTACTATATGCTTGCGTTTGTGTAGATCTAATGCGTTGCGTGAACTTTG
CACCGGCACTCTCTCAGCGATTGTGCTAATATTGATTTCATTTCAACAAA
TCTTAGTTGAAACTGCTCAAATATATTCAATAGATTTAACTTTTTCACAT
TTTTAGACTGCAAGAAGATCATTTTGTTTTCAGCGTAATGTGTTGTGATA
AATTAGCAAATAAACCAC
back to top

protein sequence of SMED30031745-orf-1

>SMED30031745-orf-1 ID=SMED30031745-orf-1|Name=SMED30031745-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=585bp
MNILNELDFWKNYLITSYLNDCSSILIVIAIISSVYFAKKLLQWRRIKKK
IAKKCNDTDSRKIGLFQKFQGMKRPFENIKVICELTGSEIQSKIRSHDIL
AVDVLEAFQANSLMKNNDLNFLADVIYEADVSSLMVDPKNNSGVMALPLS
VSDGLCIEKYDSTFGLLKESFHPNKKDCVVVKVLRENGAIPSIITCTGQG
DIMMGTGNLFSGKTIHPGNSKLSCGGNSGSAAVALATNSSIIGIATDLQG
EIRVPASFCGVYGLKPTSKRISKRFTKSLGHKQNIIDYSIGPLARNVSDL
ISLFRSISTERMFELDPFCPPVAFNEALFSSEKPLTIGYYVNIGSNQSEC
TPAVERAVLEAKKALENVGHKLVKYQLPNVEKVFNKVHSTIMASDAGQSI
INDIIKGESIDSSLNWYVRLLKLPNLVKRLLGSFVSLFCKPGGDWIKSLA
GASVYNMWKNKDVIDSYKEEVLASWEHNNLDAVICPVAPTAAVDLKGSHC
VINENIYSIIYNILDFPAGSLPVTNVNQLDLDKLVKCQSKKTCCQRKCDM
EAKSVGLPVGVQCVTLPWREEIVLRIMQNISDKI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036928AS_sf
IPR023631Amidase_dom
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005783endoplasmic reticulum
GO:0005789endoplasmic reticulum membrane
GO:0005794Golgi apparatus
GO:0016020membrane
GO:0016021integral component of membrane
GO:0031090organelle membrane
Vocabulary: molecular function
TermDefinition
GO:0004040amidase activity
GO:0016787hydrolase activity
GO:0017064fatty acid amide hydrolase activity
GO:0102077oleamide hydrolase activity
GO:0103073anandamide amidohydrolase activity
Vocabulary: biological process
TermDefinition
GO:0009062fatty acid catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036928Amidase signature (AS) superfamilyGENE3DG3DSA:3.90.1300.10coord: 43..584
e-value: 1.7E-121
score: 408.5
IPR036928Amidase signature (AS) superfamilySUPERFAMILYSSF75304Amidase signature (AS) enzymescoord: 82..580
IPR023631Amidase signature domainPFAMPF01425Amidasecoord: 104..574
e-value: 3.7E-73
score: 247.0
NoneNo IPR availablePIRSFPIRSF001221Amidase_fungicoord: 43..584
e-value: 6.4E-64
score: 214.0
NoneNo IPR availablePANTHERPTHR45847FAMILY NOT NAMEDcoord: 24..583
NoneNo IPR availableTMHMMTMhelixcoord: 13..35