slc16a-17

Overview
Nameslc16a-17 (AKN21512.1)
Smed IDSMED30031741
Length (bp)1847
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc16a-17 (SMED30031741) t-SNE clustered cells

Violin plots show distribution of expression levels for slc16a-17 (SMED30031741) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc16a-17 (SMED30031741) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc16a-17 (SMED30031741) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031741

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30031741h1SMcG0020015 SmedASXL_015700SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30031741h1SMcG0020015 dd_Smed_v4_11626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031741h1SMcG0020015 dd_Smed_v4_11626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031741h1SMcG0020015 dd_Smed_v4_11626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30031741h1SMcG0020015 dd_Smed_v4_11626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30031741h1SMcG0020015 dd_Smed_v4_11626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031741h1SMcG0020015 dd_Smed_v4_11626_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031741h1SMcG0020015 dd_Smed_v6_11626_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30031741h1SMcG0020015 Contig28986uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30031741h1SMcG0020015 Contig28986newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc16a-17 vs. Ensembl Human
Match: SLC16A14 (solute carrier family 16 member 14 [Source:HGNC Symbol;Acc:HGNC:26417])

HSP 1 Score: 140.198 bits (352), Expect = 6.704e-35
Identity = 118/479 (24.63%), Postives = 228/479 (47.60%), Query Frame = 3
Query:  270 DGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPI--EKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTF----LGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            DGG+ W  V ++F    LI G   + G +    +E+L     +     W+ +L +   L+ GP   +     G R  A+IGG ++   +++   +  N+   +I +G+  G+G GM ++  ++ + +YF K+R L+ G +  GTGFG F+M  L++ + + + W   + I   +SL   V   L+RPL P   + N   E++++        S+  + +   +  K G + +   L  + +A   P     ++++  +R L  V+ + ++ R+  ++             YF    + F N     +   AL     + +PF ++   V   Y+ ++    F +++  + + V  FG  +L  +A    I ++ + LL   T+ ++S F    + TY        ++G + G   +L  V+  ++V ++ +A+A+G+     GI  L+GPPFAG I+DI Q YD  F++ G L++I  L
Sbjct:   29 DGGWAWMMVLSSFFVHILIMGSQMALGVLN---VEWLEEFHQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAA-NVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVSLNLCVCGALMRPLSP-GKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKDGGLGNEETLCDL-QAQECPDQAGHRKNMCALRILKTVSWLTMRVRKGFEDWYS---------GYFGTASL-FTNRMFVAFIFWALFAYSSFVIPFIHLPEIV-NLYNLSEQNDVFPLTS--IIAIVHIFGKVILGVIADLPCISVWNVFLLANFTL-VLSIFILPLMHTYAGLAVICALIGFSSG-YFSLMPVVTEDLVGIEHLANAYGIIICANGISALLGPPFAGWIYDITQKYDFSFYICGLLYMIGIL 486          
BLAST of slc16a-17 vs. Ensembl Human
Match: SLC16A9 (solute carrier family 16 member 9 [Source:HGNC Symbol;Acc:HGNC:23520])

HSP 1 Score: 135.961 bits (341), Expect = 1.725e-33
Identity = 110/485 (22.68%), Postives = 218/485 (44.95%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVD-SNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETI----GPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFI---VSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVV 1697
            PDGG+GW  VF +F+   L  G   + G    L +E+L           W+G+L     LL  P+ S+    FG R V +  GF+     ++   +P NI+  +  YGI+ G+G G+++ A +    QYFD +R L+ G    G+  G+F+  +L + +V ++   G + I+  ++L  +    L+RPL             E+L P+ Y I N    + E   +++   + S        +  +     +++ +++    +  T  P  +++ + E          ++  +++ +C   V    +++F     A+L       P   +   V    S N     FI   +S +G+ ++V +   G+LA       +++Y+  L++ G       F  +Y+     + I+G   G+  ++   +  + V ++++A A+G+     G+G  +GPP  G  +D  Q YD+ F+ SG   ++   +++
Sbjct:    7 PDGGWGWVIVFVSFLTQFLCYGSPLAVGV---LYIEWLDAFGEGKGKTAWVGSLASGVGLLASPVCSLCVSSFGARPVTIFSGFMVAGGLMLSSFAP-NIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDDRRGLALGLISTGSSVGLFIYAALQRMLVEFYGLDGCLLIVGALALNILACGSLMRPLQSSDCPLPKKIAPEDL-PDKYSIYNEKGKNLEENINILDKSYSSE----EKCRITLANGDWKQDSLLHKNPTVTHTKEPETYKKKVAEQTYFCKQLAKRKWQLYKNYCGETVALFKNKVFSALFIAILLFDIGGFPPSLLMEDVAR--SSNVKEEEFIMPLISIIGIMTAVGKLLLGILADFKWINTLYLYVATLIIMGLALCAIPFAKSYVTLALLSGILGFLTGN-WSIFPYVTTKTVGIEKLAHAYGILMFFAGLGNSLGPPIVGWFYDWTQTYDIAFYFSGFCVLLGGFILL 479          
BLAST of slc16a-17 vs. Ensembl Human
Match: SLC16A9 (solute carrier family 16 member 9 [Source:HGNC Symbol;Acc:HGNC:23520])

HSP 1 Score: 135.961 bits (341), Expect = 1.725e-33
Identity = 110/485 (22.68%), Postives = 218/485 (44.95%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVD-SNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETI----GPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFI---VSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVV 1697
            PDGG+GW  VF +F+   L  G   + G    L +E+L           W+G+L     LL  P+ S+    FG R V +  GF+     ++   +P NI+  +  YGI+ G+G G+++ A +    QYFD +R L+ G    G+  G+F+  +L + +V ++   G + I+  ++L  +    L+RPL             E+L P+ Y I N    + E   +++   + S        +  +     +++ +++    +  T  P  +++ + E          ++  +++ +C   V    +++F     A+L       P   +   V    S N     FI   +S +G+ ++V +   G+LA       +++Y+  L++ G       F  +Y+     + I+G   G+  ++   +  + V ++++A A+G+     G+G  +GPP  G  +D  Q YD+ F+ SG   ++   +++
Sbjct:    7 PDGGWGWVIVFVSFLTQFLCYGSPLAVGV---LYIEWLDAFGEGKGKTAWVGSLASGVGLLASPVCSLCVSSFGARPVTIFSGFMVAGGLMLSSFAP-NIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDDRRGLALGLISTGSSVGLFIYAALQRMLVEFYGLDGCLLIVGALALNILACGSLMRPLQSSDCPLPKKIAPEDL-PDKYSIYNEKGKNLEENINILDKSYSSE----EKCRITLANGDWKQDSLLHKNPTVTHTKEPETYKKKVAEQTYFCKQLAKRKWQLYKNYCGETVALFKNKVFSALFIAILLFDIGGFPPSLLMEDVAR--SSNVKEEEFIMPLISIIGIMTAVGKLLLGILADFKWINTLYLYVATLIIMGLALCAIPFAKSYVTLALLSGILGFLTGN-WSIFPYVTTKTVGIEKLAHAYGILMFFAGLGNSLGPPIVGWFYDWTQTYDIAFYFSGFCVLLGGFILL 479          
BLAST of slc16a-17 vs. Ensembl Human
Match: SLC16A6 (solute carrier family 16 member 6 [Source:HGNC Symbol;Acc:HGNC:10927])

HSP 1 Score: 129.028 bits (323), Expect = 4.523e-31
Identity = 126/480 (26.25%), Postives = 210/480 (43.75%), Query Frame = 3
Query:  243 KSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPL---DPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAG----TMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAE--MVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFW 1655
            K+N+   +PDGG+GW    + F       G+  +FG     LM+      S    I+WI ++ V       P+A++L  +FG R+V M+GG +     +    S   +   Y+  GII+G+G    F+  +  +SQYF K+R + T  A  G  F +F     + A+     W  ++  +  + L  ++F  LLRP+    P S       +EN K   Y ++N    ++ +IDS      + S + LT+  + +   P      +  ++ M    V    R        P  K+  +  +   +   F       Y L  L  +  +  P  Y+   +      +Q  A F++STM ++    R G G +    P RKI+I +I +++           + F G     IF+  +VG   G+ I L    LAE  +V +++M+SA G+Y  I  I  L GPP AGL+ D  + Y   F+
Sbjct:   11 KANVYTEVPDGGWGWAVAVSFFFVEVFTYGIIKTFGVFFNDLMDSFNESNSR---ISWIISICVFVLTFSAPLATVLSNRFGHRLVVMLGGLLVSTGMVAASFSQ-EVSHMYVAIGIISGLGYCFSFLPTVTILSQYFGKRRSIVTAVASTGECFAVFAFAPAIMALKERIGWRYSLLFVGLLQLNIVIFGALLRPIFIRGPAS--PKIVIQENRKEAQYMLENEK--TRTSIDS------IDSGVELTTSPKNV---PTHTNLELEPKADMQQVLVKTSPR--------PSEKKAPLLDFSILKEKSF-----ICYALFGLFATLGFFAPSLYIIP-LGISLGIDQDRAAFLLSTMAIAEVFGRIGAGFVLNREPIRKIYIELICVILLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGTHIPL----LAEDDVVGIEKMSSAAGVYIFIQSIAGLAGPPLAGLLVDQSKIYSRAFY 455          
BLAST of slc16a-17 vs. Ensembl Human
Match: SLC16A6 (solute carrier family 16 member 6 [Source:HGNC Symbol;Acc:HGNC:10927])

HSP 1 Score: 129.028 bits (323), Expect = 4.523e-31
Identity = 126/480 (26.25%), Postives = 210/480 (43.75%), Query Frame = 3
Query:  243 KSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPL---DPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAG----TMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAE--MVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFW 1655
            K+N+   +PDGG+GW    + F       G+  +FG     LM+      S    I+WI ++ V       P+A++L  +FG R+V M+GG +     +    S   +   Y+  GII+G+G    F+  +  +SQYF K+R + T  A  G  F +F     + A+     W  ++  +  + L  ++F  LLRP+    P S       +EN K   Y ++N    ++ +IDS      + S + LT+  + +   P      +  ++ M    V    R        P  K+  +  +   +   F       Y L  L  +  +  P  Y+   +      +Q  A F++STM ++    R G G +    P RKI+I +I +++           + F G     IF+  +VG   G+ I L    LAE  +V +++M+SA G+Y  I  I  L GPP AGL+ D  + Y   F+
Sbjct:   11 KANVYTEVPDGGWGWAVAVSFFFVEVFTYGIIKTFGVFFNDLMDSFNESNSR---ISWIISICVFVLTFSAPLATVLSNRFGHRLVVMLGGLLVSTGMVAASFSQ-EVSHMYVAIGIISGLGYCFSFLPTVTILSQYFGKRRSIVTAVASTGECFAVFAFAPAIMALKERIGWRYSLLFVGLLQLNIVIFGALLRPIFIRGPAS--PKIVIQENRKEAQYMLENEK--TRTSIDS------IDSGVELTTSPKNV---PTHTNLELEPKADMQQVLVKTSPR--------PSEKKAPLLDFSILKEKSF-----ICYALFGLFATLGFFAPSLYIIP-LGISLGIDQDRAAFLLSTMAIAEVFGRIGAGFVLNREPIRKIYIELICVILLTVSLFAFTFATEFWGLMSCSIFFGFMVGTIGGTHIPL----LAEDDVVGIEKMSSAAGVYIFIQSIAGLAGPPLAGLLVDQSKIYSRAFY 455          
BLAST of slc16a-17 vs. Ensembl Celegans
Match: mct-3 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:Q93896])

HSP 1 Score: 171.4 bits (433), Expect = 9.989e-46
Identity = 154/567 (27.16%), Postives = 252/567 (44.44%), Query Frame = 3
Query:  189 QFESMIDSTEDLEIVYYKKSNLRIIIP-DGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWI-GALQVSFPLLC----GPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYF--SWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQE--ENLKPELYQIQNSMIFSKE--------------AIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNV-----TGV-----PIQHRESL------------------------DETIGPVGKRLHIFQYF--CCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSV--ITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPI 1703
            Q +    + +D E V  +  +   I P DGGYGW  V A+F+ + ++DG+ F+ G I       L P    SF I+    A+ +S    C    GPIAS+L   FG R VA+ G  I+   +++  +S PNI++ Y+ +G+I G G GM+++  ++ ISQYF KKR ++TG AVCG+G G  V   L   +  +    W   +   A +++  +  C LLRPL P         +  E+ +    ++  S + SK                +++   +G + S ++  S +      P+ ++DI Y  S  N+     TG        +H++SL                        D  I    K   I Q            +    L   S  L  CC+ +PF Y+ + + +          F VS +GV + V R G G+LA       + +   AL+ AG   +       Y  W F A  V  ++G      L S+I+ E++ L+++++AFG+     G+G ++G P A  + D   N+D  F+V G L  IS  + +P+
Sbjct:    7 QADEKAAAHQDPETVEKELEDAGFIAPPDGGYGWAIVAASFLLNMIVDGVIFTVGKI-------LQPAWVHSFGISEASAAMTMSILSGCYFFAGPIASVLCNVFGCRQVALAGSLIAALGFLLS-ISAPNIYVLYVSFGLIAGAGFGMMYLPAIVIISQYFAKKRSVATGIAVCGSGIGTTVFALLNDVVWDFVGGDWKQFLVYTAAVTISGLGACILLRPLKPSKDQIEKVAKVLEDYEEHKEKVPESPLLSKHNTPFLSSLELHTAGKLENGHHTGSIKSIVDAVSKEIEDLNKPLLRKDIFYSGSTTNIAARSRTGTMTREEAAEHQQSLRFRGKVETPQQYLSKADLNAGDNGDVAIANESKIQEIKQALKQLVDKELLFSPSFLLLAFSGTLTLCCFYVPFIYLGNHLDKIEGLTTAEKSFTVSLIGVLNIVARIGCGILADRPEVSALAVNNFALIAAGLATMTVPLYTAY--WQFLAFCVPFSIGVACFAALRSIIVVELIGLEKLSNAFGILLTFMGVGAVVGSPLAAAMKDYTGNFDTSFYVMGALMTISGAMCIPL 563          
BLAST of slc16a-17 vs. Ensembl Celegans
Match: mct-1 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:A0A0M7RE14])

HSP 1 Score: 140.584 bits (353), Expect = 2.523e-35
Identity = 123/512 (24.02%), Postives = 222/512 (43.36%), Query Frame = 3
Query:  255 RIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLC----GPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFI--LAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRES--LDETIGPVGKR--LHIFQYFCCRPVC-------FRNSQXXXXXXXXXXXXXXYTL-------------PFYYVASTVTEKY-SFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVV 1697
            ++  PDGGYGW  V A+F+ +  +DG+ ++ G I       L P+ +  F    +    +S    C    GP+AS     FG R VA+ G  ++  ++++   +   IW  Y+ +G++ G+G G +++  ++ +S YF KKR ++TG AVCG+G G  V  ++   +  YF      F+  LA +++   +F  L  PL           E  +K     ++N     +E    +++        ++ +  E +  P     D  Y          P+    S  LD       +   +H  ++     V        F+ S   +     L      TL             PF Y+A  + +K   F        V+ +G  + +FR G G++A       + +  +A ++AGT  +   F      ++ + I     +     L SVI  E++ ++++++AFG+  +  GIG ++G P A  I DI  NYD+ F+V G +F  S ++ +
Sbjct:   36 KVTPPDGGYGWVVVAASFLVNMAVDGVIYTCGKI-------LVPIWADQFGSTSVAGAVISILTGCYYLAGPLASSFVNVFGIRSVAIAGSILATTAFLLSRFAS-TIWELYLLFGVLGGIGFGCMYLPSIVILSTYFAKKRSVATGIAVCGSGIGTMVFSTINGPVFDYFGKDVGSFMVYLAAIAISGSLFSLLFAPL--------KATEHQVKKVAKMVRNYEGKPEEPTQRLLE--------DVRNDLEELNRPG-HNADTFY------AGNAPVSRSRSNTLDRKAAESAEAHVVHATEHHTVHHVVKKSKFTKFKESLCSVLDKDLLFSPSFMTLAVSGTFTVLSFLVPFVYLALAMKQKNPDFTDAELSLPVTLIGAFNIMFRIGCGMVADHPKMSALQVSNVATIIAGTSMLFVPFCTELWHYVVFCIPFSAGVACFAALRSVICVELIGVEKLSNAFGILMVFMGIGAVVGGPIAAQIKDITGNYDISFYVMGIIFAFSGVMTI 516          
BLAST of slc16a-17 vs. Ensembl Celegans
Match: mct-2 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:A0A0M7RE14])

HSP 1 Score: 140.584 bits (353), Expect = 2.523e-35
Identity = 123/512 (24.02%), Postives = 222/512 (43.36%), Query Frame = 3
Query:  255 RIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLC----GPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFI--LAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRES--LDETIGPVGKR--LHIFQYFCCRPVC-------FRNSQXXXXXXXXXXXXXXYTL-------------PFYYVASTVTEKY-SFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVV 1697
            ++  PDGGYGW  V A+F+ +  +DG+ ++ G I       L P+ +  F    +    +S    C    GP+AS     FG R VA+ G  ++  ++++   +   IW  Y+ +G++ G+G G +++  ++ +S YF KKR ++TG AVCG+G G  V  ++   +  YF      F+  LA +++   +F  L  PL           E  +K     ++N     +E    +++        ++ +  E +  P     D  Y          P+    S  LD       +   +H  ++     V        F+ S   +     L      TL             PF Y+A  + +K   F        V+ +G  + +FR G G++A       + +  +A ++AGT  +   F      ++ + I     +     L SVI  E++ ++++++AFG+  +  GIG ++G P A  I DI  NYD+ F+V G +F  S ++ +
Sbjct:   36 KVTPPDGGYGWVVVAASFLVNMAVDGVIYTCGKI-------LVPIWADQFGSTSVAGAVISILTGCYYLAGPLASSFVNVFGIRSVAIAGSILATTAFLLSRFAS-TIWELYLLFGVLGGIGFGCMYLPSIVILSTYFAKKRSVATGIAVCGSGIGTMVFSTINGPVFDYFGKDVGSFMVYLAAIAISGSLFSLLFAPL--------KATEHQVKKVAKMVRNYEGKPEEPTQRLLE--------DVRNDLEELNRPG-HNADTFY------AGNAPVSRSRSNTLDRKAAESAEAHVVHATEHHTVHHVVKKSKFTKFKESLCSVLDKDLLFSPSFMTLAVSGTFTVLSFLVPFVYLALAMKQKNPDFTDAELSLPVTLIGAFNIMFRIGCGMVADHPKMSALQVSNVATIIAGTSMLFVPFCTELWHYVVFCIPFSAGVACFAALRSVICVELIGVEKLSNAFGILMVFMGIGAVVGGPIAAQIKDITGNYDISFYVMGIIFAFSGVMTI 516          
BLAST of slc16a-17 vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 138.272 bits (347), Expect = 4.614e-34
Identity = 79/224 (35.27%), Postives = 129/224 (57.59%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDS 938
            PDGGYGW  VFAAFM++ ++DG+  +F   +    E     ES    + +IG+L +   LL GP+ S L  K+  R V M GG IS  +++I   SP NI++F + YG++ G+G GM+++  ++ +  YFD KR ++TG +V G+G G F++  + Q  ++   W  TI++LA M    + +  L RPL P+ VD N  +++ ++P    +        EA++S
Sbjct:   15 PDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERY--QESDGLTV-FIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASP-NIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPL-PM-VDLNEIRDQEMEPLRQALSKVEDDEDEAVES 232          

HSP 2 Score: 75.8702 bits (185), Expect = 3.756e-14
Identity = 68/287 (23.69%), Postives = 140/287 (48.78%), Query Frame = 3
Query:  870 ENLKPELYQIQNSMIFSKEAIDSVIKS--GFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMN---VTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWIS 1715
            +NLK   ++ + +M   + +  S+ +S  G   S +NL+     +G P I +++   I   ++      +P+  R +L E I      L++ +      +C  N          LL    + +P  ++   ++E    +   A F+V   GV +++ R   G L        + I  ++L+++G + +    L +     F+AI+ G  + + I L S++LA+++ L+ + ++FGL  +  GI  L+GPPFAG+++DI  +YD  F+  G + +++ L+   I +++
Sbjct:  369 QNLKE--FKEEGTMAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEEEMIEPFVDDGCCKVLPLPMRNALSEMID-----LNLLKNKTMMILCISN----------LLGMMGFYIPIMFLKD-LSESMKLDMSLAMFLVPIFGVFNTIGRVFFGWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDITGSYDTAFYFGGLVLLVAGLISATIPFVT 637          
BLAST of slc16a-17 vs. Ensembl Celegans
Match: mct-4 (MonoCarboxylate Transporter family [Source:UniProtKB/TrEMBL;Acc:H2L0E5])

HSP 1 Score: 138.272 bits (347), Expect = 4.614e-34
Identity = 79/224 (35.27%), Postives = 129/224 (57.59%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDS 938
            PDGGYGW  VFAAFM++ ++DG+  +F   +    E     ES    + +IG+L +   LL GP+ S L  K+  R V M GG IS  +++I   SP NI++F + YG++ G+G GM+++  ++ +  YFD KR ++TG +V G+G G F++  + Q  ++   W  TI++LA M    + +  L RPL P+ VD N  +++ ++P    +        EA++S
Sbjct:   15 PDGGYGWVIVFAAFMSNLVVDGISTAFSEFKQSYKERY--QESDGLTV-FIGSLIIGTYLLVGPLVSALCNKYEQRYVVMAGGLISGIAFMIAPASP-NIYVFMLIYGVMGGLGFGMIYLPAIVVVGFYFDSKRAMATGISVAGSGVGTFLVPLICQVCIANLGWQKTIWVLAVMIFSCVFYGYLYRPL-PM-VDLNEIRDQEMEPLRQALSKVEDDEDEAVES 232          

HSP 2 Score: 75.8702 bits (185), Expect = 3.756e-14
Identity = 68/287 (23.69%), Postives = 140/287 (48.78%), Query Frame = 3
Query:  870 ENLKPELYQIQNSMIFSKEAIDSVIKS--GFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMN---VTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWIS 1715
            +NLK   ++ + +M   + +  S+ +S  G   S +NL+     +G P I +++   I   ++      +P+  R +L E I      L++ +      +C  N          LL    + +P  ++   ++E    +   A F+V   GV +++ R   G L        + I  ++L+++G + +    L +     F+AI+ G  + + I L S++LA+++ L+ + ++FGL  +  GI  L+GPPFAG+++DI  +YD  F+  G + +++ L+   I +++
Sbjct:  369 QNLKE--FKEEGTMAGYRASTLSIPRSVVGQAVSQLNLSRTGSRLGGPGIAEDEEEMIEPFVDDGCCKVLPLPMRNALSEMID-----LNLLKNKTMMILCISN----------LLGMMGFYIPIMFLKD-LSESMKLDMSLAMFLVPIFGVFNTIGRVFFGWLTDQKILSALTINNLSLIVSGLLTLACPLLTSIAGQYFYAIVFGFIISAYICLTSIVLADLMGLENLTNSFGLLVVARGIASLVGPPFAGIVYDITGSYDTAFYFGGLVLLVAGLISATIPFVT 637          
BLAST of slc16a-17 vs. Ensembl Fly
Match: chk (gene:FBgn0033095 transcript:FBtr0302166)

HSP 1 Score: 130.183 bits (326), Expect = 4.273e-31
Identity = 73/191 (38.22%), Postives = 107/191 (56.02%), Query Frame = 3
Query:  264 IPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLD 836
            +PDGGYGW  VFA+ + S + DG+ FSFG I   L+EY     S +    WI +L  S PLL GPI S L  K+G R + ++GG +S   + +      +I +  + +GII+G+GLG+ ++  +++I+ +FDKKR  +TG    GTG G FV   L   ++  + W G   IL G  L   V   L+R  D
Sbjct:  132 MPDGGYGWVVVFASLVVSLIADGLSFSFGLINVELLEYFGESTSKTA---WISSLFFSVPLLMGPIWSNLVDKYGCRKMTILGGVVSAFGFALSSFCN-SIEMLMVTFGIISGLGLGIGYVTAVVSIAFWFDKKRTFATGIGASGTGIGTFVYARLTSYLIESYGWRGATLILGGTMLNACVCGALMRDPD 318          

HSP 2 Score: 57.3806 bits (137), Expect = 3.807e-8
Identity = 38/159 (23.90%), Postives = 81/159 (50.94%), Query Frame = 3
Query: 1215 YTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAG-TMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            + +P+ Y+   + ++Y ++   +  ++S +G++ +V   G G L  L+       Y + +L+ G ++  +   +  Y+  +   +I G T  S  +    IL  +V LD+   A+GL  ++ G+G + GPP AG+I++    +D  F+ +G    +S +
Sbjct:  707 FIIPYLYLPDYM-KQYKYDVSQSAELISDVGIAQTVGMIGLGYLGDLSWMNINICYSLCMLVCGASVFFMPLLITNYMGLMVMCVIFGFTFASSFSFTPSILVSIVDLDDFTCAYGLVLLVQGVGMIAGPPIAGVIYEYTGRWDDTFYYAGIFIALSGV 864          
BLAST of slc16a-17 vs. Ensembl Fly
Match: chk (gene:FBgn0033095 transcript:FBtr0336659)

HSP 1 Score: 130.183 bits (326), Expect = 4.273e-31
Identity = 73/191 (38.22%), Postives = 107/191 (56.02%), Query Frame = 3
Query:  264 IPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLD 836
            +PDGGYGW  VFA+ + S + DG+ FSFG I   L+EY     S +    WI +L  S PLL GPI S L  K+G R + ++GG +S   + +      +I +  + +GII+G+GLG+ ++  +++I+ +FDKKR  +TG    GTG G FV   L   ++  + W G   IL G  L   V   L+R  D
Sbjct:  132 MPDGGYGWVVVFASLVVSLIADGLSFSFGLINVELLEYFGESTSKTA---WISSLFFSVPLLMGPIWSNLVDKYGCRKMTILGGVVSAFGFALSSFCN-SIEMLMVTFGIISGLGLGIGYVTAVVSIAFWFDKKRTFATGIGASGTGIGTFVYARLTSYLIESYGWRGATLILGGTMLNACVCGALMRDPD 318          

HSP 2 Score: 57.3806 bits (137), Expect = 3.807e-8
Identity = 38/159 (23.90%), Postives = 81/159 (50.94%), Query Frame = 3
Query: 1215 YTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAG-TMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            + +P+ Y+   + ++Y ++   +  ++S +G++ +V   G G L  L+       Y + +L+ G ++  +   +  Y+  +   +I G T  S  +    IL  +V LD+   A+GL  ++ G+G + GPP AG+I++    +D  F+ +G    +S +
Sbjct:  707 FIIPYLYLPDYM-KQYKYDVSQSAELISDVGIAQTVGMIGLGYLGDLSWMNINICYSLCMLVCGASVFFMPLLITNYMGLMVMCVIFGFTFASSFSFTPSILVSIVDLDDFTCAYGLVLLVQGVGMIAGPPIAGVIYEYTGRWDDTFYYAGIFIALSGV 864          
BLAST of slc16a-17 vs. Ensembl Fly
Match: chk (gene:FBgn0033095 transcript:FBtr0086140)

HSP 1 Score: 130.183 bits (326), Expect = 4.273e-31
Identity = 73/191 (38.22%), Postives = 107/191 (56.02%), Query Frame = 3
Query:  264 IPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLD 836
            +PDGGYGW  VFA+ + S + DG+ FSFG I   L+EY     S +    WI +L  S PLL GPI S L  K+G R + ++GG +S   + +      +I +  + +GII+G+GLG+ ++  +++I+ +FDKKR  +TG    GTG G FV   L   ++  + W G   IL G  L   V   L+R  D
Sbjct:  132 MPDGGYGWVVVFASLVVSLIADGLSFSFGLINVELLEYFGESTSKTA---WISSLFFSVPLLMGPIWSNLVDKYGCRKMTILGGVVSAFGFALSSFCN-SIEMLMVTFGIISGLGLGIGYVTAVVSIAFWFDKKRTFATGIGASGTGIGTFVYARLTSYLIESYGWRGATLILGGTMLNACVCGALMRDPD 318          

HSP 2 Score: 57.3806 bits (137), Expect = 3.807e-8
Identity = 38/159 (23.90%), Postives = 81/159 (50.94%), Query Frame = 3
Query: 1215 YTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAG-TMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            + +P+ Y+   + ++Y ++   +  ++S +G++ +V   G G L  L+       Y + +L+ G ++  +   +  Y+  +   +I G T  S  +    IL  +V LD+   A+GL  ++ G+G + GPP AG+I++    +D  F+ +G    +S +
Sbjct:  707 FIIPYLYLPDYM-KQYKYDVSQSAELISDVGIAQTVGMIGLGYLGDLSWMNINICYSLCMLVCGASVFFMPLLITNYMGLMVMCVIFGFTFASSFSFTPSILVSIVDLDDFTCAYGLVLLVQGVGMIAGPPIAGVIYEYTGRWDDTFYYAGIFIALSGV 864          
BLAST of slc16a-17 vs. Ensembl Fly
Match: Sln (gene:FBgn0033657 transcript:FBtr0088032)

HSP 1 Score: 121.709 bits (304), Expect = 2.041e-28
Identity = 71/207 (34.30%), Postives = 107/207 (51.69%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDP-ISVDSNSCQEENLKP 884
            PDGGYGW+ VF AF     + G+  S+G +   +ME  P   S +   +WI A+  +  L+  P++S L ++F  R V  +GG       I+ + +   + +   F G++ G+G G+    G++ +SQYFDK R L+ G  V GT  G F++  L++ +     +HGTI IL G  L   V   L RP+      DS   QEE  KP
Sbjct:  226 PDGGYGWFIVFGAFSVQFWVAGLVKSYGVLYVEIMETFP--SSTATVASWIPAILSALCLVLAPLSSALCQRFSCRTVVFVGGIFCAMGMILSYFATSLLHLLLTF-GVLTGIGGGLSTTPGIVIVSQYFDKHRALANGICVSGTAAGSFILPVLIKHLAENCGFHGTILILGGCMLHVCVSATLYRPISAYTDQDSGQGQEETAKP 429          

HSP 2 Score: 66.2402 bits (160), Expect = 6.157e-11
Identity = 48/152 (31.58%), Postives = 79/152 (51.97%), Query Frame = 3
Query: 1227 FYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAP-DRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFII 1679
             YY+ + V     +N+  AG++V+   V   + R G G L  L   DRK   Y + +L AG   +   F  T +L    A + G  LGS   L  V+LA++   D ++S++GL +M   IG +  PP AGL+ D+  +Y++ F+  G+  ++
Sbjct:  676 LYYLPAHVI-SIGYNKSEAGYLVAISAVLDLIGRLGLGWLCDLQLFDRK-KTYTLCILGAGCAVLTIPFAKTLVLVGLSAAVYGLCLGSWYVLMPVLLADVFGTDRISSSYGLVRMFQSIGAISVPPLAGLMRDLSGDYEICFYCMGSCMVL 825          
BLAST of slc16a-17 vs. Ensembl Fly
Match: CG13907 (gene:FBgn0035173 transcript:FBtr0072593)

HSP 1 Score: 121.324 bits (303), Expect = 2.886e-28
Identity = 66/189 (34.92%), Postives = 105/189 (55.56%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPL 833
            PDGGYGW   FA+FM + ++DG+ ++FG     L E++         + W+G+L     L  GPI S L  K+G R V + G  I+C ++++   S  N+ +    YG + G G GM+++  ++ +  YF+ KR L+TG AVCG+GFG F    L   ++  + W   + I AG+ L   +F  ++RPL
Sbjct:   72 PDGGYGWVICFASFMCNMIVDGIAYTFGI---FLEEFVAYFHEGKGTVAWVGSLLSGVYLSAGPIVSALANKYGCRAVCIAGSIIACIAFVLSTFST-NVSMLMATYGFMGGFGFGMIYLPAVVAVGYYFETKRSLATGIAVCGSGFGTFAFAPLATYLLEEYGWKNALLIFAGLILNCAIFGAMMRPL 256          

HSP 2 Score: 69.707 bits (169), Expect = 5.170e-12
Identity = 46/157 (29.30%), Postives = 84/157 (53.50%), Query Frame = 3
Query: 1221 LPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALV 1691
            +PF Y+     E +   +  A  ++S +G++++V R   G +A L     + +    LL++     ++    +Y  +I  +I  G  +   I+L S+IL +++ LD++ +AFGL  +  G   LIG P AG I+D+   YD+ F+++G LF IS + 
Sbjct:  588 VPFVYLVDAAKE-HDIPKNDAAMLLSIIGITNTVGRVFCGWVADLPQVNSLLLNNCCLLVSTIAVTLTPLCYSYAAYITMSIFFGLAISGYISLTSIILVDLLGLDKLTNAFGLLILFRGFAALIGTPLAGAIYDMTHTYDLPFYMAGALFGISTIT 743          
BLAST of slc16a-17 vs. Ensembl Zebrafish
Match: slc16a9a (solute carrier family 16 member 9a [Source:ZFIN;Acc:ZDB-GENE-040426-1364])

HSP 1 Score: 139.043 bits (349), Expect = 1.101e-34
Identity = 121/476 (25.42%), Postives = 213/476 (44.75%), Query Frame = 3
Query:  270 DGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPIS--VDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYL-LWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            DGG+GW  V A+FM   L  G   S G + P   E+L   +       W+G++     L+  P+ S     FG R V +  G +     ++   +P NI      YGI+ GMG G+V+ A L    QYFDK+R L+ G    GT  G F+  +L   ++  F   G + I+  ++L  +     +RPL+     +   +  +    PE    + + +  +   D   K G      N T++K  +   PIE +D    R +  ++   I    ++ + + P G      QYFC      ++     + ++  LFS     P  ++      +   + +    +VS + +++ + +   GVLA +     +++Y + L+ +GT  ++     +YL L I  A +  G      +L S I  ++V ++ +  A G+     G G  +GPP  G  FD  Q+YD+ F++SGT  ++S +
Sbjct:   11 DGGWGWMIVVASFMAQFLSFGSPQSVGVLYP---EWLSAFQEGKGMTAWVGSMVSGVALITSPVCSACVDNFGARPVTIFSGVMVAGGLMLSAFAP-NISFLIFSYGIVVGMGCGLVYAATLTITCQYFDKRRGLALGIVTTGTSVGGFIYATLQNELIELFGLEGCLLIIGALALNLMACAGPMRPLNLPGYYLKQRAALQRTEDPEPLYSKPTAVIIESGSDLKTKPGLAE---NTTTVKLLINKDPIELQDSEGERKVHILSSSIIAR--AIKKWMRPYG------QYFCETVELLQDRIFMAFCIAMFLFSLGAFPPVLFMEDVAQSEGLIDGIALIPLVSIVAMTTGIGKLILGVLADMRWVNSLYLYALTLIGSGTALLLIPVSKSYLGLQILSASV--GFFSGNWSLTSYITTKIVGIERLGQAHGILMCFGGFGIALGPPVVGWFFDWTQSYDLAFYLSGTCVLVSGV 469          
BLAST of slc16a-17 vs. Ensembl Zebrafish
Match: slc16a4 (solute carrier family 16 member 4 [Source:ZFIN;Acc:ZDB-GENE-070112-602])

HSP 1 Score: 139.043 bits (349), Expect = 1.648e-34
Identity = 121/502 (24.10%), Postives = 227/502 (45.22%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFG-FIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGI-FVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLD---PISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSG-----FVSSFINLTSMKEAMGVPPIEKE----------DIMYIRSLMNVTGV-PIQH--RESLDETIGPVGKRLHIFQ-----YFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            PDGG+GW  V   F+ + L+ G   +FG F   L  E+      +S +I+WIG++  S  L  GP+AS+   K G RV +++G       ++    +  ++   YI  G++ G+G  +++ A  + I  YF K+  L+T  ++  +G G+ F +    Q ++  ++W G + IL G+ L  +    LLRP++   P S  SNS   +  K  L   +N+M  +    +   KS         + I    + E   +P ++ +          D    ++   + GV P+         E +     ++  F      +FC        SQ              Y +P++++ S        + M A FI+S  G++ +V +  +G +       K   +   L++ G +N++S    +Y+L + +A+      G  + L   +L ++V  D++ ++ G      G+G L GPP AG ++D  Q YD  F+++G  +++S++
Sbjct:   26 PDGGWGWMVVLHCFLVNVLVMGTLKTFGIFFVALQDEF----GGSSESISWIGSIMSSLRLSGGPLASVACAKLGNRVTSIVGALFVSAGFLFSIFA-TSVTYLYISMGLVVGLGFALLYQATSVVIVTYFRKR--LATAYSIGRSGMGLTFALAPFTQLLLDQYAWQGALLILGGLMLNLVASGMLLRPINIRHPASPISNSTIHKTKKDSL---KNNMNGNTPVANGTSKSDSSPPIHKDTLIIKNPVHEQNSLPHLDLKKPTQNGVNGTDSSQTKTSPEMNGVSPVDSLLENGRTENVPENSPKVLDFSLLKNPFFCIYTWSLVFSQ------------LAYFIPYFHL-SARARNLGIDPMDASFIISVAGITETVAQLASGWVTDRNLVHKYHYHKAYLILCGVVNLLSPLATSYILLMVYAVFFAIFCGGYMALLLPVLVDLVGADKLNNSMGFSMFFVGLGCLTGPPLAGFLYDYTQTYDCSFYLAGVCYLLSSI 504          
BLAST of slc16a-17 vs. Ensembl Zebrafish
Match: slc16a4 (solute carrier family 16 member 4 [Source:ZFIN;Acc:ZDB-GENE-070112-602])

HSP 1 Score: 138.658 bits (348), Expect = 2.424e-34
Identity = 121/502 (24.10%), Postives = 227/502 (45.22%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFG-FIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGI-FVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLD---PISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSG-----FVSSFINLTSMKEAMGVPPIEKE----------DIMYIRSLMNVTGV-PIQH--RESLDETIGPVGKRLHIFQ-----YFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            PDGG+GW  V   F+ + L+ G   +FG F   L  E+      +S +I+WIG++  S  L  GP+AS+   K G RV +++G       ++    +  ++   YI  G++ G+G  +++ A  + I  YF K+  L+T  ++  +G G+ F +    Q ++  ++W G + IL G+ L  +    LLRP++   P S  SNS   +  K  L   +N+M  +    +   KS         + I    + E   +P ++ +          D    ++   + GV P+         E +     ++  F      +FC        SQ              Y +P++++ S        + M A FI+S  G++ +V +  +G +       K   +   L++ G +N++S    +Y+L + +A+      G  + L   +L ++V  D++ ++ G      G+G L GPP AG ++D  Q YD  F+++G  +++S++
Sbjct:   38 PDGGWGWMVVLHCFLVNVLVMGTLKTFGIFFVALQDEF----GGSSESISWIGSIMSSLRLSGGPLASVACAKLGNRVTSIVGALFVSAGFLFSIFA-TSVTYLYISMGLVVGLGFALLYQATSVVIVTYFRKR--LATAYSIGRSGMGLTFALAPFTQLLLDQYAWQGALLILGGLMLNLVASGMLLRPINIRHPASPISNSTIHKTEKDPL---KNNMNGNTPVANGTSKSDSSPPIHKDTLIIKNPVHEQNSLPHLDLKKPTQNGVNGTDSSQTKTSPEMNGVSPVDSLLENGRTENVPENSPKVLDFSLLKNPFFCIYTWSLVFSQ------------LAYFIPYFHL-SARARNLGIDPMDASFIISVAGITETVAQLASGWVTDRNLVHKYHYHKAYLILCGVVNLLSPLATSYILLMVYAVFFAIFCGGYMALLLPVLVDLVGADKLNNSMGFSMFFVGLGCLTGPPLAGFLYDYTQTYDCSFYLAGVCYLLSSI 516          
BLAST of slc16a-17 vs. Ensembl Zebrafish
Match: slc16a4 (solute carrier family 16 member 4 [Source:ZFIN;Acc:ZDB-GENE-070112-602])

HSP 1 Score: 138.658 bits (348), Expect = 2.424e-34
Identity = 121/502 (24.10%), Postives = 227/502 (45.22%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFG-FIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGI-FVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLD---PISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSG-----FVSSFINLTSMKEAMGVPPIEKE----------DIMYIRSLMNVTGV-PIQH--RESLDETIGPVGKRLHIFQ-----YFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            PDGG+GW  V   F+ + L+ G   +FG F   L  E+      +S +I+WIG++  S  L  GP+AS+   K G RV +++G       ++    +  ++   YI  G++ G+G  +++ A  + I  YF K+  L+T  ++  +G G+ F +    Q ++  ++W G + IL G+ L  +    LLRP++   P S  SNS   +  K  L   +N+M  +    +   KS         + I    + E   +P ++ +          D    ++   + GV P+         E +     ++  F      +FC        SQ              Y +P++++ S        + M A FI+S  G++ +V +  +G +       K   +   L++ G +N++S    +Y+L + +A+      G  + L   +L ++V  D++ ++ G      G+G L GPP AG ++D  Q YD  F+++G  +++S++
Sbjct:   38 PDGGWGWMVVLHCFLVNVLVMGTLKTFGIFFVALQDEF----GGSSESISWIGSIMSSLRLSGGPLASVACAKLGNRVTSIVGALFVSAGFLFSIFA-TSVTYLYISMGLVVGLGFALLYQATSVVIVTYFRKR--LATAYSIGRSGMGLTFALAPFTQLLLDQYAWQGALLILGGLMLNLVASGMLLRPINIRHPASPISNSTIHKTEKDPL---KNNMNGNTPVANGTSKSDSSPPIHKDTLIIKNPVHEQNSLPHLDLKKPTQNGVNGTDSSQTKTSPEMNGVSPVDSLLENGRTENVPENSPKVLDFSLLKNPFFCIYTWSLVFSQ------------LAYFIPYFHL-SARARNLGIDPMDASFIISVAGITETVAQLASGWVTDRNLVHKYHYHKAYLILCGVVNLLSPLATSYILLMVYAVFFAIFCGGYMALLLPVLVDLVGADKLNNSMGFSMFFVGLGCLTGPPLAGFLYDYTQTYDCSFYLAGVCYLLSSI 516          
BLAST of slc16a-17 vs. Ensembl Zebrafish
Match: slc16a9b (solute carrier family 16 member 9b [Source:ZFIN;Acc:ZDB-GENE-040801-69])

HSP 1 Score: 121.324 bits (303), Expect = 8.689e-29
Identity = 115/472 (24.36%), Postives = 200/472 (42.37%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMN-VTGVPI--QHRESLDETIGPVGKRLH--IFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYL-LWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSG 1664
            PDGG+GW  V A+FM   L  G   S G + P   E+L   + +     W+G+L     L+  PI S     FG R V +  G +     ++   +P N+      YGI+ G+G G+V+ A +    QYFDK+R L+ G    GT  G F+  +     ++ F   G + ++   +L  I    L+RPL                P  Y  Q + +  K   + + KS  V   +  T   +++ +   + +D    R L+N VT V +  + ++   E +  +G+ L   +F   C     +                  YT P  ++      +     +    +VS M +++ V +   GV+  +     I++Y + LL  G   +I      Y  L +  A++  G      ++   +  ++V +D +  A+G+     G   ++GPP AG I+D   +YD+ F+ SG
Sbjct:   10 PDGGWGWAIVVASFMGQFLAYGSPQSVGVLYP---EWLNTFQDSKGMTAWVGSLVSGVGLIASPICSACVVNFGARPVTIFSGVMVSGGLMLSAFAP-NVQFLIFSYGIVVGLGCGLVYAATVTITCQYFDKRRGLALGIVTTGTSVGGFLYAAAQNEFIALFGLDGCLLLIGCFALNIIACAGLMRPLH--------------LPAYYLKQRAAMAEKAEENVLEKSPVVEDPVKKT---QSIVLITGDTKDTHEKRKLLNYVTLVRLMKKKQKQYSEYLHSIGQVLQNRVFLATCVSLFAY--------------CLGAYT-PLLFLEDLAQSEGLITGISTIPLVSIMSIAAGVGKLLLGVMMDVRWMNSIYLYAVTLLGTGVALLIIPVTKNYAGLQVISAVL--GFFSGNWSVIPYMTTKVVGMDRLTEAYGILMFFGGFSIMLGPPVAGWIYDWMHSYDLAFYFSG 443          
BLAST of slc16a-17 vs. Ensembl Xenopus
Match: atf6b (activating transcription factor 6 beta [Source:Xenbase;Acc:XB-GENE-1013925])

HSP 1 Score: 142.895 bits (359), Expect = 7.499e-36
Identity = 124/501 (24.75%), Postives = 228/501 (45.51%), Query Frame = 3
Query:  207 DSTEDLEIVYYKKSNLRIIIP--DGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIG--PVGKRLHIFQYFCC---RPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLA--PDRKIW-IYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFII 1679
            D  ++L      K+ ++ + P  D G+ W  V ++F+   L+ G   + G +    +E+L   + +     WI +L +   L+ GPI  +     G R  AMIGGF++   +++   +P N+   +  +G+  G+G GMV++  ++T+  YF K+R L+ G +  GTGFG F++  L++ +     W   + I   ++L   V   L+RPLD         +E  + P+    +   + +  AI +   S          S   A+     E  + ++I  +         ++ S+ +T+    V  R   F ++         F N     +   ALL  C + +PF ++   V E Y   +    F +++  + + V  FG  +L  L   P    W ++I +    G   +I   +  Y        ++G + G   +L  V+  ++V + ++A+A+G+     GI  L+GPPFAG I+DI Q YD  F+V G L+++
Sbjct:    7 DMGKELAKDTKSKTQMKKVNPNIDRGWAWMVVLSSFLVHLLVMGSQMALGILN---LEWLEEFKQSRGLTAWISSLSMGITLIVGPIIGLFINTCGCRKTAMIGGFLTSLGWVLSAYAP-NVHFLFFSFGVTAGIGSGMVYLPAVVTVGHYFQKRRALAQGLSTTGTGFGTFLITVLLKYLCRELGWRNAMIIQGAVTLNLCVCGALMRPLDHDEEHLKDHEEAAVDPK--DAKEGALLNVNAIKA--NSELHEEEEGKASADTAVSWSKEETRNDIFINDM---------NKLSIMKTLTHMTVSVRSGFFAWYSSYFGASSLFTNKVFVAFVFWALLAYCSFVIPFIHLPEIV-EMYGLTEQNNIFPLTS--IIAIVHIFGKVILGFLGDLPCVSAWNVFIASNFTLGVSILILPLMHVYSSLALVCALIGFSSG-YFSLMPVVTEDLVGIKQLANAYGIIICANGISALLGPPFAGWIYDITQKYDYSFYVCGLLYMV 486          
BLAST of slc16a-17 vs. Ensembl Xenopus
Match: mad2l1 (mitotic arrest deficient 2 like 1 [Source:Xenbase;Acc:XB-GENE-947153])

HSP 1 Score: 128.642 bits (322), Expect = 4.542e-31
Identity = 118/480 (24.58%), Postives = 211/480 (43.96%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMES--ASFA-INWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPI-QHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDR-KI-WIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            PDGG+GW  V  AF++      M FS+ F + + + +    E   AS++ I WI ++ ++     GP++S+L  ++G R V + GG +S    II   S  +I   YIF G+I G G  +     +I + +YF KKRP++ G A+ G+   +  +  L Q +   F W G+ FIL  + L   V   L RP+ P + D              +IQ      K+    + + G   + +    +  + G    E +    ++    V  + + +HR  +   I  VG  +  F ++   P+ F                        Y      ++YS     A F++S + +     R GTG++A     R KI + +  ++   G  +++  F   Y+  + +++  G   G V  L    L ++V +   +SA GL  ++  +  L+GPP  G I D F +Y  +++  G + +++ L
Sbjct:   14 PDGGWGWMVVLGAFIS------MGFSYAFSKAITVFFKEIQEHFGASYSEIAWISSILLAAMYAGGPVSSILVNRYGSRPVVIFGGLLSGVGMIIATFSS-SILQLYIFIGVIAGFGFSLNLQPSVIVVGKYFLKKRPIANGLAMAGSPVVLSTLAPLNQFLFDKFGWRGSFFILGALLLNCCVAGALFRPIGPSTTD--------------KIQ------KKPAQDLAEKGTNETLLTANKLPPSYGTKMEETKQETCLQKFNKVLDLTLFKHRGFM---IYLVGNVVMFFAFYA--PIVFLTP---------------------YAKHLGVDEYS-----AAFLLSILAIVDMFARPGTGLIANTKWVRPKIQYFFSFSVTFNGFCHLMCPFATGYVGLVVYSVFFGLAFGMVCALLFETLMDLVGVKRFSSAVGLVTIVECVPLLLGPPIGGAIVDAFGDYKYMYFECGAIMVLAGL 435          
BLAST of slc16a-17 vs. Ensembl Xenopus
Match: SLC16A6 (solute carrier family 16 member 6 [Source:NCBI gene;Acc:100494933])

HSP 1 Score: 117.087 bits (292), Expect = 4.013e-27
Identity = 124/496 (25.00%), Postives = 211/496 (42.54%), Query Frame = 3
Query:  240 KKSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRP--LDPISVDSNSCQEENLKPELYQIQNSMIFSK-EAIDSVIKSGFVSSFINL-TSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYI--IALLMAGTMNIISTFLGTYLLWIFWAIIV-----GGTLGSVITLESVILAE--MVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
             ++N+   +PDGG+GW    A F       G+  SFG     L+ Y    + ++  I+WI ++ V       P++++L  +FG R V M+GG +     +    +  ++   Y+  G+I+G           I +SQYF+++R L T  A  G  F +F     + A+     W   + ++  + L  +V   LLRP  + P  V  +  + E L+   Y ++N    +  ++IDS ++    +S  NL T +K A    P                  P + +E+ +    P  + L  F          RN     Y L  L  +  +  P  Y+   ++     ++  + +++S M +S    R G G +    P RKI+I +  +ALL           L     W F  ++      GG LG+V      ++AE  +V +D+MAS  G+Y  I  +  L GPP  G++ D  QNY   F+       + AL
Sbjct:   11 SRANVYTKVPDGGWGWAVAGAFFFVEVFTYGVIKSFGVFFNELVGYF---DESNSRISWIISICVFVMTFTAPLSTVLSNRFGHRPVVMVGGLLISTGMMAASFA-RSVGEMYVAIGLISGGPTHYTRYCPRI-LSQYFERRRSLVTAVASTGECFAVFAFAPAITALNDLIGWRCCLLMVGALQLNIVVCGSLLRPITIKPPDVAKSPAKGEALE-SAYMLENEQTLTSIDSIDSGVE--VSTSPKNLPTGLKPARSPEP------------------PRERKETAER---PEPEPLLDFSV-------LRNPSFICYALFGLFATLGFFAPSLYII-PLSLSLGIDRELSPYMLSAMAISEVFGRIGAGWILNKKPVRKIYIELAFVALLCV-------ALLAFPFAWNFGGLMACSVFFGGMLGTVTGTHIPLVAEDDIVGIDKMASGVGVYVFIQSVAGLAGPPLGGVLVDWTQNYGSAFYSCAAGMALGAL 462          
BLAST of slc16a-17 vs. Ensembl Xenopus
Match: SLC16A6 (solute carrier family 16 member 6 [Source:NCBI gene;Acc:100494933])

HSP 1 Score: 114.39 bits (285), Expect = 2.846e-26
Identity = 126/501 (25.15%), Postives = 213/501 (42.51%), Query Frame = 3
Query:  243 KSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLIT------ISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRP--LDPISVDSNSCQEENLKPELYQIQNSMIFSK-EAIDSVIKSGFVSSFINL-TSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYI--IALLMAGTMNIISTFLGTYLLWIFWAIIV-----GGTLGSVITLESVILAE--MVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            ++N+   +PDGG+GW    A F       G+  SFG     L+ Y    + ++  I+WI ++ V       P++++L  +FG R V M+GG +     +    +  ++   Y+  G+I+G  LG        T      +SQYF+++R L T  A  G  F +F     + A+     W   + ++  + L  +V   LLRP  + P  V  +  + E L+   Y ++N    +  ++IDS ++    +S  NL T +K A    P                  P + +E+ +    P  + L  F          RN     Y L  L  +  +  P  Y+   ++     ++  + +++S M +S    R G G +    P RKI+I +  +ALL           L     W F  ++      GG LG+V      ++AE  +V +D+MAS  G+Y  I  +  L GPP  G++ D  QNY   F+       + AL
Sbjct:    9 RANVYTKVPDGGWGWAVAGAFFFVEVFTYGVIKSFGVFFNELVGYF---DESNSRISWIISICVFVMTFTAPLSTVLSNRFGHRPVVMVGGLLISTGMMAASFA-RSVGEMYVAIGLISGK-LGGSGGPTHYTRYCPRILSQYFERRRSLVTAVASTGECFAVFAFAPAITALNDLIGWRCCLLMVGALQLNIVVCGSLLRPITIKPPDVAKSPAKGEALE-SAYMLENEQTLTSIDSIDSGVE--VSTSPKNLPTGLKPARSPEP------------------PRERKETAER---PEPEPLLDFSV-------LRNPSFICYALFGLFATLGFFAPSLYII-PLSLSLGIDRELSPYMLSAMAISEVFGRIGAGWILNKKPVRKIYIELAFVALLCV-------ALLAFPFAWNFGGLMACSVFFGGMLGTVTGTHIPLVAEDDIVGIDKMASGVGVYVFIQSVAGLAGPPLGGVLVDWTQNYGSAFYSCAAGMALGAL 465          
BLAST of slc16a-17 vs. Ensembl Xenopus
Match: slc16a7 (solute carrier family 16 member 7 [Source:NCBI gene;Acc:100127205])

HSP 1 Score: 93.2041 bits (230), Expect = 9.346e-20
Identity = 75/292 (25.68%), Postives = 136/292 (46.58%), Query Frame = 3
Query:  249 NLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPME--SASFA-INWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISV----------DSNSCQEENLKPELYQIQNSMIFSKEAI------DSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVP 1067
             L+   PDGG+GW  VF +F++        FS+ F + + + +    E  + S++ I WI ++ ++     GPI+S+L  K+G R V +IGG + C   +I      ++   YI  G++ G GL       L  I +YF KKRP++ G A+ G+   +  +  L Q + + F W G+  IL G+ L   V   L+RP+ P  V          D N  ++E++   + +  +  +F           + ++  GF +  + L    + MG+       ++ I + +++   P
Sbjct:    7 TLQYTPPDGGWGWVVVFGSFISIG------FSYAFPKAITVFFKEIQEIFNTSYSEIAWISSIMLAVMYAGGPISSILVNKYGSRPV-VIGGGVLCSLAMISASFCNSVMQLYICIGVMGGFGLAFNLQPSLTIIGKYFFKKRPIANGLAMAGSPVFLSTLAPLNQFLFNQFGWRGSFLILGGLLLNCCVAGSLMRPIGPKPVKKDIEKAPKDDENHKKKESVCQSINKYLDLSLFKHRGFLIYLSGNVIMFIGFFAPIVFLAPYAKHMGIDQYSSAFLLSILAFVDMVARP 291          
BLAST of slc16a-17 vs. Ensembl Mouse
Match: Slc16a14 (solute carrier family 16 (monocarboxylic acid transporters), member 14 [Source:MGI Symbol;Acc:MGI:1919031])

HSP 1 Score: 145.206 bits (365), Expect = 8.398e-37
Identity = 134/526 (25.48%), Postives = 243/526 (46.20%), Query Frame = 3
Query:  192 FESMIDSTEDLEIVYYKKSNLRIIIP----DGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSM----IFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFL----GTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISA--LVVVP-IQWISGTR 1724
            + S  D   DLE    K  N + + P    DGG+ W  V ++F    LI G   + G +    +E+L     +     W+ +L +   L+ GP   +     G R  A+IGG ++   +++   +  N+   +I +G+  G+G GM ++  ++ + +YF K+R L+ G +  GTGFG F+M  L++ + + + W   +FI   +SL   V   L+RPL P  +++    EE      Y  ++      +   E  D   + G      +L + +      P  ++++   R L  V+ + +Q R          G R     YF    + F N     +   AL     + +PF ++   V+  Y+ ++    F +++  + + +  FG  +L  +A    I ++ + L+   T+ ++S FL     TY        ++G + G   +L  V+  ++V  + +A+A+G+     GI  L+GPPFAG IFDI Q YD  F++ G L+++    L++ P IQ I  +R
Sbjct:    2 YTSHEDIGYDLED-DRKAKNKKTLKPHPDIDGGWAWMMVLSSFFVHILIMGSQMALGVLN---VEWLEEFHQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAA-NVQSLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMFIQGALSLNLCVCGALMRPLSPEKLENCPEAEEPCALPAYSTESVKSGGPLGMAEEQDR--RPGNEEMVCDLQTQECQGQTHP--RKNVCAFRVLKTVSQLTVQVRR---------GFRDWHSGYFGTASL-FTNRMFVAFIFWALFAYSSFVIPFIHLPEIVS-LYNLSEQNDTFPLTS--IIAILHIFGKVILGAVADLPCISVWNVFLIANFTL-VLSIFLLPLMHTYASLAVICALIGFSSG-YFSLMPVVTEDLVGTEHLANAYGIIICANGISALLGPPFAGWIFDITQKYDFSFYICGLLYMVGILFLLIQPCIQMIDQSR 503          
BLAST of slc16a-17 vs. Ensembl Mouse
Match: Slc16a9 (solute carrier family 16 (monocarboxylic acid transporters), member 9 [Source:MGI Symbol;Acc:MGI:1914109])

HSP 1 Score: 138.658 bits (348), Expect = 1.330e-34
Identity = 111/487 (22.79%), Postives = 214/487 (43.94%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVD-SNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINL--------TSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGF-IVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVV 1697
            PDGG+GW  V  +F    L  G   + G    L +E+L           W+G+L     LL  P+ S+    FG R V +  GF+     ++  L+P NI+  +  YGI+ G+G G+++ A +    QYFD +R L+ G    G+  G+F+  +L + ++ ++   G + I+  ++L  +    L+RPL             EN+ P+ Y + N    + E   +    G+ S    L        TS+ +++ +    KE   Y + ++  T    Q  +          ++  +++ +C        +++F     A+L       P   +   V   Y   +      ++S  G+ ++V +   G+LA       +++Y+  L++ G       F  +Y+     + I+G   G+  ++   +  + V +D++A A+G+     G+G  +GPP  G  +D  Q YD+ F+ SG   ++   +++
Sbjct:    7 PDGGWGWVIVVVSFFTQFLSYGSPLAVGV---LYVEWLDAFGEGKGKTAWVGSLASGVGLLASPVCSLFVSSFGARPVTIFSGFLVAGGLMLSSLAP-NIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDSRRGLALGLISTGSSVGLFIYAALQRMLIEFYGLDGCLLIVGALALNILACGSLMRPLQTSDCPFPEKTAPENV-PDRYSMYNEKEKNPEETMNFQDKGYSSEDKCLPNGDWGRETSLPKSLAIAAHTKEPETYKKKVVEQTNFCKQLAK----------RKWQLYRNYCGETASLFKNKVFSALFIAILLFDIGGFPPSLLMEDVARSYHVREEDLTMPLISIFGIMTAVGKLLLGILADFKWINTLYLYVATLIITGLALCAIPFAKSYVTLAILSGILGFLTGN-WSIFPYVTTKTVGIDKLAHAYGILMFFAGLGNSLGPPIVGWFYDWTQTYDIAFYFSGFCVLLGGFILL 477          
BLAST of slc16a-17 vs. Ensembl Mouse
Match: Slc16a6 (solute carrier family 16 (monocarboxylic acid transporters), member 6 [Source:MGI Symbol;Acc:MGI:2144585])

HSP 1 Score: 125.561 bits (314), Expect = 3.982e-30
Identity = 119/478 (24.90%), Postives = 208/478 (43.51%), Query Frame = 3
Query:  243 KSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPEL---YQIQNSMIFSKEAIDSVIKSG--FVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAE--MVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFW 1655
            ++N+   +PDGG+GW    + F       G+  SFG     LM+     + ++  I+WI ++ V       P++++L  +FG R+V M GG +     I    S   ++  YI  G+I+G+G    F+  +  +SQYFDK+R + T  A  G  F +F     + A+  +  W  ++  +  + L  +V   LLRP+  I     S +   L+P     Y ++N    ++ +IDS I SG    +S  N+ S  +       E++  +      +    P+     L E            + F C  +        L+          Y +P         ++       A F++STM ++    R G G +    P RKI+I +I +++        TF   +   +  ++  G  +G++      +LAE  +V +++M+SA G+Y  I  I  L GPP AGL+ D  + Y   F+
Sbjct:   11 RANVYTQVPDGGWGWAVAVSFFFVEVFTYGIIKSFGVFFNDLMDSF---DESNSKISWIISICVFVLTFTAPLSTVLSNRFGHRLVVMAGGLLISLGMITASFSQ-RVYHMYISIGVISGLGYCFSFLPTVTILSQYFDKRRSVVTAVASTGECFAVFAFAPAITALKEHIGWRYSLLFVGLLQLNIMVCGALLRPI-IIQGPGQSPKAVTLEPRREVQYMLENEK--TRTSIDS-IDSGVELTTSPKNVPSEAKMEQETRAEQQQTLVTAPKHSQMKAPLLDFSVLKE------------KSFICYAL------FGLFATLGFFAPSLYIIPLGISLGIDPDR-------AAFLLSTMAIAEVFGRIGAGFVLNREPIRKIYIELICVILLTASLFAFTFATEFWGLMLCSVFFGSMVGTIGGTHIPMLAEDDVVGIEKMSSAAGVYVFIQSISGLAGPPLAGLLVDQSKIYSRAFY 455          
BLAST of slc16a-17 vs. Ensembl Mouse
Match: Slc16a6 (solute carrier family 16 (monocarboxylic acid transporters), member 6 [Source:MGI Symbol;Acc:MGI:2144585])

HSP 1 Score: 125.561 bits (314), Expect = 8.360e-30
Identity = 122/495 (24.65%), Postives = 217/495 (43.84%), Query Frame = 3
Query:  243 KSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPEL---YQIQNSMIFSKEAIDSVIKSG--FVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAE--MVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQ 1706
            ++N+   +PDGG+GW    + F       G+  SFG     LM+     + ++  I+WI ++ V       P++++L  +FG R+V M GG +     I    S   ++  YI  G+I+G+G    F+  +  +SQYFDK+R + T  A  G  F +F     + A+  +  W  ++  +  + L  +V   LLRP+  I     S +   L+P     Y ++N    ++ +IDS I SG    +S  N+ S  +       E++  +      +    P+     L E            + F C            Y L  L  +  +  P  Y+   +      +   A F++STM ++    R G G +    P RKI+I +I +++        TF   +   +  ++  G  +G++      +LAE  +V +++M+SA G+Y  I  I  L GPP AGL+ D  + Y   F+       ++A+ +  ++
Sbjct:   95 RANVYTQVPDGGWGWAVAVSFFFVEVFTYGIIKSFGVFFNDLMDSF---DESNSKISWIISICVFVLTFTAPLSTVLSNRFGHRLVVMAGGLLISLGMITASFSQ-RVYHMYISIGVISGLGYCFSFLPTVTILSQYFDKRRSVVTAVASTGECFAVFAFAPAITALKEHIGWRYSLLFVGLLQLNIMVCGALLRPII-IQGPGQSPKAVTLEPRREVQYMLENEK--TRTSIDS-IDSGVELTTSPKNVPSEAKMEQETRAEQQQTLVTAPKHSQMKAPLLDFSVLKE------------KSFIC------------YALFGLFATLGFFAPSLYIIP-LGISLGIDPDRAAFLLSTMAIAEVFGRIGAGFVLNREPIRKIYIELICVILLTASLFAFTFATEFWGLMLCSVFFGSMVGTIGGTHIPMLAEDDVVGIEKMSSAAGVYVFIQSISGLAGPPLAGLLVDQSKIYSRAFYSCAAGMCLAAVCLALVR 556          
BLAST of slc16a-17 vs. Ensembl Mouse
Match: Slc16a4 (solute carrier family 16 (monocarboxylic acid transporters), member 4 [Source:MGI Symbol;Acc:MGI:2385183])

HSP 1 Score: 114.775 bits (286), Expect = 1.351e-26
Identity = 118/491 (24.03%), Postives = 214/491 (43.58%), Query Frame = 3
Query:  270 DGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEEN-----LKPEL-YQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPV----CFRNSQXXXXXXXXXXXXXXYTLP-FYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIIS--ALVVVPI 1703
            DGG+GW  V   F+ +  + GM  +F     +  E     E  S  I WIG++  S     GP+A+++    G +  +++G F+    Y+I   +   I    +  G++ G+G   ++    + I++YF K+  LST  A  G G   F++    + ++  + W G + +   + L  +    LLRP+   S +++  + +       +PE  Y+ + S    KE  +  IK   +      T+    +G    E             +  P ++R  L    G   K+  +  + C + +     FRN   +++  S LL    Y +P F+ VA   T     + M A ++VS  G++ +V +  +G +A     +K   +   L++ G  N+++    T+ L + + I+     G  + L   +L ++     +    G      GI  L GPP AG I+D  Q Y   F+ SGT +I+S  +L  VP+
Sbjct:   16 DGGWGWMVVLHFFLVNVFVMGMTKTFAIFFVVFQE---EFEGTSEQIGWIGSIMSSLRFSAGPLAAIICDVLGEKATSILGTFLVSGGYVISSWA-TGIPFLCVTMGLLPGLGSAFLYQVAAVVITKYFKKRLGLSTAIARSGMGL-TFLLAPFTKFLIDLYDWTGALILFGAIILNLVPSSMLLRPIHSQSNNNSDIENKGSILSATEPEASYKTETSKC--KETQEPFIKDSTMKKSEQPTTTLTVLGNQSEE------------FSNRPHRNRPLLMSN-GKSHKKKFV-SWNCKQKLLDISLFRNPFFYIFTWSFLLSQLAYFIPTFHLVARAKT--LGIDVMDASYLVSVAGITETVSQLISGWIADQNWIKKYQYHKSYLILCGVTNLLAPLATTFPLLMAYTILFAIFAGGYLALILPVLVDLSKNSRVHKFLGYASFFAGIAVLSGPPIAGWIYDYTQTYTGSFYFSGTCYILSSVSLFFVPL 483          
BLAST of slc16a-17 vs. UniProt/SwissProt
Match: sp|Q8K1C7|MOT14_MOUSE (Monocarboxylate transporter 14 OS=Mus musculus OX=10090 GN=Slc16a14 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 5.874e-36
Identity = 134/526 (25.48%), Postives = 243/526 (46.20%), Query Frame = 3
Query:  192 FESMIDSTEDLEIVYYKKSNLRIIIP----DGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSM----IFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFL----GTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISA--LVVVP-IQWISGTR 1724
            + S  D   DLE    K  N + + P    DGG+ W  V ++F    LI G   + G +    +E+L     +     W+ +L +   L+ GP   +     G R  A+IGG ++   +++   +  N+   +I +G+  G+G GM ++  ++ + +YF K+R L+ G +  GTGFG F+M  L++ + + + W   +FI   +SL   V   L+RPL P  +++    EE      Y  ++      +   E  D   + G      +L + +      P  ++++   R L  V+ + +Q R          G R     YF    + F N     +   AL     + +PF ++   V+  Y+ ++    F +++  + + +  FG  +L  +A    I ++ + L+   T+ ++S FL     TY        ++G + G   +L  V+  ++V  + +A+A+G+     GI  L+GPPFAG IFDI Q YD  F++ G L+++    L++ P IQ I  +R
Sbjct:    2 YTSHEDIGYDLED-DRKAKNKKTLKPHPDIDGGWAWMMVLSSFFVHILIMGSQMALGVLN---VEWLEEFHQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAA-NVQSLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMFIQGALSLNLCVCGALMRPLSPEKLENCPEAEEPCALPAYSTESVKSGGPLGMAEEQDR--RPGNEEMVCDLQTQECQGQTHP--RKNVCAFRVLKTVSQLTVQVRR---------GFRDWHSGYFGTASL-FTNRMFVAFIFWALFAYSSFVIPFIHLPEIVS-LYNLSEQNDTFPLTS--IIAILHIFGKVILGAVADLPCISVWNVFLIANFTL-VLSIFLLPLMHTYASLAVICALIGFSSG-YFSLMPVVTEDLVGTEHLANAYGIIICANGISALLGPPFAGWIFDITQKYDFSFYICGLLYMVGILFLLIQPCIQMIDQSR 503          
BLAST of slc16a-17 vs. UniProt/SwissProt
Match: sp|Q7RTX9|MOT14_HUMAN (Monocarboxylate transporter 14 OS=Homo sapiens OX=9606 GN=SLC16A14 PE=2 SV=1)

HSP 1 Score: 140.198 bits (352), Expect = 3.219e-34
Identity = 118/479 (24.63%), Postives = 228/479 (47.60%), Query Frame = 3
Query:  270 DGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPI--EKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTF----LGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            DGG+ W  V ++F    LI G   + G +    +E+L     +     W+ +L +   L+ GP   +     G R  A+IGG ++   +++   +  N+   +I +G+  G+G GM ++  ++ + +YF K+R L+ G +  GTGFG F+M  L++ + + + W   + I   +SL   V   L+RPL P   + N   E++++        S+  + +   +  K G + +   L  + +A   P     ++++  +R L  V+ + ++ R+  ++             YF    + F N     +   AL     + +PF ++   V   Y+ ++    F +++  + + V  FG  +L  +A    I ++ + LL   T+ ++S F    + TY        ++G + G   +L  V+  ++V ++ +A+A+G+     GI  L+GPPFAG I+DI Q YD  F++ G L++I  L
Sbjct:   29 DGGWAWMMVLSSFFVHILIMGSQMALGVLN---VEWLEEFHQSRGLTAWVSSLSMGITLIVGPFIGLFINTCGCRQTAIIGGLVNSLGWVLSAYAA-NVHYLFITFGVAAGLGSGMAYLPAVVMVGRYFQKRRALAQGLSTTGTGFGTFLMTVLLKYLCAEYGWRNAMLIQGAVSLNLCVCGALMRPLSP-GKNPNDPGEKDVRGLPAHSTESVKSTGQQGRTEEKDGGLGNEETLCDL-QAQECPDQAGHRKNMCALRILKTVSWLTMRVRKGFEDWYS---------GYFGTASL-FTNRMFVAFIFWALFAYSSFVIPFIHLPEIV-NLYNLSEQNDVFPLTS--IIAIVHIFGKVILGVIADLPCISVWNVFLLANFTL-VLSIFILPLMHTYAGLAVICALIGFSSG-YFSLMPVVTEDLVGIEHLANAYGIIICANGISALLGPPFAGWIYDITQKYDFSFYICGLLYMIGIL 486          
BLAST of slc16a-17 vs. UniProt/SwissProt
Match: sp|Q7TM99|MOT9_MOUSE (Monocarboxylate transporter 9 OS=Mus musculus OX=10090 GN=Slc16a9 PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 9.304e-34
Identity = 111/487 (22.79%), Postives = 214/487 (43.94%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVD-SNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINL--------TSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGF-IVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVV 1697
            PDGG+GW  V  +F    L  G   + G    L +E+L           W+G+L     LL  P+ S+    FG R V +  GF+     ++  L+P NI+  +  YGI+ G+G G+++ A +    QYFD +R L+ G    G+  G+F+  +L + ++ ++   G + I+  ++L  +    L+RPL             EN+ P+ Y + N    + E   +    G+ S    L        TS+ +++ +    KE   Y + ++  T    Q  +          ++  +++ +C        +++F     A+L       P   +   V   Y   +      ++S  G+ ++V +   G+LA       +++Y+  L++ G       F  +Y+     + I+G   G+  ++   +  + V +D++A A+G+     G+G  +GPP  G  +D  Q YD+ F+ SG   ++   +++
Sbjct:    7 PDGGWGWVIVVVSFFTQFLSYGSPLAVGV---LYVEWLDAFGEGKGKTAWVGSLASGVGLLASPVCSLFVSSFGARPVTIFSGFLVAGGLMLSSLAP-NIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDSRRGLALGLISTGSSVGLFIYAALQRMLIEFYGLDGCLLIVGALALNILACGSLMRPLQTSDCPFPEKTAPENV-PDRYSMYNEKEKNPEETMNFQDKGYSSEDKCLPNGDWGRETSLPKSLAIAAHTKEPETYKKKVVEQTNFCKQLAK----------RKWQLYRNYCGETASLFKNKVFSALFIAILLFDIGGFPPSLLMEDVARSYHVREEDLTMPLISIFGIMTAVGKLLLGILADFKWINTLYLYVATLIITGLALCAIPFAKSYVTLAILSGILGFLTGN-WSIFPYVTTKTVGIDKLAHAYGILMFFAGLGNSLGPPIVGWFYDWTQTYDIAFYFSGFCVLLGGFILL 477          
BLAST of slc16a-17 vs. UniProt/SwissProt
Match: sp|Q7RTY1|MOT9_HUMAN (Monocarboxylate transporter 9 OS=Homo sapiens OX=9606 GN=SLC16A9 PE=1 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 8.286e-33
Identity = 110/485 (22.68%), Postives = 218/485 (44.95%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVD-SNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETI----GPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFI---VSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVV 1697
            PDGG+GW  VF +F+   L  G   + G    L +E+L           W+G+L     LL  P+ S+    FG R V +  GF+     ++   +P NI+  +  YGI+ G+G G+++ A +    QYFD +R L+ G    G+  G+F+  +L + +V ++   G + I+  ++L  +    L+RPL             E+L P+ Y I N    + E   +++   + S        +  +     +++ +++    +  T  P  +++ + E          ++  +++ +C   V    +++F     A+L       P   +   V    S N     FI   +S +G+ ++V +   G+LA       +++Y+  L++ G       F  +Y+     + I+G   G+  ++   +  + V ++++A A+G+     G+G  +GPP  G  +D  Q YD+ F+ SG   ++   +++
Sbjct:    7 PDGGWGWVIVFVSFLTQFLCYGSPLAVGV---LYIEWLDAFGEGKGKTAWVGSLASGVGLLASPVCSLCVSSFGARPVTIFSGFMVAGGLMLSSFAP-NIYFLFFSYGIVVGLGCGLLYTATVTITCQYFDDRRGLALGLISTGSSVGLFIYAALQRMLVEFYGLDGCLLIVGALALNILACGSLMRPLQSSDCPLPKKIAPEDL-PDKYSIYNEKGKNLEENINILDKSYSSE----EKCRITLANGDWKQDSLLHKNPTVTHTKEPETYKKKVAEQTYFCKQLAKRKWQLYKNYCGETVALFKNKVFSALFIAILLFDIGGFPPSLLMEDVAR--SSNVKEEEFIMPLISIIGIMTAVGKLLLGILADFKWINTLYLYVATLIIMGLALCAIPFAKSYVTLALLSGILGFLTGN-WSIFPYVTTKTVGIEKLAHAYGILMFFAGLGNSLGPPIVGWFYDWTQTYDIAFYFSGFCVLLGGFILL 479          
BLAST of slc16a-17 vs. UniProt/SwissProt
Match: sp|Q5ZJU0|MOT9_CHICK (Monocarboxylate transporter 9 OS=Gallus gallus OX=9031 GN=SLC16A9 PE=2 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.146e-32
Identity = 120/477 (25.16%), Postives = 225/477 (47.17%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEE--NLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIM--YIRSLMNVTGVPIQHRESLDET--IGPVGKR-LHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQM-YAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESV---ILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSG 1664
            PDGG+GW  V  +F    L  G   + G    L +E+L           W+G+L     LL  P+ S+    FG R VA+  GF+     ++   +P NI+  Y+ YGI+ G+G G+++ A +    QYFDK+R L+ G    G+  G+F+  +L + ++  +   G + I+  +SL  +    L+RPL+  S DS S ++   +  P+ Y + +    + E   S+++ G++         K A  VP  ++++I+   + S +NV       ++ +++T     + KR   ++  +    V    +++F     A+L       P   +   +    + N+  Y   +VS +G+ +++ +   G+LA       +++Y++ LLM G   +   F  +Y    F   ++ G LG +    S+   +  + V ++++  A+G+     G+G  +GPP  G  +D  Q YD  F+ SG
Sbjct:    7 PDGGWGWVIVIVSFFTQFLCYGSPLAVGV---LYLEWLDAFGEGKGKTAWVGSLANGIGLLASPVCSICVSSFGARPVAIFSGFMVAGGLMMSSFAP-NIYFLYLSYGIVVGLGCGLLYNATVTITCQYFDKRRGLALGLISTGSSVGLFIYAALQRELIELYGLDGCLLIVGALSLNILACGSLMRPLE--SSDSPSPEKACTDKVPDQYFVYHEKEKTVEENISILEKGYIDE-------KCANNVPDYKQDNILNKNVLSSINVDEKDTYKKKVVEQTNFCKQLAKRKWQLYLNYWEETVVLFKNRVFSALFFAILLFDIGGFPPSLLMEDIARSANINEEDYHMPLVSIIGIMTAIGKLILGILADFKWVNTLYLYVLTLLMMGAALLAIPFARSY----FTLAVLSGILGFLTGNWSIFPYVTTKTVGIEKLTHAYGILMFFAGLGNSLGPPIVGWFYDWTQEYDTAFYFSG 466          
BLAST of slc16a-17 vs. TrEMBL
Match: A0A0H3YFA0 (Slc16a-17 OS=Schmidtea mediterranea OX=79327 GN=slc16a-17 PE=2 SV=1)

HSP 1 Score: 993.03 bits (2566), Expect = 0.000e+0
Identity = 508/508 (100.00%), Postives = 508/508 (100.00%), Query Frame = 3
Query:  201 MIDSTEDLEIVYYKKSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWISGTR 1724
            MIDSTEDLEIVYYKKSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQLFLYYLSALLFSCCYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWISGTR
Sbjct:    1 MIDSTEDLEIVYYKKSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQLFLYYLSALLFSCCYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWISGTR 508          
BLAST of slc16a-17 vs. TrEMBL
Match: A0A0P5NVA3 (Monocarboxylate transporter OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 1.036e-56
Identity = 148/554 (26.71%), Postives = 267/554 (48.19%), Query Frame = 3
Query:  255 RIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPI---SVDSNSCQEE-----NLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMG--------------------------------------VPPIEKEDIMYIRSLMNVTGVPIQHRE--------------SLDETIGPVGKRLHIFQYFCCRPVC-------FRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWIS 1715
             I+ PDGG+GW  + A+F  + ++DG+ FSFG +   L E     E     ++W+ +L   F LL GP  S L  +FGFR+VA  G  ++  S+ +  L+  ++   Y+F G++ G+G+G+V++  ++ +  YF+K+R L+TG AVCG+G G FV+      ++ Y+ W GT+ I  G+ L   +F  + RPL+P    SV      EE      L   + + ++  + S E  ++     F SS  +L +  + +G                                      V P+ ++D  Y  SL  +     Q+RE              ++DE  G  GK+       C R V        F+++   L   S+ +    + +PF ++A+   E+   ++  A F++S +GV+++V R   G L+       +++   AL + G + I + F   Y + I +A + G ++    +L S+++ E++ L+ + +AFGL  M  G+   +G P A + FD   +YD  F++SG++ +IS ++  P+ +I+
Sbjct:   28 HIVPPDGGWGWVVMIASFFCNIIVDGIIFSFGLVVTNLAESF---EVPVSTVSWVASLLAGFYLLAGPFVSSLATRFGFRLVACAGSVVAGLSFAVASLAM-SVEFLYVFIGVLGGIGMGLVYVPAVVAVGFYFEKRRALATGIAVCGSGIGTFVLAPFTTWLLGYYGWRGTLLIHGGLVLNCAIFGAMFRPLEPAKKKSVRRQLADEEVSAGTPLMVRIKKERDEKLRSDERQETTQTDHFHSSTNSLNNTVKLVGIKSKRSSTLTDSSASLGKKETPLLAAGGSKRSLANQDDVRPLNRDDAFYTGSLQRLP----QYRENPASYHASVTRIPDAVDEADG--GKK----SSRCMRAVSSLIQFSLFKSATFDLLCFSSFITFLGFFVPFMFLAARA-EQLGADKESASFLLSIIGVTNTVGRVVCGALSDHPKVNVLFVNNAALTLGGVVTIATPFFPAYEMLIVYACLFGLSIACFASLRSILMVELLGLENLTNAFGLCLMFTGVSATVGGPLASMFFDATNDYDASFYLSGSMILISGILCYPLGYIN 566          
BLAST of slc16a-17 vs. TrEMBL
Match: A0A0P5XZD6 (Monocarboxylate transporter OS=Daphnia magna OX=35525 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 1.889e-56
Identity = 148/555 (26.67%), Postives = 269/555 (48.47%), Query Frame = 3
Query:  255 RIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLP-PMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPI---SVDSNSCQEE-----NLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMG--------------------------------------VPPIEKEDIMYIRSLMNVTGVPIQHRE--------------SLDETIGPVGKRLHIFQYFCCRPVC-------FRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWIS 1715
             I+ PDGG+GW  + A+F  + ++DG+ FSFG +   L E    P+ +    ++W+ +L   F LL GP  S L  +FGFR+VA  G  ++  S+ +  L+  ++   Y+F G++ G+G+G+V++  ++ +  YF+K+R L+TG AVCG+G G FV+      ++ Y+ W GT+ I  G+ L   +F  + RPL+P    SV      EE      L   + + ++  + S E  ++     F SS  +L +  + +G                                      V P+ ++D  Y  SL  +     Q+RE              ++DE  G  GK+       C R V        F+++   L   S+ +    + +PF ++A+   E+   ++  A F++S +GV+++V R   G L+       +++   AL + G + I + F   Y + I +A + G ++    +L S+++ E++ L+ + +AFGL  M  G+   +G P A + FD   +YD  F++SG++ +IS ++  P+ +I+
Sbjct:   28 HIVPPDGGWGWVVMIASFFCNIIVDGIIFSFGLVVTNLAESFDVPVST----VSWVASLLAGFYLLAGPFVSSLATRFGFRLVACAGSVVAGLSFAVASLAM-SVEFLYVFIGVLGGIGMGLVYVPAVVAVGFYFEKRRALATGIAVCGSGIGTFVLAPFTTWLLGYYGWRGTLLIHGGLVLNCAIFGAMFRPLEPAKKKSVRRQLADEEVSAGTPLMVRIKKERDEKLRSDERQETTQTDHFHSSTNSLNNTVKLVGIKSKRSSTLTDSSASLGKKETPLLAAGGSKRSLANQDDVRPLNRDDAFYTGSLQRLP----QYRENPASYHASVTRIPDAVDEADG--GKK----SSRCMRAVSSLIQFSLFKSATFDLLCFSSFITFLGFFVPFMFLAARA-EQLGADKESASFLLSIIGVTNTVGRVVCGALSDHPKVNVLFVNNAALTLGGVVTIATPFFPAYEMLIVYACLFGLSIACFASLRSILMVELLGLENLTNAFGLCLMFTGVSATVGGPLASMFFDATNDYDASFYLSGSMILISGILCYPLGYIN 566          
BLAST of slc16a-17 vs. TrEMBL
Match: A0A1S3I6K6 (monocarboxylate transporter 12 OS=Lingula unguis OX=7574 GN=LOC106161430 PE=4 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 2.388e-56
Identity = 154/590 (26.10%), Postives = 282/590 (47.80%), Query Frame = 3
Query:  153 LKQCIYHAIISIQFESMIDSTEDLEIVYYKKSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQ---EENLKPELYQI------------------QNSMIFSKEAI-------------------DSVIKSGFV----SSFINLTSMKEAMGVPP----IEKEDIMYIRSLMNV------------TGVPIQHRESLDETIGPVGKRLHIFQYFC--CRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISA--LVVVP--IQWISGTR 1724
            ++Q   +  +++      DS  D E     + +L II PDGG+GW  VF++F+   L DG+ +SFG      +E+L   + +     W+G+L     LL GP+AS    K+G RV  + G  ++   +I+   SP N+++ Y  +GI+ G+G G++++  ++++  YF+K+R  +TG AVCG+G G F+       +V  + W G + I AG+ L  I+   + RPL          +   E+ L+ +L +I                  Q  ++ S+                      +S I+SG V        ++      +G  P    ++++D++Y+ SL N+            + + I H     ET  PVG    +   F         ++    ++ +S  L S  +  PF Y+     ++  +++  A +++S +G+ ++V R   G+++      ++W+Y I L + G   + S+F+ +Y L + +A   G  +G+ + L SVIL +++ L+ + S+FGL  M  GI  LIGPP  G +FD   +YD+ F+++G++  +S   L V+P   +W    R
Sbjct:    1 MEQEQKNTAVNVATVDTNDSKVDQEDAEVDRDDL-IIPPDGGWGWVVVFSSFLIHILADGIVYSFGI---FYVEFLEDFKGSKGETAWVGSLVPGITLLTGPVASAFTSKYGCRVTTIAGAALAAVGFIVSIFSP-NLYMLYFTFGIVGGLGFGLIYLPAIVSVGFYFEKRRAFATGLAVCGSGLGTFIFAPFSTELVHEYGWRGAVLIQAGLILNCILCGAVFRPLYSAREQREMREARIEKRLRKKLGKIDKDGDVKAATVKNGQGSAQKPLLRSRSTASESHTVTVQTPLPPSMIKSESDIRSGNVIVEDPRSPSVVRSLSHLGFKPHHTVMQRKDVLYVGSLRNIPLYRSNVSVYQASVLSIPHVVPPSETDEPVGFCTQMKDSFLEMMDFTLLKDWVFIIFAISNFLTSIGFNAPFIYIPDRALQE-GYDEHSAAWLLSGVGIGNTVGRIVFGLMSDWKWVNRLWLYNITLTICGVATVFSSFMKSYPLMMVYACTFGCFIGAYVGLTSVILVDLLGLERLTSSFGLVLMFQGIATLIGPPIVGWVFDGTNSYDIAFYITGSMVALSGMMLFVIPQVQRWQDKKR 584          
BLAST of slc16a-17 vs. TrEMBL
Match: R7VHW0 (MFS domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_171191 PE=4 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 1.070e-54
Identity = 133/498 (26.71%), Postives = 252/498 (50.60%), Query Frame = 3
Query:  270 DGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSN----------SCQEENL---KPELYQIQNSMIFSK------EAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQ 1706
            DGG+GW  +FA+F+NS ++DG+ FSFG      +EYL   +       WIG++     ++ GPIA  L  KFG R V ++G   S  ++     SP NI +  + YG++ GMG G++++  ++ +  YFDK+R  +TG A CG+G G FV   L Q ++  ++W G  +I+AG+ L  ++   + RPL     D +          S +EEN+   +P++   + + + SK      + I +V  S  +S   +   + E++    +  +    + S M+V          + +    V K + +           +N    +Y +S +L    + +PF Y+     E   +++ +A  ++S +G++++V R   G ++       + I  +AL++ G   +   FL  Y + + +A + G  + + ++L SVIL +++ +  + S+FG+  M  GI   +G P AG +FD+  +Y++ F+V+G    ++ L+ +P++
Sbjct:    6 DGGWGWIVLFASFLNSVILDGVCFSFGI---FFLEYLDHFQENKGKTAWIGSVLNGTYMIMGPIAGALANKFGCRPVTIVGSIWSTIAFFASTYSP-NINVLILTYGVLGGMGFGLMYLPAIVIVGFYFDKRRAFATGIATCGSGIGAFVFAPLCQVLIQTYAWRGAQWIIAGLVLNGVIIGAVFRPLTHAESDRHHGRTRKLTVCSYEEENVIYTRPDVTASKAAEVLSKAPTPNEDHISAVASSHNLSVISSCEHLHESLPSNTLHTKSNNKVDSCMHV----------IKDLFKEVSKSMDV--------SVLKNPVFVVYGVSCILCMKGFFVPFIYLVDKAVET-GYSKTHAAMLLSMLGITNTVGRVVAGWVSDRPWADCLLINNVALIVGGLSTMAVPFLDEYWMLVAYATVFGLCIAAFVSLRSVILVDLIGIQRLTSSFGILVMCQGISSFVGAPIAGSLFDLTGSYNVSFFVAGVSIALAGLICLPLR 480          
BLAST of slc16a-17 vs. Ensembl Cavefish
Match: slc16a4 (solute carrier family 16 member 4 [Source:ZFIN;Acc:ZDB-GENE-070112-602])

HSP 1 Score: 138.272 bits (347), Expect = 2.462e-34
Identity = 123/497 (24.75%), Postives = 232/497 (46.68%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFG-FIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGI-FVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLD--PISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKE--AMGVPPIEKEDIM-YIRSLMN------VTGVPIQHRES-----LDETIGPVGKRLHIFQ-----YFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            PDGG+GW  V   F+ + L+ G   SFG F   L  E+    ES    I+WIG++  S  L  GP+AS+   K G RV +++G  +    ++I   +   +++ YI  G++ G+G  +++ A  +  + YF K+  L+T  ++  +G G+ F +    Q ++  ++W G + IL  + L  +    LLRP+   P  V S        K E   +QN +  +    + V K+    SF   T + E  ++G   ++  ++   +++ +N      V   P  + +S     L E   P   ++  F      +FC        SQ              Y +P++++ +        + M A FI+S  G++ ++ +  +G +A      K   +   L++ G +N++S    +Y+L + +A+      G  + L   +L ++V  D++ ++ G      G+G L GPP AG ++D  Q YD  F+++G  +++S++
Sbjct:   34 PDGGWGWMVVLHCFLVNVLVMGTLKSFGIFFVALQDEFGGSAES----ISWIGSIMSSLRLSGGPLASVACAKLGNRVTSIMGALLVSAGFLISIFATSVVYL-YISMGLVVGLGFALLYQATSVVTATYFRKR--LATAYSIGRSGMGLTFALAPFTQLLLDQYAWQGALLILGALMLNLVASGMLLRPIHVRPAVVSS---PPPGTKKE--PLQNGLNVTAAVSNGVAKTDSSPSFHTETLIIENPSLGQKSLQATELTSLVQNGVNGLDTGPVKVYPETNGKSVVDSLLHEKTPPKKAKVLDFSLLKNPFFCIYTWSLVFSQ------------LAYFIPYFHLTARA-RNLGIDPMDASFIISVAGITETMAQLASGWVADRNLVHKYHYHKAYLILCGVVNLLSPLATSYILLMVYAVFFAIFCGGYMALLLPVLVDLVGSDKLNNSMGFSMFFVGLGCLTGPPLAGFLYDYTQTYDCSFYLAGVCYLLSSV 505          
BLAST of slc16a-17 vs. Ensembl Cavefish
Match: slc16a6b (monocarboxylate transporter 7-like [Source:NCBI gene;Acc:103045885])

HSP 1 Score: 126.331 bits (316), Expect = 2.973e-30
Identity = 127/507 (25.05%), Postives = 211/507 (41.62%), Query Frame = 3
Query:  246 SNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPE--------LYQIQNSMI-FSKEAIDSVIKSGFVSSFINLTSMKEAMGVPP---IEKEDIMYIRSL--------------------MNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAE--MVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSG 1664
            +N+   IPDGG+GW    A F       G+   FG     LM +    E  +  ++WI ++ V       P++++L  +FG R V M GG +     I    +  +I   YI  G+++G+G  + F+  +  +SQYF+K+R L T  A  G  F +F +   +  + ++  W   + ++  M    I F  LLRP+  I    +S +EE   P+         Y+ +N +   S  ++DS ++S   SS  NL     A G  P   + K+D +    L                          P + +E  +E +    K L       C  +C+                  +    Y +  +V+     NQ  A +++STM V+    R   G +    P RKI+I +I  ++   +  + T +  +          G   G+V +    +LAE  +V +D M+SA G+Y  I     L GPP AG + D  +NY   F+ S 
Sbjct:   14 ANVYPQIPDGGWGWAVAVAFFFTEVFTYGIIKIFGIFLQDLMSHF---EETNSRVSWIVSICVFVMTFTAPLSTVLSNRFGCRPVVMFGGLLISLGTISTAFTH-SINQMYITVGLVSGLGYCLTFLPTVTILSQYFNKRRSLVTSVASTGECFSLFALTPALSILKAHVGWRNCLVVIGLMQASLIAFGALLRPII-IQPKLSSPEEEKEGPQSPLKKAETKYEQENELTRTSYSSVDSGVQS-ISSSKTNL-----AEGQSPNRSVTKQDSVQTAKLDIQEQKEVQEEEEFEHPVLPSTPLQQPTKQQEKKEEPVVAQPKLLDFSVLRDCSFICY-------SLFGLFATLGFFAPQLYIIDLSVSCGLERNQ--ATYMLSTMAVAEIFGRLSIGWILNRRPVRKIYILLICTMLLSLVLALFTAVSEFWGLACCCAAFGFLFGTVGSTHIPMLAEDDVVGIDRMSSAVGVYVFIQSFAGLAGPPLAGALVDFTKNYGSAFYTSA 500          
BLAST of slc16a-17 vs. Ensembl Cavefish
Match: ENSAMXT00000010927.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002229.1:6659:13971:1 gene:ENSAMXG00000010636.2 transcript:ENSAMXT00000010927.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 118.627 bits (296), Expect = 3.402e-28
Identity = 118/477 (24.74%), Postives = 198/477 (41.51%), Query Frame = 3
Query:  243 KSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGF-ISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAE--MVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSG 1664
             +N+   IPDGG+GW    A F       G+   FG     LM +    E  +  ++WI ++ V       P++++L  +FG R V M GG  IS  +    F    N    YI  G+++G+G  + F+  +  +SQYF+K+R L T  A  G  F +F +   +  + ++  W   + ++  M    I F  LLRP+  I    +S +EE         +   + SK ++DS ++S        ++S K  +   P+  +  +   S++            L  T+G    +L+I                                       +V+     NQ  A +++STM V+    R   G +    P RKI+I +I  ++   +  + T +  +          G   G+V +    +LAE  +V +D M+SA G+Y  I     L GPP AG + D  +NY   F+ S 
Sbjct:   13 SANVYPQIPDGGWGWAVAVAFFFTEVFTYGIIKIFGIFLQDLMSHF---EETNSRVSWIVSICVFVMTFTAPLSTVLSNRFGCRPVVMFGGLLISLGTISTAFTHSINQ--MYITVGLVSGLGYCLTFLPTVTILSQYFNKRRSLVTSVASTGECFSLFALTPALSILKAHVGWRNCLVVIGLMQASLIAFGALLRPII-IQPKLSSPEEEK--------EGRSLPSKSSVDSGVQS--------ISSSKTNLKEEPVVAQPKLLDFSVLRDCSFICYSLFGLFATLGFFAPQLYIIDL------------------------------------SVSCGLERNQ--ATYMLSTMAVAEIFGRLSIGWILNRRPVRKIYILLICTMLLSLVLALFTAVSEFWGLACCCAAFGFLFGTVGSTHIPMLAEDDVVGIDRMSSAVGVYVFIQSFAGLAGPPLAGALVDFTKNYGSAFYTSA 429          
BLAST of slc16a-17 vs. Ensembl Cavefish
Match: slc16a5a (solute carrier family 16 member 5 [Source:NCBI gene;Acc:103035800])

HSP 1 Score: 118.242 bits (295), Expect = 6.653e-28
Identity = 113/487 (23.20%), Postives = 203/487 (41.68%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAI-NWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLA--PDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL-VVVPIQWIS 1715
            PDGG+GW       ++S ++  +  +F     +    L     AS ++ +W+ ++  +     GP+ S+L ++FG R   ++GG +S         +  +I   YI  G+I G+G    F   +  + QYF ++R  +   +  GT  G+  + +L   + + F W G+  IL GM L   V   L+RPL P             KP+ +         K+  +   K+G                     KE++  + S +                     +R   F  FC       N +  ++ L        + +P  ++    T+    +Q  A  +++ +G  + + R   G+L  LA    R I++  +ALL+ G  N I  F  T+ + + + +  G T+  V TL   +L ++V ++   SA GL  ++  +  LIGPP AGL+ D    Y  ++  S    + SAL ++V   W+ 
Sbjct:   39 PDGGWGW----VILVSSIVVLALTLAFPSCMSIFYTDLQKQFHASNSVTSWVPSIMTAVLHAGGPLCSVLVERFGCRATVIMGGVLSGIGMAASAFTN-SIVELYITAGVITGLGFCFSFQPAVTILGQYFVRRRVFANAMSSTGTALGLSTLPTLSNYLHTEFGWRGSFLILGGMLLNCCVCGALMRPLGPS------------KPKAH---------KQKANGPTKTG---------------------KENLKLLASCI---------------------RRHMAFDQFC------NNQRYRVFSLGVTWMMLGFVVPLIFLVPFATDN-GMDQNKAALLLNVLGFVNIIVRPAFGLLFNLAWFKGRHIYVLSVALLLNGLSNCICCFSATFPVLLVYMLCYGLTMSVVGTLLFTVLMDIVEMNRFLSALGLLAIMESVTLLIGPPLAGLLVDKTGEYTYVYLASSITVVTSALFLLVSFYWLD 450          
BLAST of slc16a-17 vs. Ensembl Cavefish
Match: slc16a7 (monocarboxylate transporter 2-like [Source:NCBI gene;Acc:103047734])

HSP 1 Score: 117.472 bits (293), Expect = 1.457e-27
Identity = 115/486 (23.66%), Postives = 204/486 (41.98%), Query Frame = 3
Query:  246 SNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFA---INWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLA--PDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            +NL    PDGG+GW  VF +F++      + FS+ F + L + +    E  S +   I W+ ++ ++     GP++S+L  ++G R V M+GG +     +        I   YI  G+I G+GL       L  I +YF  KRP++ G A+ G+   +  +  L Q +   F W G+ FIL  + L   V   L+RP++              KP + Q       + E  +   +       + L S K+     P        +   ++++    +HR  L   +  VG     F +F   PV F                        Y      ++YS     A F++S   +   V R GTG++A       R  + +  +++  G  +++   L  Y   + +A++ G   G V  L   +L ++V     +SA GL  +I     L+GPP +G + D+F +Y  +++  G + ++  +
Sbjct:    7 TNLGYTPPDGGWGWAVVFGSFIS------IGFSYAFPKSLTIYFKEIQEYFSISYSEIAWVSSIMLATMYAGGPVSSILVNRYGSRPVVMVGGLLVGVGMVAASFGT-TIMHLYICVGVIGGIGLAFNLQPALTIIGKYFHVKRPIANGLAMAGSPVFLSTLAPLNQFLFDTFGWQGSFFILGAIVLNCCVAGALMRPIN-----------VKAKPAVSQSSGGDRSAGEVGEG--EGDVDPQAVGLVSEKQQ----PKRGGCAARVNQFIDLS--LFKHRGYLIYLVANVG---MFFGFFA--PVVFLAP---------------------YAKHQGIDEYS-----AAFLLSIFALVDMVARPGTGLVANTKWIRPRIQYFFSFSVMYNGVCHLMLPMLPGYTGLVVYAVVFGLAFGMVCALLFEVLMDLVGAQRFSSAVGLATIIECCPVLLGPPISGALVDVFMDYKYMYYACGVMMLVPGI 435          
BLAST of slc16a-17 vs. Ensembl Sea Lamprey
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 138.272 bits (347), Expect = 3.686e-35
Identity = 120/509 (23.58%), Postives = 218/509 (42.83%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPL-----------------------DPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQ---------HRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKI--WIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALV 1691
            PDGG+GW  V A F+ +     +      I    ME+    +       WI ++     +LC PI S+L   FG R   M GG  S   +I+   +  +I + Y+F G+  G G  + +   ++ +++YF ++R L+TG A+ G+G G F++  L+Q ++  FSW G + +L        V   LLRP+                         +     + Q E  +P    +  + + S+ +   V      +   N  +  +A  VPP+ + D       + + G P +          R +    +   GK    + +   R       +  +++ S +L +   + PF Y+     + +      A  ++S +G+         G L      RK     Y++A+ + G  +++   + ++ L + +A++ G   G+ +TL SV+ A++V    ++SA GL   +  + +LI PP AG + DI   Y   F VSG   I+SAL+
Sbjct:    6 PDGGWGWMVVLACFIVNVCTRAVTRC---ISIFFMEFQSHFQKDYATTAWINSMVDCLTMLCAPIGSLLSSHFGCRATVMAGGLFSSAGFIMASFAT-SIEMLYVFLGVFAGFGFSLCYSPSIVMVTKYFRRRRALATGLAMSGSGVGTFLLAPLVQYLLDVFSWRGALLLLGAFVSNLCVCGALLRPIHLQYSCYAMRITLVGKTDGSVGHSTLGGTKKNAQGEKKRPMAVTLTTAPLTSRHSPGRV-----GTERANGNNGTDARAVPPVFRTDPGMEAWTVAMAGPPDRGCSAGAGACARGAWGRLVNAAGKLRRNYGFVVQR-------EFVVFWASVMLMAYGCSTPFVYLVP-YAQSHGVPPGMAALLLSVLGIVDIAGNISYGWLTDRPSVRKHRGLFYMVAVGLEGVWSLLLPLMASFPLLMVYAVLYGYFDGAYVTLISVVTADLVGPVHVSSAVGLVFFMHAVPYLIAPPVAGWLVDITGTYTAAFLVSGMAMILSALL 497          
BLAST of slc16a-17 vs. Ensembl Sea Lamprey
Match: zgc:165507 (solute carrier family 16 member 7 [Source:HGNC Symbol;Acc:HGNC:10928])

HSP 1 Score: 115.546 bits (288), Expect = 1.053e-27
Identity = 123/484 (25.41%), Postives = 198/484 (40.91%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPME---SASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDS--NSCQEE---NLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDR-KI-WIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            PDGG+GW  V  AF++      + FS+ F + + + +    E   +    I WI ++ ++     GPI+S+L  K+G R + + GG ++    I        I+  Y   G+I G+GL       L  I +YF KKRP++ G ++ G+  G+  +  L Q +++ F W G+  ILA +     V   L+RP+ P          +EE   NL+  L    NS     EA D    S F S F+ L  +                            +HR  L    G V   +  F +F   PV F                        Y      E YS     A F++S M     V R  TG+LA     R KI + +  A+   G  +++  F   Y   + +A   G   G V  +    L ++V     +SA GL  ++     L+GPP  G + D+  +Y  +++V G + +++ +
Sbjct:   14 PDGGWGWAVVVGAFIS------IGFSYAFPKAITVFFKDIQEIFHTTYSEIAWISSIMLAVMYAGGPISSILVNKYGSRPIVIAGGILAGTGMIAASFCN-TIFQLYFCIGVIGGLGLAFNLQPALTIIGKYFYKKRPIANGISMAGSPVGLSTIAPLNQVLINNFGWRGSFLILAALLFNCCVAGSLMRPVGPTPAKDARKKGKEEVPNNLENPLLATSNS-----EAKDKNGDS-FSSRFMQLLDLTL-------------------------FKHRGFLIYLSGNV---IMFFGFFA--PVVFLAP---------------------YAKHMGIENYS-----AAFLLSVMAFVDMVARPTTGLLANHPRIRPKIQYFFSFAVFFNGFCHVMCPFASDYTGLVIYAAFFGMAFGMVSAMLFETLMDLVGAQRFSSAVGLVTIVECCPVLLGPPIGGWLVDVTGDYKYMYYVCGAIVMVAGI 428          
BLAST of slc16a-17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001631.1 (pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 gene:ENSPMAG00000001470.1 transcript:ENSPMAT00000001631.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 114.005 bits (284), Expect = 2.332e-27
Identity = 73/208 (35.10%), Postives = 109/208 (52.40%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPL----DPISVDSNSCQEENL 878
            PDGG+GW  V AAF+  +L+ G+  S G      +E+    + +S AI+WI ++ +       PIAS L  +FG R V ++GG IS C   +C      +   Y+  G++ G G  MVF   + T+S+YFDK+R L+ G A  G G   F    L Q +V  ++W G + ILAG+ L   V   LLRP+    D +    N+ +  +L
Sbjct:    8 PDGGWGWLIVLAAFVQVSLVFGVVRSVGV---FFIEFTEYFQESSTAISWITSIALCVHQFASPIASTLSNQFGSRSVVIVGG-ISACIGFLCASFAHCLLHLYLSLGLLTGFGWAMVFSPSISTLSKYFDKRRSLALGIAFSGVGMSSFAFSPLFQMLVETYTWRGALMILAGLELNLCVCGALLRPIRLREDDLFQTENAAKHRSL 211          

HSP 2 Score: 56.225 bits (134), Expect = 1.194e-8
Identity = 41/158 (25.95%), Postives = 80/158 (50.63%), Query Frame = 3
Query: 1221 LPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVV 1694
            +P+ ++ + + +   F+ +   F++S + V+  V R  +G LA L     + ++    L  G + +I  F  TY   I   I+ G   G++  +   +L+++V +  + SA G   ++  +G L+GPP +G + D   +Y M F  SG + I+  LV+
Sbjct:  247 IPYVHLLAHL-QMLGFSSLSGAFVISAVAVADIVARLFSGWLADLRRIPMVHLFFFWTLTTGIIIVIIPFGQTYTDMIVIGIVYGFASGAMAPIGVSLLSKIVGIARITSAIGFLMLLESVGSLLGPPISGFLKDYTGDYTMSFIASGLVIILGCLVL 403          
BLAST of slc16a-17 vs. Ensembl Sea Lamprey
Match: SLC16A12 (solute carrier family 16 member 12 [Source:HGNC Symbol;Acc:HGNC:23094])

HSP 1 Score: 112.079 bits (279), Expect = 8.485e-27
Identity = 117/480 (24.38%), Postives = 199/480 (41.46%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQA-IVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDR------KIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISA 1685
            PDGG+GW  V + F  +A    +      I    +E+       +    WI ++     +L  PI S+L  +FG R   M GG +S   +II   SP  I   Y+F G++ G+G  + +   +  +S+YF + R L+TG A+ G G G FV+  ++Q  ++  ++W G + +L     Q  V   LLRPL        S      KP L   Q +   +   +D       V SF+   S      VP I  E ++   S+  +                          Y C  P+                    Y +PF +   T   +       A F++S +GV   V   GT   + L  DR      +   Y  A+ + G   +    + ++ L + +A + G   G+   L  V++A++V     ++A GL   +  + +L+GPP AG + D+  +Y+  F++SG + ++ +
Sbjct:   13 PDGGWGWVVVCSCFTVTACTRAITRC---IPIFFVEFQQHFSKDTSTTAWINSIMDCTTMLFAPIGSLLSTRFGCRATVMFGGLVSSSGFIIASFSP-TIEFLYLFLGLMAGLGFALCYSPSIAIVSRYFQRHRLLATGLAMSGNGVGTFVLAPVVQQLLIEVYAWRGALLLLGAFVAQLCVCGALLRPL-------ASPATPTAKPGLLGKQPAE--TAMPLDHYKLFCKVKSFMTFESQ-----VPIIRPELLVLCLSVSLLA-------------------------YGCITPL-------------------VYLVPFAHSVGTPERQ-------AAFLLSLLGVMDIV---GTVTYSWLI-DRECLRSRRAHCYCAAVGLYGACALALPAMRSFPLLVAFAALYGYFNGACTPLIPVLVADLVEPAGASTAIGLIYAMHALPYLLGPPTAGWLVDLTADYNAAFFLSGAIIMLGS 419          
BLAST of slc16a-17 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009990.1 (pep scaffold:Pmarinus_7.0:GL478117:170324:185545:-1 gene:ENSPMAG00000009036.1 transcript:ENSPMAT00000009990.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 2.094e-22
Identity = 100/414 (24.15%), Postives = 168/414 (40.58%), Query Frame = 3
Query:  453 GPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLA--PDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            GPI+S+L  +FG R V +IGG ++    II      +I   YI  G+I G GL +     L  + +YFDK+RP++ G A+ G+   +  +    Q +   F W G+  ILAG+     +   L+RP+ P    + + +                 S   +     S      IN  +  E       E   +  I  L+++T    +HR  L    G V   L  F  F                            P  ++A    +    +Q  A F++S + +   V R  TG+L  L     R  +++  +L+  G  +++      Y   + +AI  G   G V  +    L ++V     +SA GL  +I     L+GPP  G++ D+   Y  +F+VSG +  ++ +
Sbjct:    6 GPISSILVNRFGSRPVVIIGGMLAGLGMIISSFCT-SIVQLYICVGVIGGFGLALNLQPALTILGRYFDKRRPMAIGLAMAGSPVVLSSLAPFNQVLFDAFGWRGSFLILAGILFNCCLAGSLMRPIGPKKGSAPAAR----------------ISVLGLSGSNPSAHC-ELINRDTKSEGSKAAEPEPGILATISRLLDLT--LFRHRGFLIYLAGNV---LLFFGLFA---------------------------PLIFLA-PYAKHMGVDQYSAAFLLSILALVDMVTRPLTGILGNLKLVRPRIQYLFSFSLIFNGFCHLMGPMATDYGGLVIYAIFFGIAFGMVSAMLFETLMDLVGAARFSSAVGLVTIIESCPVLLGPPIGGMLVDVTGEYKYMFYVSGAILCVAGI 368          
BLAST of slc16a-17 vs. Ensembl Yeast
Match: ESBP6 (Protein with similarity to monocarboxylate permeases; appears not to be involved in transport of monocarboxylates such as lactate, pyruvate or acetate across the plasma membrane [Source:SGD;Acc:S000005069])

HSP 1 Score: 62.003 bits (149), Expect = 1.743e-10
Identity = 52/210 (24.76%), Postives = 88/210 (41.90%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGM--SLQTIVFCCLLRPLDP---ISVDSNSCQEENLK 881
            PDGGYGW   F  F+      G   SFG      + +     ++ +    I  L V    L  P+   L +  G R   + G  +   +Y++   +   +W  Y+  G + G  + ++F+     +  +F KKR ++ G ++ GTG G  V G     ++S F        + G+  S+  +V   LL+  +P   I + S     E LK
Sbjct:  207 PDGGYGWVVTFCVFLTMFSTWGCNASFGVDLAYYLNHDTYPGASKYDYALIAGLTVFLGQLLSPLVMALMRIIGLRTTMLFGDAVMLAAYLLASFTT-KLWQLYVTQGFMVGCSISLIFVPATTVLPGWFLKKRAVAMGVSLLGTGAGGVVYGLATNKMLSDFGNTRWCLRIIGISCSISVLVAIALLKERNPTPAIGLKSPRAMFEQLK 415          
BLAST of slc16a-17 vs. Ensembl Yeast
Match: MCH2 (Protein with similarity to mammalian monocarboxylate permeases; monocarboxylate permeases are involved in transport of monocarboxylic acids across the plasma membrane but mutant is not deficient in monocarboxylate transport [Source:SGD;Acc:S000001704])

HSP 1 Score: 55.0694 bits (131), Expect = 1.987e-8
Identity = 52/238 (21.85%), Postives = 94/238 (39.50%), Query Frame = 3
Query:  243 KSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGF 956
             +++ I +PDGGYGW+ + A  + +    G    +       +E       +      IG L  S  L   P+ + L   F  + +  +G      + ++   S   +W  Y+  G++ G GL  +F+  +  I  +F  KR L++G    G+G G  V    MQ+I+             G+    I  C +   L  I++       + L+      Q+   +  E +D  + S F
Sbjct:   28 NTSISIEVPDGGYGWFILLAFILYNFSTWGANSGYAIYLAHYLENNTFAGGSKLDYASIGGLAFSCGLFFAPVITWLYHIFSIQFIIGLGILFQGAALLLAAFSV-TLWEIYLTQGVLIGFGLAFIFIPSVTLIPLWFRNKRSLASGIGTAGSGLGGIVFNLGMQSILQK----------RGVKWALIAQCIICTSLSTIALMLTRTTHQGLR------QHKRSYKFELLDYDVLSNF 248          
BLAST of slc16a-17 vs. Ensembl Nematostella
Match: EDO38836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBR3])

HSP 1 Score: 102.064 bits (253), Expect = 5.595e-23
Identity = 61/216 (28.24%), Postives = 108/216 (50.00%), Query Frame = 3
Query:  270 DGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEEN--LKPELYQIQNSM 911
            D  + W   FAAF + A+  G+  SFG I   L++     ++A+    W+G+  ++   L  P+  +L  ++G R+V + GG ++C   +      P++ I Y+ Y +I G G    + +  I ++ YF K R L+TG A  G+  GI VM   +Q+++ +  W  T  +++ +SL   VF C   P   +   S     EN  L+P+  +  +S+
Sbjct:   53 DSVWSWVVCFAAFSSCAITQGLHGSFGLIYVALLKNFGQSKAAT---AWVGSGALAIACLLSPLVGLLCTRYGCRLVTIFGG-LTCAVGLFLTAHAPSLPIIYLTYSMIFGFGASCSYTSAFIAVTDYFSKWRSLATGIACAGSSVGILVMTRAIQSLLQHLGWESTFMVMSAVSLSLCVFGCTYDPSIRLCAGSADRISENTRLQPDQKKCASSL 264          
BLAST of slc16a-17 vs. Ensembl Nematostella
Match: EDO46666 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPD0])

HSP 1 Score: 99.7525 bits (247), Expect = 3.493e-22
Identity = 62/174 (35.63%), Postives = 94/174 (54.02%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCS-YIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILA 785
            P+GG GW    AAF     + G+  S+G I   L++     E+ S    WIG++  S   LCGP+AS L  ++G R VA IGG +S    ++  F+  P     Y+ YG++ G+G G+ F   +I + QYF K+ PL+ G A  G+G G  +    +Q ++S F W  ++ ILA
Sbjct:   20 PEGGRGWVVCAAAFFAMFTVFGIHISYGVIYANLVDEHGFGEAES---AWIGSVAGSLNFLCGPVASFLCDRYGCRSVAFIGGILSVLGLFLTSFVQNPGK--MYVTYGLLWGVGSGLSFTPSIIVLGQYFRKRFPLANGIASSGSGIGGLLAAPFIQFLLSNFGWQNSMRILA 188          
BLAST of slc16a-17 vs. Ensembl Nematostella
Match: EDO35238 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM28])

HSP 1 Score: 98.5969 bits (244), Expect = 4.721e-22
Identity = 77/302 (25.50%), Postives = 138/302 (45.70%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLS--PPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDS----NSCQEENLKPELYQIQNSMIFSKEAI------DSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQY 1136
            PDGG+GW    AAF+   ++ G   +FG I    +E L   +       W+G++      L GP+ + L KK G R+  ++G  I+      C L    PNI+I  + YG++ G+G  M +   +I +  YF+K+  L+ G    G+G G   MG ++Q ++       T+ I A M    ++   + RP++   +++       QE N K    +  +  +F  +A        S+   G+   F++L S+    G+       ++ I S+ +  G  I  + + D    P   RL+++Q+
Sbjct:   19 PDGGWGWLVCLAAFITQFIVLGTMNNFGVIY---VELLQEFKVGKAEAAWVGSITYGMMFLLGPLGTTLCKKIGCRLTTVVGCIIAAGG---CLLGSVAPNIYIMDLTYGLMFGVGASMCYFPSVIILGTYFNKRLSLANGLTSAGSGVGSLAMGPILQKVIEAVGMRNTMRISAAMISSIVLVSAIYRPINTPFLNAAKYETKHQEANKKKGCLKFLDFSLFKNKAYLLWAASLSLWMLGYFVPFVHLISLATIQGIDIYMATLLIGIMSVGSTIGRLIFGKIA-DH---PKVNRLYLYQF 310          

HSP 2 Score: 63.5438 bits (153), Expect = 9.223e-11
Identity = 57/264 (21.59%), Postives = 113/264 (42.80%), Query Frame = 3
Query:  894 QIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISA 1685
             + N +  +   + S+     +   I    M+  M +       I+ + ++      P  +    +       K+    ++       F+N    L+  S  L+   Y +PF ++ S  T +   +   A  ++  M V S++ R   G +A      ++++Y  + LM G  N I     TY    F+A   G   G  + L  V+  ++V  + MA+  G+   I  +   +GPP AG I+D+ ++Y++ F+V+G + +I+A
Sbjct:  149 SLANGLTSAGSGVGSLAMGPILQKVIEAVGMRNTMRISAAMISSIVLVSAIYRPINTPFLNAAKYETKHQEANKKKGCLKFL--DFSLFKNKAYLLWAASLSLWMLGYFVPFVHLISLATIQ-GIDIYMATLLIGIMSVGSTIGRLIFGKIADHPKVNRLYLYQFSFLMIGISNTICPAFSTYAGLAFYAAFFGFFEGCYVLLAPVLTGDIVGRNNMATGVGVLFAIKSVPLTLGPPIAGFIYDMSKSYELAFYVAGAVPVIAA 409          
BLAST of slc16a-17 vs. Ensembl Nematostella
Match: EDO35637 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKX5])

HSP 1 Score: 93.2041 bits (230), Expect = 2.260e-20
Identity = 73/298 (24.50%), Postives = 128/298 (42.95%), Query Frame = 3
Query:  267 PDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPP-------MESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLS-PPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQY 1136
            P+GG+GW     AF    L+ G+  S G I   L++            ++ +F   W+G+L        GP+ + L ++FG RVV + G   S C+  +   S   ++ + Y  YGII G G  + +   +I +S+YF  +  L  G    G+G G   MG ++Q + ++  +      LA   +   V   L RP+  +  ++    E          +N       A  S+   G+   F++L    E +GV P +   ++   S+ +  G  +  + S    I     RLH++Q+
Sbjct:    1 PEGGWGWVVCLGAFFIQFLMLGVQNSAGIIYTALVDRFHAHRGVTGETKNYTFFKAWVGSLATGMMFFLGPLTTSLCERFGCRVVGLAGA--SLCTMGLLLSSIVTSLPVLYFTYGIIWGAGTSLCYFPTIIVLSKYFKTRLSLVNGLVTAGSGVGTLCMGPILQLLFAHLGYAHAFMALAAFMVPVFVCSALFRPVRNVFCETGRPHETRKMFYWEIFKNKGYVVWIACLSIFMLGYFVPFVHLVRHAEDLGVQPTKSSLLIGYMSIASTLGRLVFGKISDSPCI----NRLHVYQF 292          
BLAST of slc16a-17 vs. Ensembl Nematostella
Match: EDO46709 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPB5])

HSP 1 Score: 91.6633 bits (226), Expect = 5.501e-20
Identity = 62/265 (23.40%), Postives = 131/265 (49.43%), Query Frame = 3
Query:  270 DGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCS-YIICFL-SPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVT 1058
            +GG+GW      F+ + ++ G+  SFG +   L++ L   ++ +    WIGA+ +    LCGP+ S+L  ++  +  A IG  +S    ++  F+  PP +   Y+ YG++ G+G  + F++ ++ + +YF K+  L  G A  G+G G  V G +M  +++   W   + +L+G ++   +   L +P +   V +   ++     +L   +N    +     ++ + G++  F++L    E +G   I K    ++   +++T
Sbjct:    4 EGGWGWIVCAGTFIVNFIVFGIHNSFGVVYVNLLDELKLGKAET---AWIGAMAMGLNFLCGPLTSILCTRYSCQATAFIGALLSVLGLFLTSFVQEPPKM---YLTYGLLFGVGSSLSFVSSIVILGEYFQKRLALVNGIATSGSGVGSLVTGPVMNYLLANIGWQNCMRVLSGFAMLLWIAAFLFKP-NKRRVSTRPSKDAGKLVDLSIWRNKAYVTWVITVALFQFGYLFPFVHLIKYAEELG---ISKSKGAWLIGFLSIT 258          

HSP 2 Score: 47.7506 bits (112), Expect = 8.004e-6
Identity = 35/150 (23.33%), Postives = 70/150 (46.67%), Query Frame = 3
Query: 1215 YTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSG 1664
            Y  PF ++     E+   ++    +++  + ++S++ R   G L       +I +Y +++   G   I+      Y   I +A+  G   G  +   +VI A++V  ++++   G       I    GPP AG ++D F +YD+ F++SG
Sbjct:  227 YLFPFVHLIK-YAEELGISKSKGAWLIGFLSITSTIGRVLFGRLCDFQRVNRITVYQLSVFAIGVSTILCPLASNYGGLIAYAVTFGFFDGCFVGQVAVITADIVGHEKLSQGVGNMFGFIAIPMSFGPPVAGWLYDAFGSYDLSFYLSG 375          
BLAST of slc16a-17 vs. Ensembl Medaka
Match: slc16a9a (solute carrier family 16 member 9 [Source:NCBI gene;Acc:101165170])

HSP 1 Score: 121.709 bits (304), Expect = 5.099e-29
Identity = 109/473 (23.04%), Postives = 199/473 (42.07%), Query Frame = 3
Query:  270 DGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPIS--VDSNSCQEENLKPELY---QIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKE-AMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYL-LWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGT 1667
            DGG+GW  V A+FM   L  G   S G + P   E+L   +       W+G+L     L+  PI S     FG R V    G +     ++   +P N+      YGI+ G+G G+V+ A L    QYFDK+R L+ G    GT  G F+  +    ++ +F   G + I+  ++L  +     +RPL+     +   +  E + + +L+    + +  I +  A+ +V K+  V   +    +K+ A+ +   +K     +     +      + E +  T   +  ++ +   FC     F                     P  ++      +    ++    +VS   +++ V +   G+L  +     +++Y   +   G   ++     TY+ L I  A++  G      +L S I   +V LD+++ A G+     G G ++GPP  G  FD  Q+YD+ F+ SG+
Sbjct:    9 DGGWGWAIVAASFMAQLLAYGSPQSVGVLYP---EWLHAFQEGKGVTAWVGSLVAGVGLIASPICSACVDNFGARPVTFFSGVMVAGGLMLSAFAP-NVPFLMFSYGIVVGLGCGLVYSATLTITCQYFDKRRGLALGIVTTGTSIGAFIYATAQNELIVFFGLDGCLLIIGAIALNLMACAGFMRPLNMPGYYLKQKAALERHTEEQLFVKLPLHDLNITTGSAVTTVEKTPTVKELLITIDVKDLAIQIEKKKKGPFAGVAIAKFIKAKQKAYSEYIHSTCEILQDQVMV--AFCIGIFLFSLGAFP---------------PVLFIEDVAQSEGLIEEVSLFPLVSIGAIATGVGKLVLGILVDIKWINCVYLYAFTMFAGGIALLLIPITKTYVGLQILSAVM--GFFSGNWSLTSYITTHIVGLDKLSQAHGILMFFGGFGIMLGPPVVGWFFDCTQSYDLAFYFSGS 458          
BLAST of slc16a-17 vs. Ensembl Medaka
Match: slc16a6a (monocarboxylate transporter 7 [Source:NCBI gene;Acc:101155804])

HSP 1 Score: 122.094 bits (305), Expect = 5.142e-29
Identity = 122/498 (24.50%), Postives = 216/498 (43.37%), Query Frame = 3
Query:  264 IPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCC--LLRPL-------DPISVDSNSCQEENLKPELYQIQNS-----MIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTG--VLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIV-----GGTLGSVITLESVILAE--MVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            +PDGG+GW    A F+      G    FG     L++     + ++  I+W+ ++ V      GP+AS++  +FG++ V MIGG + CC  I    +  +I   YI YG + G+G  + ++  +  +S+YF+++R L    A  G    +F +     A+     W  T+ ++   +LQ+IV  C  LLRP+       D    D +S +E     E   ++ S     +    E IDS   +G VS    L   K       ++K  +        VT    Q  ++  + I    K L       C  + +                  +  P Y +  +V+  +   +  A F++S + V+  + RF  G  +   L   RK+ + ++ +++  T++++    G  L+  F+ + V     G  +G++      +LAE  +V ++ M SA G+Y  I     L GPP  G++ DI +NY   F+       +SAL
Sbjct:   20 VPDGGWGWVVAVAFFLVEIFTYGTIKIFGI---FLLDLKTEFKESNSRISWVVSIAVFVMTFNGPLASVMTNRFGYQFVVMIGGLLICCGTIATSFAS-SINQIYITYGFVAGLGYCLTYLPTVTILSKYFNRRRSLVVAVASIGESLSLFALAPAYSAVRDKIGWRHTMTLIG--ALQSIVIVCGALLRPVLIVPRESDSTDADKSSPKELEALQECGHVEGSDQESCLRKENEMIDSYGTTG-VSDLKCLKDEKSPEENALLQKGGVKETERTPTVTS---QENDNEKQGIKDCSKLLDFSILRECSFILY-------SLFGLFATLGFFAPPLYVIELSVS--HGVERDRAAFMLSIIAVAEILGRFFIGWILSHRLFSGRKLLVLLVCVIIM-TLDLV----GFTLVKEFYGLAVCCALYGFFMGTISCTHIPLLAEDDVVGIERMTSAGGVYVFIQSFAGLAGPPLGGVLVDITKNYGAAFYSCAIGMGLSAL 493          
BLAST of slc16a-17 vs. Ensembl Medaka
Match: slc16a6a (monocarboxylate transporter 7 [Source:NCBI gene;Acc:101155804])

HSP 1 Score: 122.094 bits (305), Expect = 5.142e-29
Identity = 122/498 (24.50%), Postives = 216/498 (43.37%), Query Frame = 3
Query:  264 IPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCC--LLRPL-------DPISVDSNSCQEENLKPELYQIQNS-----MIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTG--VLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIV-----GGTLGSVITLESVILAE--MVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISAL 1688
            +PDGG+GW    A F+      G    FG     L++     + ++  I+W+ ++ V      GP+AS++  +FG++ V MIGG + CC  I    +  +I   YI YG + G+G  + ++  +  +S+YF+++R L    A  G    +F +     A+     W  T+ ++   +LQ+IV  C  LLRP+       D    D +S +E     E   ++ S     +    E IDS   +G VS    L   K       ++K  +        VT    Q  ++  + I    K L       C  + +                  +  P Y +  +V+  +   +  A F++S + V+  + RF  G  +   L   RK+ + ++ +++  T++++    G  L+  F+ + V     G  +G++      +LAE  +V ++ M SA G+Y  I     L GPP  G++ DI +NY   F+       +SAL
Sbjct:   20 VPDGGWGWVVAVAFFLVEIFTYGTIKIFGI---FLLDLKTEFKESNSRISWVVSIAVFVMTFNGPLASVMTNRFGYQFVVMIGGLLICCGTIATSFAS-SINQIYITYGFVAGLGYCLTYLPTVTILSKYFNRRRSLVVAVASIGESLSLFALAPAYSAVRDKIGWRHTMTLIG--ALQSIVIVCGALLRPVLIVPRESDSTDADKSSPKELEALQECGHVEGSDQESCLRKENEMIDSYGTTG-VSDLKCLKDEKSPEENALLQKGGVKETERTPTVTS---QENDNEKQGIKDCSKLLDFSILRECSFILY-------SLFGLFATLGFFAPPLYVIELSVS--HGVERDRAAFMLSIIAVAEILGRFFIGWILSHRLFSGRKLLVLLVCVIIM-TLDLV----GFTLVKEFYGLAVCCALYGFFMGTISCTHIPLLAEDDVVGIERMTSAGGVYVFIQSFAGLAGPPLGGVLVDITKNYGAAFYSCAIGMGLSAL 493          
BLAST of slc16a-17 vs. Ensembl Medaka
Match: SLC16A6 (solute carrier family 16 member 6 [Source:NCBI gene;Acc:101154956])

HSP 1 Score: 120.168 bits (300), Expect = 3.034e-28
Identity = 118/483 (24.43%), Postives = 213/483 (44.10%), Query Frame = 3
Query:  249 NLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFG-FIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRS---LMNVTGVPIQHRESL---DETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIV-----GGTLGSVITLESVILAE--MVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFW 1655
            N+   +PDGG+GW    A F+  A   G+  + G F++ L+ E+    ES S  ++W+ ++         P+A+ML  +FGFR V M+GGF++C   I    +  +I   YI  G+I+G G  + F+  +  ++QYF ++R L T  A  G  F +F    +   +     W   + I+  +    I    LLRP+   +V   + + + +    Y+++N    +  ++DS +  G   S +  ++  E  G    + + +M  +      +    P   +E     D   GP+  R      F       R+     Y L  L  +  +  P  Y+ + +++        +  ++S M V+  V R   GV+   A  RK       +++   + +    +   ++W FW + V     G  LG+V +    +LAE  +V + +M S  G+Y  I     L GPP  G++ D+ +NY   F+
Sbjct:   13 NVYPAVPDGGWGWVVAAAFFLVEASTYGVVKTLGIFLQDLMEEF---GESNS-RVSWVISICAFIMTFTAPLATMLSNRFGFRPVVMMGGFLTCLGTISSAFTS-SIKDMYITIGVISGFGYCLSFLPTVTILAQYFCRRRSLVTAVASSGESFAVFAFAPVFSRLKEDIGWRYCLVIMGVIQASIISCGLLLRPIVIETVKDAASEADAVAQSDYELENEQTCT--SVDSALSRGSEDSGVPSSASDEDWGSEEAKTKALMAQQEQERPRSPPPSPSSEKEGSFLPDSEAGPLKPRSPKLLDFS----VLRDGAFIWYSLFGLFATLGFFAPQLYI-TELSKSRGVPVTASSCMLSVMAVAEIVGRLSIGVVLDRARCRK-----TLVVLGCVVLLCLVLVAFAVVWEFWGLAVCCALYGFFLGTVASTHIPLLAEEDVVGIQKMPSCVGVYVFIQSFAGLAGPPLGGVLVDVTKNYGAAFY 478          
BLAST of slc16a-17 vs. Ensembl Medaka
Match: ENSORLT00000025268.2 (solute carrier family 16 member 12 [Source:NCBI gene;Acc:101161384])

HSP 1 Score: 119.013 bits (297), Expect = 4.099e-28
Identity = 121/501 (24.15%), Postives = 220/501 (43.91%), Query Frame = 3
Query:  240 KKSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSL--MNVTGVPIQHRESLDETIGPVGKRLHIFQY-FCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLAT---LAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWISGTR 1724
            K+ ++ +  PDGG+GW  V   FM +     +      I    +E+     +   A  WI +L     +LC P+ S++G ++  RV  M+GG +     ++      ++ + Y+  G++ G+G  + +   +  +  YF +++ L+ G A+ G+G G FV+  ++Q ++  +SW G + I++ +     V   L+RP+        + QE+               ++EA       G VSS     S+K     PP E E  +   +L        P + R S   T           +Y F  +P            +S L  +   +LPF Y+          +  +A F++S +GV   V     G L     L P R +  YI+++ M G   I +  L ++ L + +AI+ G   G+ + L  V+ +++V    ++ A G+   +  I +L+ PP  GL+ DI ++Y   F +SGT  + SA ++  +  I   R
Sbjct:    5 KQKSVGVSPPDGGWGWVIVGCCFMVTVCTRAVTRC---ISIFFVEFQGHFGAEYSATAWIHSLVDCITMLCAPVGSLVGNRWSCRVAVMLGG-VLSSCGLLLSSFSTSLELLYLTMGVLTGLGFALCYTPAIALVGCYFQQRKALAYGIAMSGSGIGTFVLAPVLQLLIELYSWRGALLIMSAVVANLCVCGALMRPI--------TVQEQ---------------TEEA-----TCGEVSSQDTELSIK-----PPKETEVGLLPLTLPGEKPNPSPKKRRFSFSRT-----------EYSFLLQP------DFLGLAVSFLFLASGCSLPFVYLVPYALSA-GISHQHAAFLMSILGVIDIVGNITFGWLTDQRCLKPHR-LSCYILSVAMEGLCCIFAPLLRSFRLLLPFAILYGYFDGAYVALIPVVTSDVVGAKHLSLALGVVYFLHAIPYLLSPPIGGLLVDITESYTGTFLLSGTALLASAFILSALVGIRRCR 449          
BLAST of slc16a-17 vs. Planmine SMEST
Match: SMESG000035197.1 (SMESG000035197.1)

HSP 1 Score: 991.104 bits (2561), Expect = 0.000e+0
Identity = 507/508 (99.80%), Postives = 507/508 (99.80%), Query Frame = 3
Query:  201 MIDSTEDLEIVYYKKSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWISGTR 1724
            MIDSTEDLEIVYYKKSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPP EKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQLFLYYLSALLFSCCYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWISGTR
Sbjct:    1 MIDSTEDLEIVYYKKSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPTEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQLFLYYLSALLFSCCYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWISGTR 508          
BLAST of slc16a-17 vs. Planmine SMEST
Match: SMESG000035197.1 (SMESG000035197.1)

HSP 1 Score: 821.231 bits (2120), Expect = 0.000e+0
Identity = 422/423 (99.76%), Postives = 422/423 (99.76%), Query Frame = 3
Query:  456 PIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWISGTR 1724
            PIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPP EKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQLFLYYLSALLFSCCYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWISGTR
Sbjct:   43 PIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPTEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQLFLYYLSALLFSCCYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVPIQWISGTR 465          
BLAST of slc16a-17 vs. Planmine SMEST
Match: SMESG000006948.1 (SMESG000006948.1)

HSP 1 Score: 135.961 bits (341), Expect = 1.247e-33
Identity = 69/186 (37.10%), Postives = 107/186 (57.53%), Query Frame = 3
Query:  273 GGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRP 830
            GG+GW  VFA+FM   L DG+ +SFG    L  E++    ++  A+ W+ ++ V   L  GP+AS+L  KFGFR V +IG FIS   +   F  P   W  Y    +I+G+G G+V++  ++T+S YF +KR  + G AVCG+G G FV   L++ ++  + W GT+ I+ G+    +    + RP
Sbjct:   38 GGWGWVVVFASFMVHVLADGVTYSFGV---LTTEFISHFGASREAVGWMASILVGMTLSAGPLASILCNKFGFRTVTIIGSFISAIGFCAPFFYP-EFWFLYFSASVISGLGFGLVYLPSIVTVSIYFKRKRAFAIGLAVCGSGIGTFVFSPLIEYLIETYGWRGTMLIVGGLIFNCLACGAVYRP 219          

HSP 2 Score: 74.3294 bits (181), Expect = 1.187e-13
Identity = 45/160 (28.12%), Postives = 90/160 (56.25%), Query Frame = 3
Query: 1215 YTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVV 1694
            +  PF Y      +    N   A F++S++G+ ++  R   G L+T +   ++ +Y  +LL++G + ++S++  TY   I + +  G   G+ +TL S++L +++ ++++ ++FG+  +  G    IGPP AG I+DI  ++D  F+V G    IS L++
Sbjct:  402 FNAPFLYAKDRALQMGIENNQ-ASFLISSIGIGNTFGRVIFGYLSTKSFINRLNLYNTSLLISGIVVMLSSYAITYFWMIVYTLGFGLLTGTYVTLTSIVLVDLLGIEKLNASFGMTMVAQGAAVFIGPPLAGWIYDITFSFDWSFFVCGAFLAISGLML 560          
BLAST of slc16a-17 vs. Planmine SMEST
Match: SMESG000071951.1 (SMESG000071951.1)

HSP 1 Score: 130.568 bits (327), Expect = 5.270e-32
Identity = 126/477 (26.42%), Postives = 220/477 (46.12%), Query Frame = 3
Query:  255 RIIIPDGGYGWWTVFAAFMNSALIDGMFFSFG-FIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSW------HGTIFILAGMSLQTIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKSGFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETIGPVGKRLHIFQYFCCRPVCFRNSQXXXXXXXXXXXXXXYTLPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLMAGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSG 1664
             I+ PDGG+GW  + AA +   ++ G+  SFG FI PL+ EY    +++   ++WI +L  +  L   P+A++L  KF  RV+ +IG  I+C ++   F   P +W F     I+ G+G+ +  M   I +++YFDKK  +  G    GTG    ++  +   +++   W      +G +FIL G+   +I F  L +   P   D N    +N K E ++ +N+++ +        K   + +F++ T++        IEK D     SL       I ++E   E       R  +       PV        L  ++  L +  +   F Y      +     +  A F++  +G+ +++ R   G L +    +   +Y+++L++AG   I S    +Y L + + I  G  +GS  TL SV+L ++V L +     GL   +  IG LI  P +G I+D  Q +   F+ SG
Sbjct:   50 EIVCPDGGWGWVVLIAAVIIRIILGGLLVSFGLFITPLIKEY----KTSQSTVSWIASLMSAPALAAAPLATLLAIKFSDRVIVIIGSAIACVAFAAPFFYSP-LW-FMFMSSILTGVGMAIAMMNTTIVLTKYFDKKLCILNGMFTSGTGIASLIITPIFNKLINSCGWRLSMLIYGALFILCGIC--SITFKELPKKTKPKINDVN----DNTKMEKHEERNAVVININC----HKEPTIHNFLSATNIATNYNT-DIEKIDQRLFTSLQ-----YIHNKEDNFE-------RKRVGNLLSNMPVS------TLLGMTNFLTNLGHDTTFMYAKQRAVD-MKITESKAAFLLIAIGIGNTIGRLLFGYLGSRKEIKTYILYLVSLVLAGGFLIFSRVAFSYPLMLVYTIGFGLFIGSYTTLTSVVLLDIVGLRDFTKGLGLTYFVQAIGLLICSPMSGAIYDATQTFHWAFFNSG 490          
BLAST of slc16a-17 vs. Planmine SMEST
Match: SMESG000003109.1 (SMESG000003109.1)

HSP 1 Score: 132.109 bits (331), Expect = 9.260e-32
Identity = 71/216 (32.87%), Postives = 121/216 (56.02%), Query Frame = 3
Query:  192 FESMIDSTEDLEIVYYKKSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFGFIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVVAMIGGFISCCSYIIC-FLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQYFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQTIVFCCLLRPLD 836
            ++ MID  ++ +I         +  PDGG+ W  V A+F     IDG  F++G + P +ME     +  SF   W G+L   F +  GP+AS L  +F FR VA+ GG IS  + ++  F++  N+  F IF+G++ G+G  ++++  +  +  +F +KRP++ G A+ G+G G F+ G L+  ++   +W G I ++A +  Q +VF  L RPL+
Sbjct:  149 YKQMIDPYQEGDIQAMAAETAPMGPPDGGWAWLIVLASFFCMITIDGTCFNYGLLVPEMMETFQENDIMSFM--WPGSLLAGFYMSMGPVASALSNQFDFRPVALAGGIISGIAILLSSFMN--NLLAFIIFFGVLGGIGFSLIYLPAIAIVGHWFHEKRPIAVGLALYGSGCGTFLYGQLIPRLIEIVTWKGCIILIAAVCFQCLVFIVLFRPLE 360          

HSP 2 Score: 59.3066 bits (142), Expect = 7.198e-9
Identity = 42/173 (24.28%), Postives = 90/173 (52.02%), Query Frame = 3
Query: 1221 LPFYYVASTVTEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRK------IWIYIIALLMAGTMNIISTFLGTYL-LWIFWAIIVGGTLGSVITLESVILAEMVTLDEMASAFGLYQMICGIGFLIGPPFAGLIFDI-FQNYDMIFWVSGTLFIISALVVVPIQWIS 1715
            +PFY++   + +    +   AG ++S +G++++  R    +    A          +WI    L++AG       FL TY    +F   + G  +   ++L+S+++ E++ ++ + +AFG   +  G+  +IGPP AG I D+ F  Y+  F+ +G + I+S ++  P+++++
Sbjct:  781 VPFYFLPGYI-KSLDMDLKIAGGLISYVGLANTAGRLFATIYIEKAWSSNYPWADCLWINNFVLILAGVTACSIPFLITYYGALVFVLCLYGLCVAGFVSLKSILVVELLGVNRLTNAFGFLLIFQGLATVIGPPLAGWICDLKFHKYEYGFYFAGAMIILSGILCFPLRFVA 952          
The following BLAST results are available for this feature:
BLAST of slc16a-17 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC16A146.704e-3524.63solute carrier family 16 member 14 [Source:HGNC Sy... [more]
SLC16A91.725e-3322.68solute carrier family 16 member 9 [Source:HGNC Sym... [more]
SLC16A91.725e-3322.68solute carrier family 16 member 9 [Source:HGNC Sym... [more]
SLC16A64.523e-3126.25solute carrier family 16 member 6 [Source:HGNC Sym... [more]
SLC16A64.523e-3126.25solute carrier family 16 member 6 [Source:HGNC Sym... [more]
back to top
BLAST of slc16a-17 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mct-39.989e-4627.16MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-12.523e-3524.02MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-22.523e-3524.02MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-44.614e-3435.27MonoCarboxylate Transporter family [Source:UniPro... [more]
mct-44.614e-3435.27MonoCarboxylate Transporter family [Source:UniPro... [more]
back to top
BLAST of slc16a-17 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chk4.273e-3138.22gene:FBgn0033095 transcript:FBtr0302166[more]
chk4.273e-3138.22gene:FBgn0033095 transcript:FBtr0336659[more]
chk4.273e-3138.22gene:FBgn0033095 transcript:FBtr0086140[more]
Sln2.041e-2834.30gene:FBgn0033657 transcript:FBtr0088032[more]
CG139072.886e-2834.92gene:FBgn0035173 transcript:FBtr0072593[more]
back to top
BLAST of slc16a-17 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a9a1.101e-3425.42solute carrier family 16 member 9a [Source:ZFIN;Ac... [more]
slc16a41.648e-3424.10solute carrier family 16 member 4 [Source:ZFIN;Acc... [more]
slc16a42.424e-3424.10solute carrier family 16 member 4 [Source:ZFIN;Acc... [more]
slc16a42.424e-3424.10solute carrier family 16 member 4 [Source:ZFIN;Acc... [more]
slc16a9b8.689e-2924.36solute carrier family 16 member 9b [Source:ZFIN;Ac... [more]
back to top
BLAST of slc16a-17 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atf6b7.499e-3624.75activating transcription factor 6 beta [Source:Xen... [more]
mad2l14.542e-3124.58mitotic arrest deficient 2 like 1 [Source:Xenbase;... [more]
SLC16A64.013e-2725.00solute carrier family 16 member 6 [Source:NCBI gen... [more]
SLC16A62.846e-2625.15solute carrier family 16 member 6 [Source:NCBI gen... [more]
slc16a79.346e-2025.68solute carrier family 16 member 7 [Source:NCBI gen... [more]
back to top
BLAST of slc16a-17 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc16a148.398e-3725.48solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a91.330e-3422.79solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a63.982e-3024.90solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a68.360e-3024.65solute carrier family 16 (monocarboxylic acid tran... [more]
Slc16a41.351e-2624.03solute carrier family 16 (monocarboxylic acid tran... [more]
back to top
BLAST of slc16a-17 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8K1C7|MOT14_MOUSE5.874e-3625.48Monocarboxylate transporter 14 OS=Mus musculus OX=... [more]
sp|Q7RTX9|MOT14_HUMAN3.219e-3424.63Monocarboxylate transporter 14 OS=Homo sapiens OX=... [more]
sp|Q7TM99|MOT9_MOUSE9.304e-3422.79Monocarboxylate transporter 9 OS=Mus musculus OX=1... [more]
sp|Q7RTY1|MOT9_HUMAN8.286e-3322.68Monocarboxylate transporter 9 OS=Homo sapiens OX=9... [more]
sp|Q5ZJU0|MOT9_CHICK2.146e-3225.16Monocarboxylate transporter 9 OS=Gallus gallus OX=... [more]
back to top
BLAST of slc16a-17 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YFA00.000e+0100.00Slc16a-17 OS=Schmidtea mediterranea OX=79327 GN=sl... [more]
A0A0P5NVA31.036e-5626.71Monocarboxylate transporter OS=Daphnia magna OX=35... [more]
A0A0P5XZD61.889e-5626.67Monocarboxylate transporter OS=Daphnia magna OX=35... [more]
A0A1S3I6K62.388e-5626.10monocarboxylate transporter 12 OS=Lingula unguis O... [more]
R7VHW01.070e-5426.71MFS domain-containing protein OS=Capitella teleta ... [more]
back to top
BLAST of slc16a-17 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a42.462e-3424.75solute carrier family 16 member 4 [Source:ZFIN;Acc... [more]
slc16a6b2.973e-3025.05monocarboxylate transporter 7-like [Source:NCBI ge... [more]
ENSAMXT00000010927.23.402e-2824.74pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
slc16a5a6.653e-2823.20solute carrier family 16 member 5 [Source:NCBI gen... [more]
slc16a71.457e-2723.66monocarboxylate transporter 2-like [Source:NCBI ge... [more]
back to top
BLAST of slc16a-17 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC16A123.686e-3523.58solute carrier family 16 member 12 [Source:HGNC Sy... [more]
zgc:1655071.053e-2725.41solute carrier family 16 member 7 [Source:HGNC Sym... [more]
ENSPMAT00000001631.12.332e-2735.10pep scaffold:Pmarinus_7.0:GL477961:12469:26731:1 g... [more]
SLC16A128.485e-2724.38solute carrier family 16 member 12 [Source:HGNC Sy... [more]
ENSPMAT00000009990.12.094e-2224.15pep scaffold:Pmarinus_7.0:GL478117:170324:185545:-... [more]
back to top
BLAST of slc16a-17 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ESBP61.743e-1024.76Protein with similarity to monocarboxylate permeas... [more]
MCH21.987e-821.85Protein with similarity to mammalian monocarboxyla... [more]
back to top
BLAST of slc16a-17 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO388365.595e-2328.24Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466663.493e-2235.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352384.721e-2225.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356372.260e-2024.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467095.501e-2023.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of slc16a-17 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc16a9a5.099e-2923.04solute carrier family 16 member 9 [Source:NCBI gen... [more]
slc16a6a5.142e-2924.50monocarboxylate transporter 7 [Source:NCBI gene;Ac... [more]
slc16a6a5.142e-2924.50monocarboxylate transporter 7 [Source:NCBI gene;Ac... [more]
SLC16A63.034e-2824.43solute carrier family 16 member 6 [Source:NCBI gen... [more]
ENSORLT00000025268.24.099e-2824.15solute carrier family 16 member 12 [Source:NCBI ge... [more]
back to top
BLAST of slc16a-17 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000035197.10.000e+099.80SMESG000035197.1[more]
SMESG000035197.10.000e+099.76SMESG000035197.1[more]
SMESG000006948.11.247e-3337.10SMESG000006948.1[more]
SMESG000071951.15.270e-3226.42SMESG000071951.1[more]
SMESG000003109.19.260e-3232.87SMESG000003109.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30031741
GenBankAKN21512.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031741 ID=SMED30031741|Name=slc16a-17|organism=Schmidtea mediterranea sexual|type=transcript|length=1847bp
GGCTGTGTTAGTGTGCGTGTAAGTGGAGACAGAAAAAACAACACCATTTC
TGTATGGTTGCCACATGCACGCTAACACACATACAATTGCAACCGAAGAG
ATAGTTTTGTAGTCTGTCGTTGACCTTATTTGCAGCTTCTCCCACTTTCT
GACTCAAACAATGCATATATCATGCGATAATTTCAATACAGTTCGAGAGT
ATGATCGACAGTACTGAAGATCTCGAAATTGTTTATTATAAAAAATCCAA
TCTAAGAATTATAATTCCAGATGGTGGCTATGGATGGTGGACAGTTTTTG
CAGCCTTTATGAATTCCGCATTAATTGATGGAATGTTCTTTTCATTTGGA
TTCATAAGACCGTTATTAATGGAATATTTGCCGCCAATGGAATCGGCGTC
TTTCGCAATCAATTGGATTGGTGCTTTGCAAGTTTCCTTTCCGTTACTAT
GCGGCCCGATTGCGTCGATGTTAGGTAAAAAGTTCGGATTTCGAGTTGTT
GCGATGATTGGCGGATTCATCAGTTGTTGCAGTTATATTATCTGTTTCTT
GTCGCCTCCCAACATTTGGATATTCTATATTTTCTATGGAATAATTAATG
GAATGGGATTGGGAATGGTATTTATGGCTGGATTGATAACCATATCCCAG
TATTTCGATAAAAAGCGTCCATTATCAACTGGAACAGCAGTTTGTGGAAC
TGGATTCGGAATATTTGTTATGGGAAGTTTAATGCAAGCAATAGTAAGCT
ATTTTTCATGGCATGGAACAATTTTCATTTTGGCCGGAATGTCTTTGCAA
ACAATTGTCTTTTGCTGTTTATTGAGACCCCTTGACCCAATTTCAGTTGA
TAGTAATTCATGTCAAGAAGAAAATTTAAAGCCCGAACTTTATCAGATTC
AAAATTCTATGATTTTTAGCAAGGAAGCAATTGATTCGGTTATAAAATCT
GGATTCGTGTCGAGTTTCATAAATTTAACATCAATGAAAGAAGCTATGGG
AGTTCCTCCAATAGAAAAAGAAGACATTATGTATATCAGAAGTTTAATGA
ATGTTACTGGAGTTCCTATTCAGCACAGAGAATCGTTAGACGAAACAATC
GGTCCTGTTGGAAAACGACTGCATATATTTCAATATTTTTGCTGTAGACC
GGTTTGCTTTCGAAATTCTCAATTGTTTCTTTACTACTTATCAGCTCTCT
TATTTTCTTGTTGTTACACACTTCCGTTTTACTATGTAGCAAGCACAGTA
ACTGAAAAGTATAGCTTTAATCAAATGTATGCCGGATTTATCGTTTCAAC
AATGGGAGTAAGTTCATCAGTTTTTCGTTTCGGAACGGGAGTACTCGCCA
CTCTGGCGCCGGATAGGAAAATATGGATCTACATAATTGCCCTATTAATG
GCTGGTACAATGAATATCATTTCCACGTTTCTTGGTACTTATTTACTTTG
GATATTTTGGGCTATCATTGTTGGGGGCACATTGGGTAGCGTAATTACAC
TGGAGTCGGTGATTTTGGCAGAAATGGTAACTCTTGACGAGATGGCATCA
GCATTTGGATTGTATCAAATGATTTGTGGAATTGGATTTCTCATTGGTCC
TCCGTTCGCCGGTTTGATCTTTGACATATTTCAGAATTACGACATGATCT
TTTGGGTTTCTGGTACTCTTTTCATCATTAGTGCTCTGGTAGTGGTTCCA
ATTCAGTGGATAAGTGGAACCCGATGAGTTGATTTCTTATGACAAATTCA
TTTCTTCGAAAAAAAGAAATTATTTGCACTAGAATGAAAATATATCTGAT
TTAGTTGTGATTTTTTTTTACTTGATTTAATAATAAACATTTTGGCG
back to top

protein sequence of SMED30031741-orf-1

>SMED30031741-orf-1 ID=SMED30031741-orf-1|Name=SMED30031741-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=509bp
MIDSTEDLEIVYYKKSNLRIIIPDGGYGWWTVFAAFMNSALIDGMFFSFG
FIRPLLMEYLPPMESASFAINWIGALQVSFPLLCGPIASMLGKKFGFRVV
AMIGGFISCCSYIICFLSPPNIWIFYIFYGIINGMGLGMVFMAGLITISQ
YFDKKRPLSTGTAVCGTGFGIFVMGSLMQAIVSYFSWHGTIFILAGMSLQ
TIVFCCLLRPLDPISVDSNSCQEENLKPELYQIQNSMIFSKEAIDSVIKS
GFVSSFINLTSMKEAMGVPPIEKEDIMYIRSLMNVTGVPIQHRESLDETI
GPVGKRLHIFQYFCCRPVCFRNSQLFLYYLSALLFSCCYTLPFYYVASTV
TEKYSFNQMYAGFIVSTMGVSSSVFRFGTGVLATLAPDRKIWIYIIALLM
AGTMNIISTFLGTYLLWIFWAIIVGGTLGSVITLESVILAEMVTLDEMAS
AFGLYQMICGIGFLIGPPFAGLIFDIFQNYDMIFWVSGTLFIISALVVVP
IQWISGTR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 27..288
e-value: 1.4E-17
score: 65.5
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 318..503
e-value: 6.6E-16
score: 60.2
NoneNo IPR availablePANTHERPTHR11360:SF260GON-2 EXTRAGENIC MODIFIERcoord: 24..502
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 24..502
NoneNo IPR availableCDDcd17352MFS_MCT_SLC16coord: 28..501
e-value: 1.34238E-55
score: 188.145
NoneNo IPR availableTMHMMTMhelixcoord: 29..51
NoneNo IPR availableTMHMMTMhelixcoord: 391..413
NoneNo IPR availableTMHMMTMhelixcoord: 484..506
NoneNo IPR availableTMHMMTMhelixcoord: 122..144
NoneNo IPR availableTMHMMTMhelixcoord: 362..384
NoneNo IPR availableTMHMMTMhelixcoord: 95..117
NoneNo IPR availableTMHMMTMhelixcoord: 417..439
NoneNo IPR availableTMHMMTMhelixcoord: 325..347
NoneNo IPR availableTMHMMTMhelixcoord: 452..474
NoneNo IPR availableTMHMMTMhelixcoord: 66..88
NoneNo IPR availableTMHMMTMhelixcoord: 189..211
NoneNo IPR availableTMHMMTMhelixcoord: 157..179
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 46..423
e-value: 4.7E-22
score: 78.4
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 324..508
score: 15.184
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 29..502