carboxypeptidase E

Overview
Namecarboxypeptidase E
Smed IDSMED30031739
Length (bp)1904
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of carboxypeptidase E (SMED30031739) t-SNE clustered cells

Violin plots show distribution of expression levels for carboxypeptidase E (SMED30031739) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of carboxypeptidase E (SMED30031739) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for carboxypeptidase E (SMED30031739) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031739

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30031739SMESG000037720.1 SmedASXL_014186SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30031739SMESG000037720.1 dd_Smed_v4_3059_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031739SMESG000037720.1 dd_Smed_v4_3059_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031739SMESG000037720.1 dd_Smed_v4_3059_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031739SMESG000037720.1 dd_Smed_v4_3059_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031739SMESG000037720.1 Contig32674newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031739SMESG000037720.1 Contig47783uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031739SMESG000037720.1 Contig47783newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031739SMESG000037720.1 Contig27168uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031739SMESG000037720.1 Contig27168newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031739SMESG000037720.1 Contig7654uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031739SMESG000037720.1 Contig7654newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031739SMESG000037720.1 Contig4030uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031739SMESG000037720.1 Contig4030newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031739SMESG000037675.1 Contig4030uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031739SMESG000037675.1 Contig4030newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30031739SMESG000037720.1 dd_Smed_v6_3059_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30031739SMESG000037720.1 OX_Smed_1.0.18422ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of carboxypeptidase E vs. Ensembl Human
Match: CPE (carboxypeptidase E [Source:HGNC Symbol;Acc:HGNC:2303])

HSP 1 Score: 361.303 bits (926), Expect = 5.190e-118
Identity = 194/430 (45.12%), Postives = 270/430 (62.79%), Query Frame = 2
Query:   86 LEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLN--KKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMF-KRKDSCPNSD----FLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLE 1342
            L+    I + +H   EL+  L  +  +C++I+ +Y      V ++     L VI    +P  H PG PEFKY+GNMHGNE VGRELL+FLA YLC+++  GNE + N++ STRIHI+PS+NPDG++ A     E   W VGR+NA  +DLNRNFPDLD++V+ N + G   +HLL   KK +D++ +L  ET  VI WI  IPFVLSAN+HGGD+VANYPYD++     ++ S +PD+ +F+ LA +YS +NP M    +  C  +D    F+  DG TNG  WYS+ GGMQDFNYL++NCFEIT+E+ C KFP  + L  +W  N  SL+++++  H G+KG V  R   G  P+A A I          VE I H VT+A +GDY+RLL+PG Y + A+APG+ +  + V V       A  ++F LE
Sbjct:   43 LQQEDGISFEYHRYPELREALVSVWLQCTAISRIY-----TVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFV--DGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKNSLISYLEQIHRGVKGFV--RDLQG-NPIANATI---------SVEGIDHDVTSAKDGDYWRLLIPGNYKLTASAPGYLAITKKVAVPYS---PAAGVDFELE 450          
BLAST of carboxypeptidase E vs. Ensembl Human
Match: CPZ (carboxypeptidase Z [Source:HGNC Symbol;Acc:HGNC:2333])

HSP 1 Score: 333.569 bits (854), Expect = 9.877e-107
Identity = 171/419 (40.81%), Postives = 255/419 (60.86%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIA---NRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSEL-GRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQA-SLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEP 1345
            I + HH+  ++  +L R   +C+ +   Y      + ++     L VI F   P +H    PE K +GN+HGNEV GRE+L++LA YLC +++ GN  ++ ++ +TRIH+LPSMNPDG+++A       N W  GR NA N+DLNRNFPDL    ++ +E  G + DH+   +     ++  ET  ++ W+ +IPFVLSA++HGGD+V +YP+D S    + +  S TPD ++FK L+ +Y+  +P M  R ++    +FL +  I NGA WYS +GGM DFNYL TNCFEIT+E+GC KFP  + LY  W  N +SL+NF++  H GIKG+V   ++   KPV  A I +           I H +TTA +GDY+RLL PG + VIA APG+   I+ V++    + + +V +F L+P
Sbjct:   46 IRFSHHSYAQMVRVLRRTASRCAHVARTY-----SIGRSFDGRELLVIEFSSRPGQHELMEPEVKLIGNIHGNEVAGREMLIYLAQYLCSEYLLGNPRIQRLLNTTRIHLLPSMNPDGYEVAAAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLAETRGARSDHIPIPQHYWWGKVAPETKAIMKWMQTIPFVLSASLHGGDLVVSYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNYLHTNCFEITVELGCVKFPPEEALYILWQHNKESLLNFVETVHRGIKGVV---TDKFGKPVKNARISVKG---------IRHDITTAPDGDYWRLLPPGIHIVIAQAPGYAKVIKKVIIPARMKRAGRV-DFILQP 446          
BLAST of carboxypeptidase E vs. Ensembl Human
Match: CPN1 (carboxypeptidase N subunit 1 [Source:HGNC Symbol;Acc:HGNC:2312])

HSP 1 Score: 330.872 bits (847), Expect = 2.046e-106
Identity = 185/426 (43.43%), Postives = 259/426 (60.80%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIA---NRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKS---TVDG--KNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPADSQ 1357
            + +RHH   +L   L ++ ++C  IT +Y      + ++V    LYV+ F   P  H P  PE KYVGNMHGNE +GREL+L L+++LC++    N+ +  +++ TRIHILPSMNPDG+++A      +  ++VGR NAN VDLNRNFPDL+  ++ N + G    HL       + ++E ET  VI W+ S  FVLSAN+HGG VVANYPYDKS    V G  +  ++ TPD+++F+ LA  YS  +  MF+  +     D+ P DGITNGA WYSLS GMQDFNYL TNCFEITLE+ C KFP  + L   W+ N ++L+ F++  H GIKG+VL   +  Y  +A AVI ++ +          H VT+   GDY+RLL+PG Y+V A APG+  +   V V         ++NF L+ +  Q
Sbjct:   21 VTFRHHRYDDLVRTLYKVQNECPGITRVY-----SIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNW-KSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNC---GDYFP-DGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVL---DENYNNLANAVISVSGIN---------HDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTV---GPAEPTLVNFHLKRSIPQ 421          
BLAST of carboxypeptidase E vs. Ensembl Human
Match: CPZ (carboxypeptidase Z [Source:HGNC Symbol;Acc:HGNC:2333])

HSP 1 Score: 333.569 bits (854), Expect = 3.859e-105
Identity = 171/419 (40.81%), Postives = 255/419 (60.86%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIA---NRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSEL-GRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQA-SLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEP 1345
            I + HH+  ++  +L R   +C+ +   Y      + ++     L VI F   P +H    PE K +GN+HGNEV GRE+L++LA YLC +++ GN  ++ ++ +TRIH+LPSMNPDG+++A       N W  GR NA N+DLNRNFPDL    ++ +E  G + DH+   +     ++  ET  ++ W+ +IPFVLSA++HGGD+V +YP+D S    + +  S TPD ++FK L+ +Y+  +P M  R ++    +FL +  I NGA WYS +GGM DFNYL TNCFEIT+E+GC KFP  + LY  W  N +SL+NF++  H GIKG+V   ++   KPV  A I +           I H +TTA +GDY+RLL PG + VIA APG+   I+ V++    + + +V +F L+P
Sbjct:  172 IRFSHHSYAQMVRVLRRTASRCAHVARTY-----SIGRSFDGRELLVIEFSSRPGQHELMEPEVKLIGNIHGNEVAGREMLIYLAQYLCSEYLLGNPRIQRLLNTTRIHLLPSMNPDGYEVAAAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLAETRGARSDHIPIPQHYWWGKVAPETKAIMKWMQTIPFVLSASLHGGDLVVSYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNYLHTNCFEITVELGCVKFPPEEALYILWQHNKESLLNFVETVHRGIKGVV---TDKFGKPVKNARISVKG---------IRHDITTAPDGDYWRLLPPGIHIVIAQAPGYAKVIKKVIIPARMKRAGRV-DFILQP 572          
BLAST of carboxypeptidase E vs. Ensembl Human
Match: CPZ (carboxypeptidase Z [Source:HGNC Symbol;Acc:HGNC:2333])

HSP 1 Score: 333.183 bits (853), Expect = 5.665e-105
Identity = 171/419 (40.81%), Postives = 255/419 (60.86%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIA---NRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSEL-GRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQA-SLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEP 1345
            I + HH+  ++  +L R   +C+ +   Y      + ++     L VI F   P +H    PE K +GN+HGNEV GRE+L++LA YLC +++ GN  ++ ++ +TRIH+LPSMNPDG+++A       N W  GR NA N+DLNRNFPDL    ++ +E  G + DH+   +     ++  ET  ++ W+ +IPFVLSA++HGGD+V +YP+D S    + +  S TPD ++FK L+ +Y+  +P M  R ++    +FL +  I NGA WYS +GGM DFNYL TNCFEIT+E+GC KFP  + LY  W  N +SL+NF++  H GIKG+V   ++   KPV  A I +           I H +TTA +GDY+RLL PG + VIA APG+   I+ V++    + + +V +F L+P
Sbjct:  183 IRFSHHSYAQMVRVLRRTASRCAHVARTY-----SIGRSFDGRELLVIEFSSRPGQHELMEPEVKLIGNIHGNEVAGREMLIYLAQYLCSEYLLGNPRIQRLLNTTRIHLLPSMNPDGYEVAAAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLAETRGARSDHIPIPQHYWWGKVAPETKAIMKWMQTIPFVLSASLHGGDLVVSYPFDFSKHPQEEKMFSPTPDEKMFKLLSRAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNYLHTNCFEITVELGCVKFPPEEALYILWQHNKESLLNFVETVHRGIKGVV---TDKFGKPVKNARISVKG---------IRHDITTAPDGDYWRLLPPGIHIVIAQAPGYAKVIKKVIIPARMKRAGRV-DFILQP 583          
BLAST of carboxypeptidase E vs. Ensembl Celegans
Match: egl-21 (Carboxypeptidase E [Source:UniProtKB/Swiss-Prot;Acc:O17754])

HSP 1 Score: 355.14 bits (910), Expect = 5.560e-116
Identity = 201/448 (44.87%), Postives = 279/448 (62.28%), Query Frame = 2
Query:  107 EYRH-HNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRT---RNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELG-RKQDHLLNKKTIDEDELER--ETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQA---SLTPDNEVFKFLALSYSKYNPRMFKRK----DSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPA---DSQNEVKTNNPLCNEIA 1399
            E+ H HN  +L+  L  IN+KC  IT LY     ++ ++V    L VI F  +P  HIP  PE K +GNMHGNE +GRELLL  A+ LC+  +  ++ +  ++ ST IHILPSMNPDG+++A  T   + +W+ GR+N N VDLNR+FPDLD + ++  ++G  K DHLL   ++ ED ++R  ET+ V  W  S+PFVLSAN H GD+VANYP+D + +D  +Q    S +PD+  F++LA SY+  +  M K      D      F  + GITNGAKWYS++GGMQDFNYLATN  EITLE+ C K P+G  L  FW  N KS+  ++  +H G+KG+V+       +P+ +AV+ I N T   +  P+ H VTT SEGD+YR+L  G+Y +I AA G+    + V V N+ + SA V+NF L PA    S+NE +    L NEIA
Sbjct:   36 EWGHYHNQAQLEAKLGEINEKCPEITTLY-----EIGQSVEGRPLVVIQFSTTPGEHIPTKPEVKLIGNMHGNEPIGRELLLRFAETLCNGAINNDKEIVQLLNSTSIHILPSMNPDGFELALGTEPAQRQWLTGRSNINGVDLNRDFPDLDSIFYELQKIGVPKFDHLL---SLFEDNVDRQPETIAVGQWTLSLPFVLSANFHEGDLVANYPFD-AAIDENSQKTAYSASPDDGTFRWLAKSYADNHAHMSKNDHAPCDGTSQDAFARQGGITNGAKWYSVAGGMQDFNYLATNAMEITLELSCEKMPEGSQLPRFWEDNQKSIFEYVWKSHSGVKGMVVDAMTG--EPIKRAVVWIRNGT---ETVPVKHPVTTWSEGDFYRVLPAGKYEIIVAAEGYDIAAKNVTVENKVRDSALVVNFALSPAADEPSENEQEQIAELVNEIA 469          
BLAST of carboxypeptidase E vs. Ensembl Celegans
Match: egl-21 (Carboxypeptidase E [Source:UniProtKB/Swiss-Prot;Acc:O17754])

HSP 1 Score: 355.14 bits (910), Expect = 5.560e-116
Identity = 201/448 (44.87%), Postives = 279/448 (62.28%), Query Frame = 2
Query:  107 EYRH-HNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRT---RNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELG-RKQDHLLNKKTIDEDELER--ETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQA---SLTPDNEVFKFLALSYSKYNPRMFKRK----DSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPA---DSQNEVKTNNPLCNEIA 1399
            E+ H HN  +L+  L  IN+KC  IT LY     ++ ++V    L VI F  +P  HIP  PE K +GNMHGNE +GRELLL  A+ LC+  +  ++ +  ++ ST IHILPSMNPDG+++A  T   + +W+ GR+N N VDLNR+FPDLD + ++  ++G  K DHLL   ++ ED ++R  ET+ V  W  S+PFVLSAN H GD+VANYP+D + +D  +Q    S +PD+  F++LA SY+  +  M K      D      F  + GITNGAKWYS++GGMQDFNYLATN  EITLE+ C K P+G  L  FW  N KS+  ++  +H G+KG+V+       +P+ +AV+ I N T   +  P+ H VTT SEGD+YR+L  G+Y +I AA G+    + V V N+ + SA V+NF L PA    S+NE +    L NEIA
Sbjct:   36 EWGHYHNQAQLEAKLGEINEKCPEITTLY-----EIGQSVEGRPLVVIQFSTTPGEHIPTKPEVKLIGNMHGNEPIGRELLLRFAETLCNGAINNDKEIVQLLNSTSIHILPSMNPDGFELALGTEPAQRQWLTGRSNINGVDLNRDFPDLDSIFYELQKIGVPKFDHLL---SLFEDNVDRQPETIAVGQWTLSLPFVLSANFHEGDLVANYPFD-AAIDENSQKTAYSASPDDGTFRWLAKSYADNHAHMSKNDHAPCDGTSQDAFARQGGITNGAKWYSVAGGMQDFNYLATNAMEITLELSCEKMPEGSQLPRFWEDNQKSIFEYVWKSHSGVKGMVVDAMTG--EPIKRAVVWIRNGT---ETVPVKHPVTTWSEGDFYRVLPAGKYEIIVAAEGYDIAAKNVTVENKVRDSALVVNFALSPAADEPSENEQEQIAELVNEIA 469          
BLAST of carboxypeptidase E vs. Ensembl Celegans
Match: egl-21 (Carboxypeptidase E [Source:UniProtKB/Swiss-Prot;Acc:O17754])

HSP 1 Score: 355.14 bits (910), Expect = 5.560e-116
Identity = 201/448 (44.87%), Postives = 279/448 (62.28%), Query Frame = 2
Query:  107 EYRH-HNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRT---RNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELG-RKQDHLLNKKTIDEDELER--ETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQA---SLTPDNEVFKFLALSYSKYNPRMFKRK----DSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPA---DSQNEVKTNNPLCNEIA 1399
            E+ H HN  +L+  L  IN+KC  IT LY     ++ ++V    L VI F  +P  HIP  PE K +GNMHGNE +GRELLL  A+ LC+  +  ++ +  ++ ST IHILPSMNPDG+++A  T   + +W+ GR+N N VDLNR+FPDLD + ++  ++G  K DHLL   ++ ED ++R  ET+ V  W  S+PFVLSAN H GD+VANYP+D + +D  +Q    S +PD+  F++LA SY+  +  M K      D      F  + GITNGAKWYS++GGMQDFNYLATN  EITLE+ C K P+G  L  FW  N KS+  ++  +H G+KG+V+       +P+ +AV+ I N T   +  P+ H VTT SEGD+YR+L  G+Y +I AA G+    + V V N+ + SA V+NF L PA    S+NE +    L NEIA
Sbjct:   36 EWGHYHNQAQLEAKLGEINEKCPEITTLY-----EIGQSVEGRPLVVIQFSTTPGEHIPTKPEVKLIGNMHGNEPIGRELLLRFAETLCNGAINNDKEIVQLLNSTSIHILPSMNPDGFELALGTEPAQRQWLTGRSNINGVDLNRDFPDLDSIFYELQKIGVPKFDHLL---SLFEDNVDRQPETIAVGQWTLSLPFVLSANFHEGDLVANYPFD-AAIDENSQKTAYSASPDDGTFRWLAKSYADNHAHMSKNDHAPCDGTSQDAFARQGGITNGAKWYSVAGGMQDFNYLATNAMEITLELSCEKMPEGSQLPRFWEDNQKSIFEYVWKSHSGVKGMVVDAMTG--EPIKRAVVWIRNGT---ETVPVKHPVTTWSEGDFYRVLPAGKYEIIVAAEGYDIAAKNVTVENKVRDSALVVNFALSPAADEPSENEQEQIAELVNEIA 469          
BLAST of carboxypeptidase E vs. Ensembl Celegans
Match: cpd-2 (CarboxyPeptidase D family [Source:UniProtKB/TrEMBL;Acc:Q22825])

HSP 1 Score: 255.758 bits (652), Expect = 1.109e-77
Identity = 148/407 (36.36%), Postives = 219/407 (53.81%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDK-STVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDF----LPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQ 1309
            + + H N   L + +  ++ K  ++TH+Y        ++V    L+V+   + P  H   IPEFKYV NMHGNEV GR  L+ LA  L + +   N W+R +V+STRIH++PSMNPDG++ A+      V GR NAN  DLNRNFP      F  SE+                  + ET+ ++ W   IPF LSAN+HGG  + NYP+D   T   ++  + +PDN +F  LA +Y++ + RM+K+   C + D      P++GI NGA WY +SGGMQD+NYL TNCFE+T+E+ C KFP  K L   W  N  +L+ FI   H  I G+V+  +++G + +  A + I               V +  EG+++RL   G+Y +      +    Q V VT + +
Sbjct:   54 LNFSHMNYSTLTDHIHNLHRKFPNLTHIY-----SAGQSVQGRELWVLVVSRYPIEHRKLIPEFKYVANMHGNEVTGRVFLVSLAHTLLENY-NSNLWIRQLVDSTRIHLMPSMNPDGYEHASEGDQAGVTGRQNANGKDLNRNFPSRFPNYFPTSEI------------------QPETIAIMNWTRQIPFALSANLHGGTTLVNYPFDDFPTRTRQSHYAPSPDNALFVRLAYTYARGHERMWKKGPRCLDDDLNISVDPQNGIINGADWYIVSGGMQDWNYLNTNCFEVTVEMNCEKFPQTKKLRYLWEENKYALLKFIDLIHGAIHGLVID-ADTG-EGIVNATVSIDERAKI---------VVSYGEGEFWRLANMGKYDLTFDHSDYYPVTQTVHVTPQDR 425          
BLAST of carboxypeptidase E vs. Ensembl Celegans
Match: cpd-2 (CarboxyPeptidase D family [Source:UniProtKB/TrEMBL;Acc:Q22825])

HSP 1 Score: 255.758 bits (652), Expect = 1.109e-77
Identity = 148/407 (36.36%), Postives = 219/407 (53.81%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDK-STVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDF----LPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQ 1309
            + + H N   L + +  ++ K  ++TH+Y        ++V    L+V+   + P  H   IPEFKYV NMHGNEV GR  L+ LA  L + +   N W+R +V+STRIH++PSMNPDG++ A+      V GR NAN  DLNRNFP      F  SE+                  + ET+ ++ W   IPF LSAN+HGG  + NYP+D   T   ++  + +PDN +F  LA +Y++ + RM+K+   C + D      P++GI NGA WY +SGGMQD+NYL TNCFE+T+E+ C KFP  K L   W  N  +L+ FI   H  I G+V+  +++G + +  A + I               V +  EG+++RL   G+Y +      +    Q V VT + +
Sbjct:   54 LNFSHMNYSTLTDHIHNLHRKFPNLTHIY-----SAGQSVQGRELWVLVVSRYPIEHRKLIPEFKYVANMHGNEVTGRVFLVSLAHTLLENY-NSNLWIRQLVDSTRIHLMPSMNPDGYEHASEGDQAGVTGRQNANGKDLNRNFPSRFPNYFPTSEI------------------QPETIAIMNWTRQIPFALSANLHGGTTLVNYPFDDFPTRTRQSHYAPSPDNALFVRLAYTYARGHERMWKKGPRCLDDDLNISVDPQNGIINGADWYIVSGGMQDWNYLNTNCFEVTVEMNCEKFPQTKKLRYLWEENKYALLKFIDLIHGAIHGLVID-ADTG-EGIVNATVSIDERAKI---------VVSYGEGEFWRLANMGKYDLTFDHSDYYPVTQTVHVTPQDR 425          
BLAST of carboxypeptidase E vs. Ensembl Fly
Match: svr (gene:FBgn0004648 transcript:FBtr0344737)

HSP 1 Score: 261.151 bits (666), Expect = 3.161e-80
Identity = 160/361 (44.32%), Postives = 217/361 (60.11%), Query Frame = 2
Query:  287 PEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWV---VGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKN-QASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFK-SQIQCVLVTNESQFSAKVLNFRLEPADS 1354
            P  KY+ NMHG+E VGR+LL+++A YL   H   ++ +  +V ST I+++P+MNPDG+ ++     E +   VGR NA N+DLNR+FPD          L +   H L  ++      + ET  ++ WI S PFVLSAN HGG VVA+YPYD S    +  + SLTPD+ VFK LA +YS  +P M  RK +  N  F    GITNGA WY LSGGMQDFNY  +NCFE+T+E+ C K+P    L   W  N  SL+  ++  HIGIKG+V     SG+ P+A A     NV  AG  E  +    T+  G+Y+RLL PG YSV A+A G++ S  Q V VTN++Q  A  L+F+L P ++
Sbjct:   92 PPVKYIANMHGDETVGRQLLVYMAQYLLGNHERISD-LGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRGNAANIDLNRDFPD---------RLEQSHVHQLRAQS-----RQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIM--RKGNNCNDSF--SGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLV--TDASGF-PIADA-----NVYVAGLEEKPMR---TSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQ-EALRLDFKLAPVET 421          
BLAST of carboxypeptidase E vs. Ensembl Fly
Match: svr (gene:FBgn0004648 transcript:FBtr0070086)

HSP 1 Score: 261.151 bits (666), Expect = 3.161e-80
Identity = 160/361 (44.32%), Postives = 217/361 (60.11%), Query Frame = 2
Query:  287 PEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWV---VGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKN-QASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFK-SQIQCVLVTNESQFSAKVLNFRLEPADS 1354
            P  KY+ NMHG+E VGR+LL+++A YL   H   ++ +  +V ST I+++P+MNPDG+ ++     E +   VGR NA N+DLNR+FPD          L +   H L  ++      + ET  ++ WI S PFVLSAN HGG VVA+YPYD S    +  + SLTPD+ VFK LA +YS  +P M  RK +  N  F    GITNGA WY LSGGMQDFNY  +NCFE+T+E+ C K+P    L   W  N  SL+  ++  HIGIKG+V     SG+ P+A A     NV  AG  E  +    T+  G+Y+RLL PG YSV A+A G++ S  Q V VTN++Q  A  L+F+L P ++
Sbjct:   92 PPVKYIANMHGDETVGRQLLVYMAQYLLGNHERISD-LGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRGNAANIDLNRDFPD---------RLEQSHVHQLRAQS-----RQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIM--RKGNNCNDSF--SGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLV--TDASGF-PIADA-----NVYVAGLEEKPMR---TSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQ-EALRLDFKLAPVET 421          
BLAST of carboxypeptidase E vs. Ensembl Fly
Match: svr (gene:FBgn0004648 transcript:FBtr0290017)

HSP 1 Score: 272.322 bits (695), Expect = 1.529e-78
Identity = 163/440 (37.05%), Postives = 241/440 (54.77%), Query Frame = 2
Query:  107 EYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYD--------------KSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCP--NSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPADSQNEVKTNN 1378
            +Y HHN   +++ L  I+    S+T LY      + K+V    L+V+    +P  H+PG+PEFKYV NMHGNEVVG+ELLL L  Y+ +++   ++ +  +V  TR+H L SMNPDG++I+        VGR NA+ +DLNRNFPD         + G  +    NK T      E E   V+ W  S+PFVLSAN+HGG +VANYP+D               S+++G+ + + T DN +FK LA  YS  +P M+  +  C    ++F P DGITNGA+WYS++GGMQD+NY+   C E+T+E+GC KFP    L  +W  + + L+ FI+  H GI G V   S  G  P+A AV+++             H   +   GDY++L +PGR+++      +      V V +   F  + ++  L P D Q+    N+
Sbjct:  306 KYEHHNFTAMESYLRAISSSYPSLTRLY-----SIGKSVQGRDLWVLEIFATPGSHVPGVPEFKYVANMHGNEVVGKELLLILTKYMLERY-GNDDRITKLVNGTRMHFLYSMNPDGYEISIEGDRTGGVGRANAHGIDLNRNFPD---------QYGTDR---FNKVT------EPEVAAVMNWTLSLPFVLSANLHGGSLVANYPFDDNENDFNDPFMRLRNSSINGR-KPNPTEDNALFKHLAGIYSNAHPTMYLGQ-PCELFQNEFFP-DGITNGAQWYSVTGGMQDWNYVRAGCLELTIEMGCDKFPKAAELSRYWEDHREPLLQFIEQVHCGIHGFV--HSTIG-TPIAGAVVRLDGAN---------HSTYSQVFGDYWKLALPGRHNLTVLGDNYAPLRMEVEVPDVHPFEMR-MDITLMPDDPQHWASAND 705          

HSP 2 Score: 208.379 bits (529), Expect = 1.030e-56
Identity = 132/289 (45.67%), Postives = 171/289 (59.17%), Query Frame = 2
Query:  494 VGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKN-QASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFK-SQIQCVLVTNESQFSAKVLNFRLEPADS 1354
            VGR NA N+DLNR+FPD          L +   H L  ++      + ET  ++ WI S PFVLSAN HGG VVA+YPYD S    +  + SLTPD+ VFK LA +YS  +P M  RK +  N  F    GITNGA WY LSGGMQDFNY  +NCFE+T+E+ C K+P    L   W  N  SL+  ++  HIGIKG+V     SG+ P+A A     NV  AG  E  +    T+  G+Y+RLL PG YSV A+A G++ S  Q V VTN++Q  A  L+F+L P ++
Sbjct:   16 VGRGNAANIDLNRDFPD---------RLEQSHVHQLRAQS-----RQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIM--RKGNNCNDSF--SGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVT--DASGF-PIADA-----NVYVAGLEEKPMR---TSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQ-EALRLDFKLAPVET 274          
BLAST of carboxypeptidase E vs. Ensembl Fly
Match: svr (gene:FBgn0004648 transcript:FBtr0344738)

HSP 1 Score: 272.707 bits (696), Expect = 1.630e-78
Identity = 163/440 (37.05%), Postives = 241/440 (54.77%), Query Frame = 2
Query:  107 EYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYD--------------KSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCP--NSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPADSQNEVKTNN 1378
            +Y HHN   +++ L  I+    S+T LY      + K+V    L+V+    +P  H+PG+PEFKYV NMHGNEVVG+ELLL L  Y+ +++   ++ +  +V  TR+H L SMNPDG++I+        VGR NA+ +DLNRNFPD         + G  +    NK T      E E   V+ W  S+PFVLSAN+HGG +VANYP+D               S+++G+ + + T DN +FK LA  YS  +P M+  +  C    ++F P DGITNGA+WYS++GGMQD+NY+   C E+T+E+GC KFP    L  +W  + + L+ FI+  H GI G V   S  G  P+A AV+++             H   +   GDY++L +PGR+++      +      V V +   F  + ++  L P D Q+    N+
Sbjct:  453 KYEHHNFTAMESYLRAISSSYPSLTRLY-----SIGKSVQGRDLWVLEIFATPGSHVPGVPEFKYVANMHGNEVVGKELLLILTKYMLERY-GNDDRITKLVNGTRMHFLYSMNPDGYEISIEGDRTGGVGRANAHGIDLNRNFPD---------QYGTDR---FNKVT------EPEVAAVMNWTLSLPFVLSANLHGGSLVANYPFDDNENDFNDPFMRLRNSSINGR-KPNPTEDNALFKHLAGIYSNAHPTMYLGQ-PCELFQNEFFP-DGITNGAQWYSVTGGMQDWNYVRAGCLELTIEMGCDKFPKAAELSRYWEDHREPLLQFIEQVHCGIHGFV--HSTIG-TPIAGAVVRLDGAN---------HSTYSQVFGDYWKLALPGRHNLTVLGDNYAPLRMEVEVPDVHPFEMR-MDITLMPDDPQHWASAND 852          

HSP 2 Score: 260.766 bits (665), Expect = 2.229e-74
Identity = 160/361 (44.32%), Postives = 217/361 (60.11%), Query Frame = 2
Query:  287 PEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWV---VGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKN-QASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFK-SQIQCVLVTNESQFSAKVLNFRLEPADS 1354
            P  KY+ NMHG+E VGR+LL+++A YL   H   ++ +  +V ST I+++P+MNPDG+ ++     E +   VGR NA N+DLNR+FPD          L +   H L  ++      + ET  ++ WI S PFVLSAN HGG VVA+YPYD S    +  + SLTPD+ VFK LA +YS  +P M  RK +  N  F    GITNGA WY LSGGMQDFNY  +NCFE+T+E+ C K+P    L   W  N  SL+  ++  HIGIKG+V     SG+ P+A A     NV  AG  E  +    T+  G+Y+RLL PG YSV A+A G++ S  Q V VTN++Q  A  L+F+L P ++
Sbjct:   92 PPVKYIANMHGDETVGRQLLVYMAQYLLGNHERISD-LGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRGNAANIDLNRDFPD---------RLEQSHVHQLRAQS-----RQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIM--RKGNNCNDSF--SGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVT--DASGF-PIADA-----NVYVAGLEEKPMR---TSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQ-EALRLDFKLAPVET 421          
BLAST of carboxypeptidase E vs. Ensembl Fly
Match: svr (gene:FBgn0004648 transcript:FBtr0070081)

HSP 1 Score: 272.707 bits (696), Expect = 1.630e-78
Identity = 163/440 (37.05%), Postives = 241/440 (54.77%), Query Frame = 2
Query:  107 EYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYD--------------KSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCP--NSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPADSQNEVKTNN 1378
            +Y HHN   +++ L  I+    S+T LY      + K+V    L+V+    +P  H+PG+PEFKYV NMHGNEVVG+ELLL L  Y+ +++   ++ +  +V  TR+H L SMNPDG++I+        VGR NA+ +DLNRNFPD         + G  +    NK T      E E   V+ W  S+PFVLSAN+HGG +VANYP+D               S+++G+ + + T DN +FK LA  YS  +P M+  +  C    ++F P DGITNGA+WYS++GGMQD+NY+   C E+T+E+GC KFP    L  +W  + + L+ FI+  H GI G V   S  G  P+A AV+++             H   +   GDY++L +PGR+++      +      V V +   F  + ++  L P D Q+    N+
Sbjct:  453 KYEHHNFTAMESYLRAISSSYPSLTRLY-----SIGKSVQGRDLWVLEIFATPGSHVPGVPEFKYVANMHGNEVVGKELLLILTKYMLERY-GNDDRITKLVNGTRMHFLYSMNPDGYEISIEGDRTGGVGRANAHGIDLNRNFPD---------QYGTDR---FNKVT------EPEVAAVMNWTLSLPFVLSANLHGGSLVANYPFDDNENDFNDPFMRLRNSSINGR-KPNPTEDNALFKHLAGIYSNAHPTMYLGQ-PCELFQNEFFP-DGITNGAQWYSVTGGMQDWNYVRAGCLELTIEMGCDKFPKAAELSRYWEDHREPLLQFIEQVHCGIHGFV--HSTIG-TPIAGAVVRLDGAN---------HSTYSQVFGDYWKLALPGRHNLTVLGDNYAPLRMEVEVPDVHPFEMR-MDITLMPDDPQHWASAND 852          

HSP 2 Score: 260.766 bits (665), Expect = 2.229e-74
Identity = 160/361 (44.32%), Postives = 217/361 (60.11%), Query Frame = 2
Query:  287 PEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWV---VGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKN-QASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFK-SQIQCVLVTNESQFSAKVLNFRLEPADS 1354
            P  KY+ NMHG+E VGR+LL+++A YL   H   ++ +  +V ST I+++P+MNPDG+ ++     E +   VGR NA N+DLNR+FPD          L +   H L  ++      + ET  ++ WI S PFVLSAN HGG VVA+YPYD S    +  + SLTPD+ VFK LA +YS  +P M  RK +  N  F    GITNGA WY LSGGMQDFNY  +NCFE+T+E+ C K+P    L   W  N  SL+  ++  HIGIKG+V     SG+ P+A A     NV  AG  E  +    T+  G+Y+RLL PG YSV A+A G++ S  Q V VTN++Q  A  L+F+L P ++
Sbjct:   92 PPVKYIANMHGDETVGRQLLVYMAQYLLGNHERISD-LGQLVNSTDIYLVPTMNPDGYALSQEGNCESLPNYVGRGNAANIDLNRDFPD---------RLEQSHVHQLRAQS-----RQPETAALVNWIVSKPFVLSANFHGGAVVASYPYDNSLAHNECCEESLTPDDRVFKQLAHTYSDNHPIM--RKGNNCNDSF--SGGITNGAHWYELSGGMQDFNYAFSNCFELTIELSCCKYPAASTLPQEWQRNKASLLQLLRQAHIGIKGLVT--DASGF-PIADA-----NVYVAGLEEKPMR---TSKRGEYWRLLTPGLYSVHASAFGYQTSAPQQVRVTNDNQ-EALRLDFKLAPVET 421          
BLAST of carboxypeptidase E vs. Ensembl Zebrafish
Match: cpe (carboxypeptidase E [Source:ZFIN;Acc:ZDB-GENE-090313-68])

HSP 1 Score: 363.999 bits (933), Expect = 1.649e-119
Identity = 199/427 (46.60%), Postives = 266/427 (62.30%), Query Frame = 2
Query:   59 LCLIFVFLVL----EASGK--IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLN--KKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMF-KRKDSCP--NSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLV 1294
             C   + L L    EA G+  I + +H   E++  L  +  +C SIT +Y      V ++     L V+    +P  H PG PEFKY+GNMHGNE VGRELL++LA YLC+++  GN+ + +++ STRIHI+PSMNPDG++ A     E   W VGR+NA  +DLNRNFPDLD++V+ N   G   +HLL   KK +DE+ +L  ET  VI WI  IPFVLSAN+HGGDVVANYPYD++     ++ S +PD+ VFK LA +YS YNP M    +  C   + D   K+GITNG  WYS+ GGMQDFNYL++NCFEITLE+ C KFP    L  +W  N  SL+N+I+  H G+ G V  R   G  P++ A +          VE I H +TTA +GDY+RLL PG Y V A+APG+ + ++ V V
Sbjct:    6 FCGAVLMLALSSVKEAEGENGISFEYHRYEEMRKSLVSVWLQCPSITRIY-----TVGESFEGRELLVLEMSDNPGIHEPGEPEFKYIGNMHGNEAVGRELLIYLAQYLCNEYQEGNDTIIDLIHSTRIHIMPSMNPDGFEKAASQPGEMKDWFVGRSNAQGIDLNRNFPDLDRIVYMNEREGGANNHLLKNMKKAVDENTKLAPETKAVIHWIMDIPFVLSANLHGGDVVANYPYDETRSGSTHEYSASPDDLVFKSLAKAYSIYNPVMSDTNRPPCRKNDDDSSFKEGITNGGAWYSVPGGMQDFNYLSSNCFEITLELSCDKFPPEDSLKQYWDQNRNSLVNYIEQVHRGVSGFV--RDLQG-NPISNASV---------SVEGIDHDITTAKDGDYWRLLAPGNYKVSASAPGYLTVVKKVAV 415          
BLAST of carboxypeptidase E vs. Ensembl Zebrafish
Match: cpe (carboxypeptidase E [Source:ZFIN;Acc:ZDB-GENE-090313-68])

HSP 1 Score: 363.999 bits (933), Expect = 1.649e-119
Identity = 199/427 (46.60%), Postives = 266/427 (62.30%), Query Frame = 2
Query:   59 LCLIFVFLVL----EASGK--IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLN--KKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMF-KRKDSCP--NSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLV 1294
             C   + L L    EA G+  I + +H   E++  L  +  +C SIT +Y      V ++     L V+    +P  H PG PEFKY+GNMHGNE VGRELL++LA YLC+++  GN+ + +++ STRIHI+PSMNPDG++ A     E   W VGR+NA  +DLNRNFPDLD++V+ N   G   +HLL   KK +DE+ +L  ET  VI WI  IPFVLSAN+HGGDVVANYPYD++     ++ S +PD+ VFK LA +YS YNP M    +  C   + D   K+GITNG  WYS+ GGMQDFNYL++NCFEITLE+ C KFP    L  +W  N  SL+N+I+  H G+ G V  R   G  P++ A +          VE I H +TTA +GDY+RLL PG Y V A+APG+ + ++ V V
Sbjct:    6 FCGAVLMLALSSVKEAEGENGISFEYHRYEEMRKSLVSVWLQCPSITRIY-----TVGESFEGRELLVLEMSDNPGIHEPGEPEFKYIGNMHGNEAVGRELLIYLAQYLCNEYQEGNDTIIDLIHSTRIHIMPSMNPDGFEKAASQPGEMKDWFVGRSNAQGIDLNRNFPDLDRIVYMNEREGGANNHLLKNMKKAVDENTKLAPETKAVIHWIMDIPFVLSANLHGGDVVANYPYDETRSGSTHEYSASPDDLVFKSLAKAYSIYNPVMSDTNRPPCRKNDDDSSFKEGITNGGAWYSVPGGMQDFNYLSSNCFEITLELSCDKFPPEDSLKQYWDQNRNSLVNYIEQVHRGVSGFV--RDLQG-NPISNASV---------SVEGIDHDITTAKDGDYWRLLAPGNYKVSASAPGYLTVVKKVAV 415          
BLAST of carboxypeptidase E vs. Ensembl Zebrafish
Match: cpn1 (carboxypeptidase N, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9116])

HSP 1 Score: 334.724 bits (857), Expect = 3.401e-108
Identity = 182/415 (43.86%), Postives = 260/415 (62.65%), Query Frame = 2
Query:   74 VFLVLEAS--GKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTR---NEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKS---TVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLV 1294
            + L LEAS  G  +++HH   E+   L  +  +C  IT +Y      + ++     LYV+ F  +P  H    PEFKYVGNMHGNEV+GRELL++L+ +LC+++ AGNE +  ++  TRIHILPSMNPDG+++A R     N ++VGR N+  VDLNRNFPDL+ +++   E    Q+H L      E ++E ETL VI W+ +  FVLSAN+HGG VVANYP+DKS    + GK   S T D+++F+ LA +YS  +  M K  +     D+   +GITNGA WYSLS GMQDFNYL TNCFEITLE+ C KFP    L + W+ N ++L+++++  H GIKG+V   + +    ++ AVI +  ++         H +T+ + GDY+RLL+PG Y+V A+APG++     V V
Sbjct:   13 LLLGLEASLTGASDFQHHGYEEMVRALFAVQSECPYITRIY-----SIGRSTEGRHLYVLEFSDNPGIHETLEPEFKYVGNMHGNEVLGRELLIYLSQFLCEEYRAGNERITRLIHDTRIHILPSMNPDGYEVAARQGPEFNGYLVGRGNSKEVDLNRNFPDLNALMYY-YEKHNGQNHHLPLPDNWELQVEPETLAVIKWMQNYNFVLSANLHGGAVVANYPFDKSREPRIRGKTTYSATTDDKIFRKLAKTYSYAHSWMHKGWNC---GDYF-DEGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPATALANEWLANREALVSYMEQVHHGIKGMVYDENNNA---ISNAVISVAGIS---------HDITSGTLGDYFRLLLPGTYTVTASAPGYQPSTSTVTV 405          
BLAST of carboxypeptidase E vs. Ensembl Zebrafish
Match: cpn1 (carboxypeptidase N, polypeptide 1 [Source:ZFIN;Acc:ZDB-GENE-030131-9116])

HSP 1 Score: 333.954 bits (855), Expect = 3.242e-106
Identity = 182/415 (43.86%), Postives = 260/415 (62.65%), Query Frame = 2
Query:   74 VFLVLEAS--GKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTR---NEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKS---TVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLV 1294
            + L LEAS  G  +++HH   E+   L  +  +C  IT +Y      + ++     LYV+ F  +P  H    PEFKYVGNMHGNEV+GRELL++L+ +LC+++ AGNE +  ++  TRIHILPSMNPDG+++A R     N ++VGR N+  VDLNRNFPDL+ +++   E    Q+H L      E ++E ETL VI W+ +  FVLSAN+HGG VVANYP+DKS    + GK   S T D+++F+ LA +YS  +  M K  +     D+   +GITNGA WYSLS GMQDFNYL TNCFEITLE+ C KFP    L + W+ N ++L+++++  H GIKG+V   + +    ++ AVI +  ++         H +T+ + GDY+RLL+PG Y+V A+APG++     V V
Sbjct:  145 LLLGLEASLTGASDFQHHGYEEMVRALFAVQSECPYITRIY-----SIGRSTEGRHLYVLEFSDNPGIHETLEPEFKYVGNMHGNEVLGRELLIYLSQFLCEEYRAGNERITRLIHDTRIHILPSMNPDGYEVAARQGPEFNGYLVGRGNSKEVDLNRNFPDLNALMYY-YEKHNGQNHHLPLPDNWELQVEPETLAVIKWMQNYNFVLSANLHGGAVVANYPFDKSREPRIRGKTTYSATTDDKIFRKLAKTYSYAHSWMHKGWNC---GDYF-DEGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPATALANEWLANREALVSYMEQVHHGIKGMVYDENNNA---ISNAVISVAGIS---------HDITSGTLGDYFRLLLPGTYTVTASAPGYQPSTSTVTV 537          
BLAST of carboxypeptidase E vs. Ensembl Zebrafish
Match: cpz (carboxypeptidase Z [Source:ZFIN;Acc:ZDB-GENE-090313-267])

HSP 1 Score: 309.686 bits (792), Expect = 3.547e-96
Identity = 163/397 (41.06%), Postives = 246/397 (61.96%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGR-KQDHLLNKKTIDEDEL-ERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQA-SLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQ 1276
            I++ +H+N ++ +IL++   KCS I+  Y      + ++V    L VI F  +P +H    PE K +GNMHGNEV+GR+LL++LA YLC +++ GNE ++ I+ +TRIHIL SMNPDG++IA    +E   W  GR NA N+DLNRNFPDL  + +        + DH+    +   +++   ET  ++ WI + PFV+SA++HGG++V +YP+D S    +++  S TPD ++F+ LA +Y+  +  M         + F  K GITNGA WYS +GGM DFNYL +NC+EIT+E+GC KFP  + LY  W  N ++L++F+++ H GIKGIV     +G K    A+I          V+ + H +TTA +GDY+RL+ PG + V A+A G+  Q
Sbjct:  186 IQFTYHSNSQMFSILKKTASKCSHISQTY-----SIGRSVEGKDLLVIEFSNNPGQHDLLEPEIKLIGNMHGNEVLGRQLLIYLAQYLCSEYLLGNERIQTIINTTRIHILASMNPDGYEIAASEGHEYNGWTSGRANAQNLDLNRNFPDLTSIFYNRRRFRHFRSDHIPIPDSYWMNKVVAPETYAIMKWIRTYPFVISASLHGGELVISYPFDFSRHPQEDRMYSPTPDEQIFRQLARTYADAHATMSNNDTERCGASFANKGGITNGALWYSFAGGMSDFNYLHSNCYEITVELGCDKFPSEEELYPEWRRNKEALLSFMESVHKGIKGIVKDEHGNGIK---GAIIS---------VKGLRHDITTAEDGDYWRLMNPGVHIVTASASGYSKQ 565          
BLAST of carboxypeptidase E vs. Ensembl Xenopus
Match: cpe (carboxypeptidase E [Source:NCBI gene;Acc:100127580])

HSP 1 Score: 364.385 bits (934), Expect = 2.209e-119
Identity = 192/410 (46.83%), Postives = 261/410 (63.66%), Query Frame = 2
Query:   98 GKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRN---EWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLN--KKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFK-RKDSCPNSD----FLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLV 1294
            G I Y +H   E+++ L  +  +C SI+ +Y      V ++     L VI    +P  H PG PEFKYVGNMHGNE VGRELLL+ A YLC+++   NE + N++ +TRIHI+PS+NPDG++ A +      +W VGR+NA  +DLNRNFPDLD++V+ N   G   +HLL   KK++DE+ +L  ET+ VI WI  IPFVLSAN+HGGD+VANYPYDK+     ++ S  PD+ +F+ LA SYS  NP M    +  C  SD    F+  DG TNGA WYS+ GGMQDFNYL++NCFEIT+E+GC KFP  + L  +W  N  SL+N++   H G+ G V  +   G+ P+A A I          V+ I H VT+A +GDY+RLL PG Y + A+APG+ +  + V V
Sbjct:   38 GDISYEYHRYPEMRDALVAVWLQCPSISRIY-----TVGRSFEGRELLVIEISDNPGEHEPGEPEFKYVGNMHGNEAVGRELLLYFAQYLCNEYQRENETIVNLIHNTRIHIMPSLNPDGFEKAAQQPGDIKDWFVGRSNAQGIDLNRNFPDLDRIVYLNEREGGTNNHLLQNLKKSVDENAKLAPETVAVIHWIMDIPFVLSANLHGGDLVANYPYDKTRSGSTHEYSACPDDGIFQSLARSYSSLNPTMSDPDRKPCRKSDDDSSFI--DGTTNGAAWYSVPGGMQDFNYLSSNCFEITVELGCDKFPPEEMLKSYWEENKDSLVNYLMQVHRGVTGFV--KDHHGF-PIANATI---------SVDGIDHDVTSAKDGDYWRLLAPGNYKITASAPGYLAVAKKVAV 428          
BLAST of carboxypeptidase E vs. Ensembl Xenopus
Match: cpz (carboxypeptidase Z [Source:NCBI gene;Acc:100170588])

HSP 1 Score: 320.087 bits (819), Expect = 2.179e-102
Identity = 174/436 (39.91%), Postives = 255/436 (58.49%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRT---RNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQ-DHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQA-SLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPADSQNEVKTNNPLCNEI 1396
            I++ HH+  ++  +L++   +CS I+  Y      + ++     L  I F   P +H    PEF+Y+GNMHGNEV GRELL++LA +LC +++ GN  ++ ++ +TRIH+LPSMNPDG++ A       N W  GR NA N+DLNRNFPDL   V K   +   + DH+   ++  + ++  E   V+ W+ SIPFV+S ++HGGD+V +YPYD S    + +  S TPD +VF+ L  +Y   +P M  +  S    +F  K GI NGA+WYS SGGM DF+YL TNCFE+TLE+GC KFP    LY  W  N +++++ I+  H GIKG V  + E G  P+ KA I          V+ I H +TT  +GDY+RLL+PG Y V A A G+ S++   +        A  ++F L+  D +N      P+ NE+
Sbjct:   25 IQFIHHSYSDMVRVLKKTAARCSQISKTY-----SIGRSYEGKDLLAIEFSAQPGQHKALTPEFRYIGNMHGNEVAGRELLIYLAQFLCSEYLLGNSRIQTLINTTRIHLLPSMNPDGYEHAAEEGAGYNGWTNGRLNAQNIDLNRNFPDLTSEVHKIIRMPMARLDHMPIPESYWDGKIAPEAKAVMKWMRSIPFVISGSLHGGDLVVSYPYDFSRHPLEEKMFSPTPDEKVFQMLVKTYVAAHPIMSDKSTSRCGGNFNNKGGIINGAEWYSFSGGMADFSYLHTNCFELTLELGCEKFPTEDELYSIWQNNKEAMLSLIEMVHRGIKGFV--KDEHG-NPIKKARI---------SVKGIRHDITTGEDGDYFRLLIPGSYIVSAEAFGY-SKVTKKITLPAKMLKAGRVDFALQRVDVKNL-----PIGNEL 437          
BLAST of carboxypeptidase E vs. Ensembl Xenopus
Match: cpz (carboxypeptidase Z [Source:NCBI gene;Acc:100170588])

HSP 1 Score: 315.849 bits (808), Expect = 4.792e-101
Identity = 170/413 (41.16%), Postives = 244/413 (59.08%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRT---RNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQ-DHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQA-SLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVL 1327
            I++ HH+  ++  +L++   +CS I+  Y      + ++     L  I F   P +H    PEF+Y+GNMHGNEV GRELL++LA +LC +++ GN  ++ ++ +TRIH+LPSMNPDG++ A       N W  GR NA N+DLNRNFPDL   V K   +   + DH+   ++  + ++  E   V+ W+ SIPFV+S ++HGGD+V +YPYD S    + +  S TPD +VF+ L  +Y   +P M  +  S    +F  K GI NGA+WYS SGGM DF+YL TNCFE+TLE+GC KFP    LY  W  N +++++ I+  H GIKG V  + E G  P+ KA I          V+ I H +TT  +GDY+RLL+PG Y V A A G+        VT +    AK+L
Sbjct:   25 IQFIHHSYSDMVRVLKKTAARCSQISKTY-----SIGRSYEGKDLLAIEFSAQPGQHKALTPEFRYIGNMHGNEVAGRELLIYLAQFLCSEYLLGNSRIQTLINTTRIHLLPSMNPDGYEHAAEEGAGYNGWTNGRLNAQNIDLNRNFPDLTSEVHKIIRMPMARLDHMPIPESYWDGKIAPEAKAVMKWMRSIPFVISGSLHGGDLVVSYPYDFSRHPLEEKMFSPTPDEKVFQMLVKTYVAAHPIMSDKSTSRCGGNFNNKGGIINGAEWYSFSGGMADFSYLHTNCFELTLELGCEKFPTEDELYSIWQNNKEAMLSLIEMVHRGIKGFV--KDEHG-NPIKKARI---------SVKGIRHDITTGEDGDYFRLLIPGSYIVSAEAFGYSK------VTKKITLPAKML 414          
BLAST of carboxypeptidase E vs. Ensembl Xenopus
Match: gli1 (GLI family zinc finger 1 [Source:Xenbase;Acc:XB-GENE-482644])

HSP 1 Score: 315.849 bits (808), Expect = 1.016e-100
Identity = 181/407 (44.47%), Postives = 248/407 (60.93%), Query Frame = 2
Query:   74 VFLVLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIA---NRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHL-LNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKST---VDG--KNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGF 1267
            +FL+ E +  + + HH   +L   L  + ++C  IT +Y      + ++V    LYVI F  +P  H    PEFKYVGNMHGNEV+GRELL+ LA++LC+++   NE V  ++++TRIHILPSMNPDG+++A       N ++ GR N   VDLNRNFPDL+ V++ N + G    HL L    +   ++E ET  +I W+ +  FVLSAN+HGG VVANYPYDKS    + G  ++  S TPD+ +FK LA +YS  +  M     +  N D    +GITNGA WYSL  GMQDFNYL TNCFEITLE+ C KFP  + L   W  N ++L+ +I   H GIKG++   + +G   +A AVI I+          I H VT+   GDY+RLL+PG Y V A+A G+
Sbjct:   11 LFLLCEVAASLSFFHHRYDDLVRALYNVQNQCPYITRVY-----SIGRSVQGRHLYVIEFSDNPGIHELLEPEFKYVGNMHGNEVLGRELLIQLAEFLCEEYRNNNERVTRLIQTTRIHILPSMNPDGYEVAADQGPEGNGYLTGRYNYRQVDLNRNFPDLNTVMYYNEKYGGPNHHLPLPDNWM--AQVEPETQAMIQWLKNYNFVLSANLHGGAVVANYPYDKSKEIRMRGFTRSTYSSTPDDALFKELAKTYSYAHGWM----HTGYNCDDFFYEGITNGASWYSLYKGMQDFNYLHTNCFEITLELSCDKFPREEELEQEWNGNREALLTYIDKVHQGIKGMITDENGNG---IANAVISISE---------IAHDVTSGIGGDYFRLLLPGTYEVTASAEGY 394          
BLAST of carboxypeptidase E vs. Ensembl Xenopus
Match: gli1 (GLI family zinc finger 1 [Source:Xenbase;Acc:XB-GENE-482644])

HSP 1 Score: 314.694 bits (805), Expect = 2.209e-100
Identity = 180/406 (44.33%), Postives = 246/406 (60.59%), Query Frame = 2
Query:   74 VFLVLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIA---NRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKST---VDG--KNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGF 1267
            +FL+ E +  + + HH   +L   L  + ++C  IT +Y      + ++V    LYVI F  +P  H    PEFKYVGNMHGNEV+GRELL+ LA++LC+++   NE V  ++++TRIHILPSMNPDG+++A       N ++ GR N   VDLNRNFPDL+ V++ N + G    HL         ++E ET  +I W+ +  FVLSAN+HGG VVANYPYDKS    + G  ++  S TPD+ +FK LA +YS  +  M     +  N D    +GITNGA WYSL  GMQDFNYL TNCFEITLE+ C KFP  + L   W  N ++L+ +I   H GIKG++   + +G   +A AVI I+          I H VT+   GDY+RLL+PG Y V A+A G+
Sbjct:   11 LFLLCEVAASLSFFHHRYDDLVRALYNVQNQCPYITRVY-----SIGRSVQGRHLYVIEFSDNPGIHELLEPEFKYVGNMHGNEVLGRELLIQLAEFLCEEYRNNNERVTRLIQTTRIHILPSMNPDGYEVAADQGPEGNGYLTGRYNYRQVDLNRNFPDLNTVMYYNEKYGGPNHHLPLPDNW-MAQVEPETQAMIQWLKNYNFVLSANLHGGAVVANYPYDKSKEIRMRGFTRSTYSSTPDDALFKELAKTYSYAHGWM----HTGYNCDDFFYEGITNGASWYSLYKGMQDFNYLHTNCFEITLELSCDKFPREEELEQEWNGNREALLTYIDKVHQGIKGMITDENGNG---IANAVISISE---------IAHDVTSGIGGDYFRLLLPGTYEVTASAEGY 394          
BLAST of carboxypeptidase E vs. Ensembl Mouse
Match: Cpe (carboxypeptidase E [Source:MGI Symbol;Acc:MGI:101932])

HSP 1 Score: 358.221 bits (918), Expect = 7.310e-117
Identity = 195/431 (45.24%), Postives = 270/431 (62.65%), Query Frame = 2
Query:   86 LEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLN--KKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFK-RKDSCPNSD----FLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKV-LNFRLE 1342
            L+    I + +H   EL+  L  +  +C++I+ +Y      V ++     L VI    +P  H PG PEFKY+GNMHGNE VGRELL+FLA YLC+++  GNE + N++ STRIHI+PS+NPDG++ A     E   W VGR+NA  +DLNRNFPDLD++V+ N + G   +HLL   KK +D++ +L  ET  VI WI  IPFVLSAN+HGGD+VANYPYD++     ++ S  PD+ +F+ LA +YS +NP M    +  C  +D    F+  DG TNG  WYS+ GGMQDFNYL++NCFEIT+E+ C KFP  + L  +W  N  SL+++++  H G+KG V  R   G  P+A A I          V+ I H VT+A +GDY+RLL PG Y + A+APG+ +  + V V     FS  V ++F LE
Sbjct:   43 LQQEDGISFEYHRYPELREALVSVWLQCTAISRIY-----TVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNLKKIVDQNSKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGTAHEYSSCPDDAIFQSLARAYSSFNPVMSDPNRPPCRKNDDDSSFV--DGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKSYWEDNKNSLISYLEQIHRGVKGFV--RDLQG-NPIANATI---------SVDGIDHDVTSAKDGDYWRLLAPGNYKLTASAPGYLAITKKVAVP----FSPAVGVDFELE 450          
BLAST of carboxypeptidase E vs. Ensembl Mouse
Match: Cpn1 (carboxypeptidase N, polypeptide 1 [Source:MGI Symbol;Acc:MGI:2135874])

HSP 1 Score: 335.109 bits (858), Expect = 3.338e-108
Identity = 199/462 (43.07%), Postives = 272/462 (58.87%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIA---NRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTV-----DGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPADSQNEVKTNNPLCNEIANELKQFKIVRSEKDMLVKEMKG 1465
            + +RHH   +L   L +++++C  IT LY     ++ ++V    LYV+ F   P  H P  PE KYVGNMHGNEV+GRELLL L+++LC++    N+ +  +++ TRIHILPSMNPDG+++A       + ++VGR NAN VDLNRNFPDL+   + NS+ G    HL       + ++E ET  VI WI S+ FVLSAN+HGG VVANYPYDKS         +   S TPD+E+F+ LA  YS Y      +  +C   D+ P DGITNGA WYSLS GMQDFNYL TNCFEITLE+ C KFP  + L   W+ N ++L+ F++  H GIKG+VL  + +    +  AVI +T +          H VT+   GDY+RLL+PG YSV A APG+  +   V V         V++F+L+ + SQ       P   +     KQ +  R +KD   K  +G
Sbjct:   21 VTFRHHRYDDLVRTLYKVHNQCPDITRLY-----NIGRSVKGRYLYVLEFSDYPGIHEPLEPEVKYVGNMHGNEVLGRELLLQLSEFLCEEFRNRNQRILRLIQDTRIHILPSMNPDGYEVAAAQGPNMSGYLVGRNNANGVDLNRNFPDLNTYFYYNSKNGGPNHHLPLPDNW-KSQVEPETRAVIQWIRSLNFVLSANMHGGAVVANYPYDKSLEHRFRGPHRTSNSPTPDDELFQTLAKVYS-YAHGWMHQGWNC--GDYFP-DGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPRQEELQREWLGNREALIQFLEQVHQGIKGMVLDENSNN---LTGAVISVTGIN---------HDVTSGEHGDYFRLLLPGTYSVTAKAPGYDPKTVTVTV---GPAGPTVVDFQLKRSSSQVYPVQRAPGRGQ-GGRAKQPRTSR-KKDPATKRHRG 455          
BLAST of carboxypeptidase E vs. Ensembl Mouse
Match: Cpz (carboxypeptidase Z [Source:MGI Symbol;Acc:MGI:88487])

HSP 1 Score: 329.717 bits (844), Expect = 9.381e-104
Identity = 174/419 (41.53%), Postives = 251/419 (59.90%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIA---NRTRNEWVVGRTNANNVDLNRNFPDLDKVVFK-NSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKST-VDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEP 1345
            I + HH+  ++  +L+R   +CS +   Y      + ++     L VI F   P +H    PE K +GN+HGNEV GRE+L++LA YLC +++ GN  ++ ++ +TRIH+LPSMNPDG+++A       N W  GR NA N+DLNRNFPDL    ++  S  G + DH+   +     ++  ET  ++ WI +IPFVLSA++HGGD+V +YP+D S     K   S TPD ++FK LA +Y+  +P M  R ++    +FL +  I NGA WYS +GGM DFNYL TNCFEIT+E+GC KFP  + LY  W  N + L+NF++  H GIKG+V   ++   KPV  A I +           I H VTTA +GDY+RLL PG + VIA APG+   ++ V +    + + +V +F L P
Sbjct:  188 IRFAHHSYAQMVRVLKRTAARCSQVAKTY-----SIGRSFEGKDLVVIEFSSRPGQHELMEPEVKLIGNIHGNEVAGREVLIYLAQYLCSEYLLGNPRIQRLLNTTRIHLLPSMNPDGYEVAAAEGAGYNGWTSGRQNAQNLDLNRNFPDLTSEYYRLASTRGVRTDHIPISQYYWWGKVAPETKAIMKWIQTIPFVLSASLHGGDLVVSYPFDFSKNPHEKKMFSPTPDEKMFKLLARAYADVHPMMMDRSENRCGGNFLKRGSIINGADWYSFTGGMSDFNYLHTNCFEITVELGCVKFPPEEALYGLWQQNKEPLLNFLEMVHRGIKGMV---TDKYGKPVKNARILVKG---------IRHDVTTAPDGDYWRLLPPGSHIVIAQAPGYSKVMKRVTIPLRMKKAGRV-DFILHP 588          
BLAST of carboxypeptidase E vs. Ensembl Mouse
Match: Cpd (carboxypeptidase D [Source:MGI Symbol;Acc:MGI:107265])

HSP 1 Score: 311.227 bits (796), Expect = 5.897e-92
Identity = 177/426 (41.55%), Postives = 254/426 (59.62%), Query Frame = 2
Query:  107 EYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPN---SDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRL--EPADSQNEVK 1369
            ++ HH+  +++  L R  ++  +IT LY L      K+V +  LYV+    +P  H PG PEFKY+GNMHGNEVVGRELLL L +YLC ++   +  V ++V STRIH++PSMNPDG++ +    +  VVGR N+NN DLNRNFPD    +                     +  + ET+ V++W+ + PFVLSAN+HGG +V NYPYD +   G    S +PD+ VF+ +ALSYSK N +MF+ +  C +   +++ P  GITNGA WY++ GGMQD+NYL TNCFE+T+E+GC K+P    L  +W  N +SL+ F++  H G+KG VL  ++   + +  A + +  +          H VTT   GDY+RLLVPG Y + A+A G+    + V V +E    A  +NF L    AD+ NE K
Sbjct:  499 DFHHHHFPDMEIFLRRFANEYPNITRLYSL-----GKSVESRELYVMEISDNPGVHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLC-KNFGTDPEVTDLVRSTRIHLMPSMNPDGYEKSQEGDSISVVGRNNSNNFDLNRNFPDQFVPI--------------------TEPTQPETIAVMSWVKAYPFVLSANLHGGSLVVNYPYDDNE-QGVATYSKSPDDAVFQQIALSYSKENSQMFQGR-PCKDMYLNEYFPH-GITNGASWYNVPGGMQDWNYLQTNCFEVTIELGCVKYPFENELPKYWEQNRRSLIQFMKQVHQGVKGFVLDATDG--RGILNATLSVAEIN---------HPVTTYKAGDYWRLLVPGTYKITASARGYNPVTKNVTVRSE---GAVQVNFTLVRSSADANNESK 881          

HSP 2 Score: 226.868 bits (577), Expect = 9.889e-63
Identity = 139/368 (37.77%), Postives = 201/368 (54.62%), Query Frame = 2
Query:  275 IPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANR-------TRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQA-SLTPDNEVFKFLALSYSKYNPRMFKRKDSCP-NSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKS-QIQCVLVTNESQFSAKVLNFRLEPA 1348
            +PG P+ K VGNMHG+E V R++L++LA  L   +  G+  +  ++ +T +++LPS+NPDG++ A         +      GR N+   DLNR+FPD     F   E            ++DE     E   +I WI    FVLS N+HGG VVA+YP+D S         S T D+EVF++LA +Y+  +P M   +  CP + D   KDGITNGA WY + GGMQD+NY+  NCFEITLE+ C K+P    L   W  N +SL+  I+  HIGIKG V          V  + ++   ++ AG    I H++TT   GD++RLLVPG Y++ A + G+    I  ++V    +  A  ++F L P 
Sbjct:  125 LPGRPQVKLVGNMHGDETVSRQVLVYLARELASGYRRGDPRLVRLLNTTDVYLLPSLNPDGFERAREGDCGLGDSGPPGTSGRDNSRGRDLNRSFPDQ----FSTGE----------PPSLDEVP---EVRALIDWIRRNKFVLSGNLHGGSVVASYPFDDSPEHKTTGLYSKTSDDEVFRYLAKAYASNHPIMKTGEPHCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQLRQEWENNRESLITLIEKVHIGIKGFV-------KDSVTGSGLENATISVAG----INHNITTGRFGDFHRLLVPGTYNLTALSTGYMPLTINNIMV---KEGPATEMDFSLRPT 461          

HSP 3 Score: 142.51 bits (358), Expect = 8.825e-35
Identity = 125/418 (29.90%), Postives = 199/418 (47.61%), Query Frame = 2
Query:   77 FLVLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPN-SDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVL 1327
            F++  +S    YR+H+  +L   L  +      IT+L  L      ++V    ++ +     P+   P  P+ ++V  +HGN  VG ELLL LA++LC  +   N  V  +V+ TRI I+PS+NPDG + A         G TNA+  DL+ +F          S   + +      K I E+ ++++            F LS  + GG V+  YPYDK     +N+       E  K LA  Y+  +P M   + SCPN SD     G+  GA+W+S  G M+D++    +C EIT+   C  FP    L   W  N KSL++ +   H G+ G+V  + ++G KP++KAVI +               V T   G ++ LL PG +++ A A G++ Q   V V +++  S  ++
Sbjct:  917 FMLSSSSDLALYRYHSYKDLSEFLRGLVMNYPHITNLTTL-----GQSVEYRHIWSLEISNKPNISEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNY-KRNPVVTQLVDRTRIVIVPSLNPDGRERAQEKDCTSKTGHTNAHGKDLDTDF---------TSNASQPE-----TKAIIENLIQKQD-----------FSLSIALDGGSVLVTYPYDKPVQTVENK-------ETLKHLASLYANNHPSMHMGQPSCPNNSDENIPGGVMRGAEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSAAQLPALWAENKKSLLSMLVEVHKGVHGLV--KDKAG-KPISKAVIVLNEGIK----------VYTKEGGYFHVLLAPGVHNINAIADGYQQQHTQVFVHHDAASSVVIV 1283          
BLAST of carboxypeptidase E vs. Ensembl Mouse
Match: Cpm (carboxypeptidase M [Source:MGI Symbol;Acc:MGI:1917824])

HSP 1 Score: 292.352 bits (747), Expect = 6.018e-92
Identity = 169/446 (37.89%), Postives = 250/446 (56.05%), Query Frame = 2
Query:   68 IFVFLVLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKN--QASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQ-FSAKVLNFRLEPADSQNEVKTNNPLCNEI 1396
            +++ L+L     +++R+H+   ++  L+ +    SSITHL+      + K+V    L+V+  G++P  H  GIPEFKYV NMHG+E VGRELLL L DYL   +    E + ++++STRIHI+PSMNPDG++   +    +  GR N NN DLNRNFPD     F+N+ + +                + ETL ++ W+ +  FVLSAN+HGG +VA+YP+D            SLTPD++VF+ LA +Y+  NP M K  D C N    P +GI NG  WY L GGMQD+NY+   CFEITLE+ C K+P  + L  FW  N  SL+ +I+  H+G+KG V  +S +   P+   ++++ +      + P      T   G+YY LL+PG Y +    PG  S +  + +  +SQ FSA   +F L      + +  +NP C  I
Sbjct:    6 LWLGLLLPVVAALDFRYHHQEGMEAFLKSVAQNYSSITHLH-----SIGKSVRGRNLWVLVVGQTPKEHRVGIPEFKYVANMHGDETVGRELLLHLIDYLVSSYRKDPE-ITHLIDSTRIHIMPSMNPDGFEAVQKPDCYYSNGRENYNNYDLNRNFPD----AFENNNVTK----------------QPETLAIMEWLKTETFVLSANLHGGALVASYPFDNGVQATGTLLSRSLTPDDDVFQHLAYTYASRNPNMTK-GDQCKNKRNFP-NGIINGYSWYPLQGGMQDYNYIWAQCFEITLELSCCKYPREEKLPLFWNDNKASLIEYIKQVHLGVKGQVFDQSGA---PLPNVIVEVQD---RKHICPF----RTNKLGEYYLLLLPGSYVINVTVPGHDSYLTKLTIPGKSQPFSALKKDFHLPLRWQPDSISVSNPSCPMI 413          
BLAST of carboxypeptidase E vs. UniProt/SwissProt
Match: sp|P37892|CBPE_LOPAM (Carboxypeptidase E OS=Lophius americanus OX=8073 GN=cpe PE=2 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 2.275e-118
Identity = 202/447 (45.19%), Postives = 275/447 (61.52%), Query Frame = 2
Query:   53 KYLCLIF-----VFLVLEASG---KIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLN--KKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFK-RKDSCP--NSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLE 1342
            K +C I      V  ++ A+G   +I + +H   EL+  L  +  +C +I  +Y      + ++     L V+    +P  H PG PEFKY+ NMHGNE VGRELL++LA YLC+Q+  GNE + +++ STRIH++PSMNPDG++ A     E   W VGR+NA  VDLNRNFPDLD++++ N   G   +HLL   KK +DE+ +L  ET  VI WI  IPFVLSAN+HGGDVVANYPYD++     ++ S +PD+ +FK LA ++S YNP M   ++  C   + D   KDGITNG  WYS+ GGMQDFNYL++NCFEITLE+ C KFP+   L  +W  N  SL+N+I+  H G+KG V  R   G  P+  A I          VE I H +TTA +GDY+RLL  G Y V A+APG+ + I+ V V +     A  ++F LE
Sbjct:    2 KQICSIVLLGAAVVSLVSAAGSDSEISFEYHRYEELRKALVSVWLQCPTIARIY-----TIGESFEGRELLVLEMSDNPGTHEPGEPEFKYIANMHGNEAVGRELLIYLAQYLCNQYQQGNETIIDLIHSTRIHLMPSMNPDGFEKAASQPGEIKDWFVGRSNAQGVDLNRNFPDLDRIIYTNEREGGANNHLLQNMKKAVDENTKLAPETKAVIHWIMEIPFVLSANLHGGDVVANYPYDETRTGSTHEYSASPDDVIFKSLAKAFSIYNPVMSDPQRPPCRKHDDDSSFKDGITNGGAWYSVPGGMQDFNYLSSNCFEITLELSCDKFPNEDTLKTYWEQNRNSLVNYIEQVHRGVKGYV--RDLQG-NPIFNATIS---------VEGIDHDITTAKDGDYWRLLRQGNYKVAASAPGYLTVIKKVAVPHS---PATRVDFELE 428          
BLAST of carboxypeptidase E vs. UniProt/SwissProt
Match: sp|A5A6K7|CBPE_PANTR (Carboxypeptidase E OS=Pan troglodytes OX=9598 GN=CPE PE=2 SV=1)

HSP 1 Score: 361.688 bits (927), Expect = 2.076e-117
Identity = 194/430 (45.12%), Postives = 270/430 (62.79%), Query Frame = 2
Query:   86 LEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLN--KKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMF-KRKDSC----PNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLE 1342
            L+    I + +H   EL+  L  +  +C++I+ +Y      V ++     L VI    +P  H PG PEFKY+GNMHGNE VGRELL+FLA YLC+++  GNE + N++ STRIHI+PS+NPDG++ A     E   W VGR+NA  +DLNRNFPDLD++V+ N + G   +HLL   KK +D++ +L  ET  VI WI  IPFVLSAN+HGGD+VANYPYD++     ++ S +PD+ +F+ LA +YS +NP M    +  C     +S F+  DG TNG  WYS+ GGMQDFNYL++NCFEIT+E+ C KFP  + L  +W  N  SL+++++  H G+KG V  R   G  P+A A I          VE I H VT+A +GDY+RLL+PG Y + A+APG+ +  + V V       A  ++F LE
Sbjct:   43 LQQEDGISFEYHRYPELREALVSVWLQCTAISRIY-----TVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCHKNDDDSSFV--DGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKNSLISYLEQIHRGVKGFV--RDLQG-NPIANATI---------SVEGIDHDVTSAKDGDYWRLLIPGNYKLTASAPGYLAVTKKVAVPYS---PAAGVDFELE 450          
BLAST of carboxypeptidase E vs. UniProt/SwissProt
Match: sp|P16870|CBPE_HUMAN (Carboxypeptidase E OS=Homo sapiens OX=9606 GN=CPE PE=1 SV=1)

HSP 1 Score: 361.303 bits (926), Expect = 2.492e-117
Identity = 194/430 (45.12%), Postives = 270/430 (62.79%), Query Frame = 2
Query:   86 LEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLN--KKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMF-KRKDSCPNSD----FLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLE 1342
            L+    I + +H   EL+  L  +  +C++I+ +Y      V ++     L VI    +P  H PG PEFKY+GNMHGNE VGRELL+FLA YLC+++  GNE + N++ STRIHI+PS+NPDG++ A     E   W VGR+NA  +DLNRNFPDLD++V+ N + G   +HLL   KK +D++ +L  ET  VI WI  IPFVLSAN+HGGD+VANYPYD++     ++ S +PD+ +F+ LA +YS +NP M    +  C  +D    F+  DG TNG  WYS+ GGMQDFNYL++NCFEIT+E+ C KFP  + L  +W  N  SL+++++  H G+KG V  R   G  P+A A I          VE I H VT+A +GDY+RLL+PG Y + A+APG+ +  + V V       A  ++F LE
Sbjct:   43 LQQEDGISFEYHRYPELREALVSVWLQCTAISRIY-----TVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNMKKIVDQNTKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGSAHEYSSSPDDAIFQSLARAYSSFNPAMSDPNRPPCRKNDDDSSFV--DGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKTYWEDNKNSLISYLEQIHRGVKGFV--RDLQG-NPIANATI---------SVEGIDHDVTSAKDGDYWRLLIPGNYKLTASAPGYLAITKKVAVPYS---PAAGVDFELE 450          
BLAST of carboxypeptidase E vs. UniProt/SwissProt
Match: sp|P15087|CBPE_RAT (Carboxypeptidase E OS=Rattus norvegicus OX=10116 GN=Cpe PE=1 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 4.000e-117
Identity = 197/431 (45.71%), Postives = 271/431 (62.88%), Query Frame = 2
Query:   86 LEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLN--KKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMF-KRKDSCPNSD----FLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKV-LNFRLE 1342
            L+    I + +H   EL+  L  +  +C++I+ +Y      V ++     L VI    +P  H PG PEFKY+GNMHGNE VGRELL+FLA YLC+++  GNE + N++ STRIHI+PS+NPDG++ A     E   W VGR+NA  +DLNRNFPDLD++V+ N + G   +HLL   KK +D++ +L  ET  VI WI  IPFVLSAN+HGGD+VANYPYD++     ++ S  PD+ +F+ LA +YS +NP M    +  C  +D    F+  DG TNG  WYS+ GGMQDFNYL++NCFEIT+E+ C KFP  + L  +W  N  SL+N+++  H G+KG V  R   G  P+A A I          V+ I H VT+A +GDY+RLLVPG Y + A+APG+ +  + V V     FS  V ++F LE
Sbjct:   43 LQQEDGISFEYHRYPELREALVSVWLQCTAISRIY-----TVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQRGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNLKKIVDQNSKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGTAHEYSSCPDDAIFQSLARAYSSFNPVMSDPNRPPCRKNDDDSSFV--DGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKSYWEDNKNSLINYLEQIHRGVKGFV--RDLQG-NPIANATIS---------VDGIDHDVTSAKDGDYWRLLVPGNYKLTASAPGYLAITKKVAVP----FSPAVGVDFELE 450          
BLAST of carboxypeptidase E vs. UniProt/SwissProt
Match: sp|Q00493|CBPE_MOUSE (Carboxypeptidase E OS=Mus musculus OX=10090 GN=Cpe PE=1 SV=2)

HSP 1 Score: 358.221 bits (918), Expect = 5.113e-116
Identity = 195/431 (45.24%), Postives = 270/431 (62.65%), Query Frame = 2
Query:   86 LEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLN--KKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFK-RKDSCPNSD----FLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKV-LNFRLE 1342
            L+    I + +H   EL+  L  +  +C++I+ +Y      V ++     L VI    +P  H PG PEFKY+GNMHGNE VGRELL+FLA YLC+++  GNE + N++ STRIHI+PS+NPDG++ A     E   W VGR+NA  +DLNRNFPDLD++V+ N + G   +HLL   KK +D++ +L  ET  VI WI  IPFVLSAN+HGGD+VANYPYD++     ++ S  PD+ +F+ LA +YS +NP M    +  C  +D    F+  DG TNG  WYS+ GGMQDFNYL++NCFEIT+E+ C KFP  + L  +W  N  SL+++++  H G+KG V  R   G  P+A A I          V+ I H VT+A +GDY+RLL PG Y + A+APG+ +  + V V     FS  V ++F LE
Sbjct:   43 LQQEDGISFEYHRYPELREALVSVWLQCTAISRIY-----TVGRSFEGRELLVIELSDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIFLAQYLCNEYQKGNETIVNLIHSTRIHIMPSLNPDGFEKAASQPGELKDWFVGRSNAQGIDLNRNFPDLDRIVYVNEKEGGPNNHLLKNLKKIVDQNSKLAPETKAVIHWIMDIPFVLSANLHGGDLVANYPYDETRSGTAHEYSSCPDDAIFQSLARAYSSFNPVMSDPNRPPCRKNDDDSSFV--DGTTNGGAWYSVPGGMQDFNYLSSNCFEITVELSCEKFPPEETLKSYWEDNKNSLISYLEQIHRGVKGFV--RDLQG-NPIANATI---------SVDGIDHDVTSAKDGDYWRLLAPGNYKLTASAPGYLAITKKVAVP----FSPAVGVDFELE 450          
BLAST of carboxypeptidase E vs. TrEMBL
Match: A0A1S3JWZ2 (carboxypeptidase E OS=Lingula unguis OX=7574 GN=LOC106176829 PE=4 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 1.219e-139
Identity = 215/440 (48.86%), Postives = 293/440 (66.59%), Query Frame = 2
Query:   59 LCLIFVFLVLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRT-----RNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDE--LERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSC----PNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEP 1345
            LC + + L  E S  +E +HHN  E+ + + +I+ KC  IT  Y L      KTV N  L V+    +P +H  G PEFKYVGNMHGNEVVGRELLL L DY+CDQ+ AGN+ +  ++ESTRIHI+PSMNPDGW+IA  +     + +W+ GR+NANNVDLNRNFPDLD++V++N E   K +H + +KT D+ +  ++ ET M + WI  +PFVLS+N+HGGD+VANYPYD+S      + S +PD+  F++LA SYS ++  M K  +SC     N  FL + G TNGA WYS++GGMQDFNYL TNCFEITLE+GC K+P    L  FW  N  +L+NF+  THIGIKG++  R     K +A A +K+ N+T+   +    H +T+A +GDY+RLL+PG Y V   APG+  Q +C+ VTN  +  AK ++F L+P
Sbjct:    7 LCSLAIVLFGECSS-VELKHHNYKEMLDYMVKIHKKCPEITRPYVLEG----KTVMNRSLAVLEMSDNPGKHEIGEPEFKYVGNMHGNEVVGRELLLALLDYMCDQYKAGNKTIVKLLESTRIHIMPSMNPDGWEIATESFKKTGKKDWLKGRSNANNVDLNRNFPDLDRIVYRNHE---KNNH-IKEKTHDQQKNPIQPETYMAMEWIQEVPFVLSSNLHGGDLVANYPYDESQSGAPQEYSKSPDDSTFRYLAESYSLWHATMAKPHESCDDMPDNEKFLKQKGTTNGAAWYSVAGGMQDFNYLRTNCFEITLELGCDKYPPENALPQFWEDNKDALINFMWQTHIGIKGVI--RDAQTKKGIASATVKVHNLTSDADIN---HDITSAHDGDYWRLLIPGSYMVTVTAPGYLPQTKCMEVTNPFRTEAKEVDFELQP 432          
BLAST of carboxypeptidase E vs. TrEMBL
Match: C7TYD8 (Carboxypeptidase N catalytic chain isoform 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_007774 PE=2 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 8.555e-135
Identity = 217/444 (48.87%), Postives = 286/444 (64.41%), Query Frame = 2
Query:   38 YYFMNKYLCLIFVFLVLEASGKIEYR-HHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVT-----NESQFSAKVLNFRLEPAD 1351
            YYF    L L F+  VL ++  I+++ HH+  +++ I  R+ +KC  I+ +YYL S   ++T + NRL VIA GK  DR   GIPEFKY+ NMHG+EVVGRELL+ LA YLCD+ ++ N +V  ++  TRIHILPSMNPDGW IA+  RN +  GR N+  VDLNR+FPDL K  F N + G   DH+     ID  + + ET MV+ W+    FVLSANIHGGD+VANYP+D+S + G +  S+TPDN  F  LA SY+  + RM K    C +SD    DGITNGAKWYSL+GGMQD+NYL TNCFEITLE+GC+K+PD   L  +W  N  +L+N+I   H GIKG V G  ES   P+  A+IK+TN+T +    PILH++ T   G+YYRLL  G+Y V A   GF+  + C+ V      N     AK ++F L P +
Sbjct:    2 YYF----LGLFFIQTVLCSTVTIKWQNHHSEADIERIFRRVVEKCPDISFMYYLTSDRANETENGNRLLVIALGKHADRSERGIPEFKYIANMHGDEVVGRELLIRLAVYLCDEFISQNAFVHKLLSKTRIHILPSMNPDGWDIASSNRNMYSFGRDNSKQVDLNRDFPDLTKKFFSNLQSGGPLDHI-QPDEIDVQKAQIETKMVMDWLDKFNFVLSANIHGGDLVANYPFDRS-ITGNSTESITPDNPTFVELAESYADLHHRMKKGIKECYDSDNYFNDGITNGAKWYSLNGGMQDYNYLHTNCFEITLELGCKKYPDASELPRYWNENKMALLNYIIQVHRGIKGTVYGYVESTLIPMENAIIKVTNITNSANPVPILHNINTDQFGNYYRLLTKGKYIVTALVDGFEPAVACIDVQHVPSINGPFIEAKQVDFLLLPTN 439          
BLAST of carboxypeptidase E vs. TrEMBL
Match: A0A3Q0KU19 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 1.365e-130
Identity = 213/435 (48.97%), Postives = 283/435 (65.06%), Query Frame = 2
Query:   65 LIFVFLVLEASGKIEYR-HHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLV-----TNESQFSAKVLNFRLEPAD 1351
            L FV  VL ++  I ++ HH+  +++ I+ R+ ++C  I++ YYL +G    T + NRL+VIAFG+  +    GIPEFKY+ NMHG+EVVGRELL+ LA YLCD+ ++ N ++  +V  TRIHILPSMNPDGW+IA   ++    GR N+  VDLNR+FPDL K  ++N   G   DHL     ID ++ + ET MV+ W+  I FVL AN+HGGD+VANYP+DKS + G +  S+TPDN  F  LA SY+  +PRM K    C +SD    DGITNGA+WYSL+GGMQD+NYL TN FEITLE+GC KFP+   L  +W  N  SL+N+I   H GIKG V G +E+ Y PV  A+IK+ N+T    + PILH++ T   GDYYRLL  G+Y V A+A GF   I CV V      N     A+ +NF L P +
Sbjct:    7 LFFVHTVLSSTISISWQNHHSQADIERIVGRVVERCPDISYAYYLTTGRTTTTQNGNRLFVIAFGRHANASERGIPEFKYIANMHGDEVVGRELLIRLAVYLCDEFISQNAFIHRLVNRTRIHILPSMNPDGWEIAASNKDFHEFGRGNSKRVDLNRDFPDLAKKFYRNLRNGGPLDHL-QPDEIDVEKAQIETRMVMEWLDKINFVLGANMHGGDLVANYPFDKS-ITGNSAESITPDNPTFVELAESYADKHPRMKKGIKKCYDSDNHFNDGITNGARWYSLNGGMQDYNYLHTNSFEITLELGCEKFPNASELPRYWNENKMSLLNYILQVHRGIKGTVYGYAENTYIPVENAIIKVANITDPTTLTPILHNINTDQFGDYYRLLTKGKYIVTASADGFIPAIACVDVHYTPSINGPFLEAQQVNFLLLPTN 439          
BLAST of carboxypeptidase E vs. TrEMBL
Match: A0A0V0J652 (Carboxypeptidase E (Fragment) OS=Schistocephalus solidus OX=70667 GN=CBPE PE=4 SV=1)

HSP 1 Score: 401.364 bits (1030), Expect = 5.534e-130
Identity = 204/418 (48.80%), Postives = 274/418 (65.55%), Query Frame = 2
Query:   47 MNKYLCLIFVFLVLEASGKIEY-RHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSC-PNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLV 1294
            MN+++ L+   +      KI +  HHNN EL  IL  ++ KC +I+ LYYL +GD + T   NRLYV+  G +P  H+P IPE K V NMHGNEVVGRELLL LA YLCD++  G+  V  +++ TRIH+LPSMNPDG++ A+      + GR NAN+VDLNRNFPD D++ F+ SE+ R     +  +       E ETLM+  W+  IPFVLSANIHGG +VANYP+D S +DG  + S +PD+  F+ LA SYSKYN  M  ++  C PN +F  K+GITNGA WYS+S GMQD+NY+ +NCFE+TLE+ C K+P    L +FW  N KSL+NFI   H G+KG+V GRS  G  P+A A I++ N+T       I H+VT+   GDY+RLL PG+Y + A  PG++  +  V +
Sbjct:   12 MNRFVVLVLCVVASCNGKKINWLEHHNNQELFEILNDVHRKCRNISELYYLTAGDRETTKLGNRLYVLVIGGNPKMHVPLIPEVKLVANMHGNEVVGRELLLRLAKYLCDKYKEGDGLVNWLIQHTRIHLLPSMNPDGYEQADEREKNGLSGRNNANDVDLNRNFPDSDQLAFQ-SEMDRNSRLEILAEYQRIPRPETETLMIEEWLREIPFVLSANIHGGALVANYPFDGS-IDGDTKPSPSPDDATFQALARSYSKYNMAMKTQRPKCAPNENF--KEGITNGAAWYSVSNGMQDYNYMESNCFELTLEISCEKYPSATKLPEFWKENRKSLLNFILQVHGGVKGMVYGRSADGQLPLADATIRVVNITDPDDPVHIRHYVTSNQNGDYFRLLRPGKYLIGAIKPGYEPMLINVTI 425          
BLAST of carboxypeptidase E vs. TrEMBL
Match: A0A158R4K0 (Peptidase_M14 domain-containing protein OS=Syphacia muris OX=451379 PE=4 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 7.004e-128
Identity = 210/419 (50.12%), Postives = 280/419 (66.83%), Query Frame = 2
Query:  113 RHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANR---TRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELG-RKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRK----DSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEP 1345
            ++H++ +LKNILE IN KC++ T LY + S     +V    LYVI    +P +HIP  PE KYV NMHGNE +GRELLL LA YLCD+ + GN+ +  +V ST IHILP+MNPDG++ A R   T   W+ GR NAN VDLNR+FPDLDKV ++ ++ G  + DHLL+    D  + + ET  V  W+ S+PFVLSANIH GD+VANYP+D +     NQ S +PD++ F+FLA +Y+K +  M K      D+ P   F  + GITNGAKWYS++GGMQDF+YLA+N FEITLEV C KFPD K L   W  N K+L+ FI   H GIKGIV    E+G +P+++AV+ + N+T    + PI H VTT   GDYYRLL PG+Y V+  A G++     V VTN ++ SA+++NF+L+P
Sbjct:   46 QYHDHEQLKNILENINKKCANYTELYSIGS-----SVEGRELYVITLSTTPGQHIPLKPEMKYVANMHGNEPIGRELLLRLASYLCDEILKGNKDILQLVNSTSIHILPTMNPDGFEAALRTDSTERNWMKGRKNANGVDLNRDFPDLDKVFYELTDTGVPRYDHLLD-LIRDTTKHQPETQAVGMWLLSLPFVLSANIHEGDLVANYPFDSAREPNVNQYSTSPDDKTFRFLAETYAKNHAHMAKNDHPPCDASPFDAFANQGGITNGAKWYSVAGGMQDFSYLASNAFEITLEVACNKFPDPKQLPQLWNENKKALIEFIWTVHSGIKGIV-SDEETG-EPISEAVVWVRNIT---DLTPIKHPVTTWLTGDYYRLLTPGKYQVLVTATGYEPATATVEVTNANRTSAQIVNFKLKP 453          
BLAST of carboxypeptidase E vs. Ensembl Cavefish
Match: cpe (carboxypeptidase E [Source:ZFIN;Acc:ZDB-GENE-090313-68])

HSP 1 Score: 347.821 bits (891), Expect = 2.254e-113
Identity = 196/423 (46.34%), Postives = 257/423 (60.76%), Query Frame = 2
Query:   92 ASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLN--KKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMF--KRKDSCPNSDFLP-KDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNF 1333
             SG I + +H   EL+  L  +  +C SI+ +Y      V ++     L V+    +P  H PG PEFKY+GNMHGNE VGRELL++LA YLC+++  GN+ + N++ STRIHI+PSMNPDG++ A     E   W VGRTNA  +DLNRNFPDLD++V+ N   G   +HLL   KK +DE+ +L  ET  VI WI  IPFVLSAN+HGGDVVANYPYD++     ++ S             +YS YNP M   KR     N D    K+GITNG  WYS+ GGMQDFNYL++NCFEITLE+ C KFP    L  +W  N  SL+N+++  H G+ G V  R   G  P++ A +          VE I H +TTA +GDY+RLL PG Y V A+APG+ + I+ V V   S  +A  L+F
Sbjct:   36 GSGGISFEYHRYEELRKALVAVWLQCPSISRIY-----TVGESSEGRELLVLEISDNPGVHEPGEPEFKYIGNMHGNEAVGRELLIYLAQYLCNEYQQGNDTIINLIHSTRIHIMPSMNPDGFEKAASQSGEMKDWFVGRTNAQGIDLNRNFPDLDRIVYMNEREGGANNHLLKNMKKAVDENTKLAPETKAVIHWIMDIPFVLSANLHGGDVVANYPYDETRSGSTHEYS-------------AYSVYNPVMSDPKRAPCRKNDDDSSFKEGITNGGAWYSVPGGMQDFNYLSSNCFEITLELSCDKFPPENTLKMYWDQNRNSLINYLEQVHRGVAGFV--RDLQG-NPISNASV---------SVEGIDHDLTTAKDGDYWRLLTPGNYKVSASAPGYLTVIKKVAV---SSTTATRLDF 425          
BLAST of carboxypeptidase E vs. Ensembl Cavefish
Match: cpn1 (carboxypeptidase N subunit 1 [Source:NCBI gene;Acc:103037340])

HSP 1 Score: 341.658 bits (875), Expect = 5.784e-111
Identity = 188/434 (43.32%), Postives = 268/434 (61.75%), Query Frame = 2
Query:   65 LIFVFLVLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTR---NEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKS---TVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPA 1348
            L+ V    EA    +++HH   E+   L  +  +C  IT +Y      + ++V    LYV+ F  SP  H    PEFKYVGNMHGNEV+GRELL+ L  +LC++++AGN+ + +++ +TRIHILPSMNPDG+++A R     N ++VGR N+  VDLNRNFPDL+ +++   E    Q+H L      E ++E ETL VI W+ +  F+LSAN+HGG VVANYP+DKS    + GK+  S TPD+++FK LA +YS  +  M K  +     D+  ++GITNGA WYSLS GMQDFNYL TNCFEITLE+ C KFP    L   W+ N ++L+++++  H GIKG+V   + +   P+  A I +  ++         H +TT  +GDY+RLL+PG Y+V A+A G++     V V       A  L+F L+PA
Sbjct:   10 LLLVLWAPEAQAIDDFQHHGYEEMVRALFSVQSQCPYITRIY-----SIGRSVEGRHLYVLEFSDSPGIHEALEPEFKYVGNMHGNEVLGRELLIHLCQFLCEEYLAGNQRITSLIHNTRIHILPSMNPDGYEVAARQGPEFNGYLVGRGNSREVDLNRNFPDLNGLMYY-YEKNNGQNHHLPLPDKWELQVEPETLAVIKWMQNYNFILSANLHGGAVVANYPFDKSREARIRGKSTYSATPDDKIFKKLAKAYSYAHSWMHKGWNC---GDYF-EEGITNGANWYSLSKGMQDFNYLYTNCFEITLELSCDKFPPASALSREWLANREALVSYMEQVHHGIKGMVYDENNN---PIGNAEISVAGIS---------HDITTGPDGDYFRLLLPGTYTVTASAAGYQPYSSTVTV---GPAEAIQLHFYLKPA 418          
BLAST of carboxypeptidase E vs. Ensembl Cavefish
Match: CPZ (carboxypeptidase Z [Source:NCBI gene;Acc:103025203])

HSP 1 Score: 330.872 bits (847), Expect = 2.793e-104
Identity = 181/438 (41.32%), Postives = 261/438 (59.59%), Query Frame = 2
Query:   83 VLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE-------------WVVG-RTNANNVDLNRNFPDLDKVVFKNSELGR-KQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVD-GKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPA 1348
             +E S  I++ HH+N ++ NIL++  ++CS I+  Y      + ++V    L VI F  +P  H+   PE KY+GNMHGNE +GRELL++LA YLC +++ GN  ++ ++ +TRIHILPSMNPDG+++A                   W +G R NA N+DLNRNFPDL  +V+    L R + DH+    +    ++  ET  V+ WI SIPFVLSAN HGGD+V +YPYD S      N  S TPD +VFK +A +Y+  +  M         ++F+ K GI NGA+WYS++GGM DFNYL TNCFEIT+E+GC KFP  + L+  W  N ++L+ ++++ H GIKG V      G        IK   V+  G    I H +TTA +GDY+RLL PG + V A+APG+   ++ V +    + + +V +F L+ A
Sbjct:  177 TMEPSTIIQFTHHSNTQMFNILKKTAEQCSHISRTY-----SIGQSVERRDLLVIEFSNNPGEHVLLEPEVKYIGNMHGNEAMGRELLIYLAQYLCSEYLLGNSRIQTLINTTRIHILPSMNPDGYELAYSELQSGFDTDYDEDAGFSWQIGGRYNAQNIDLNRNFPDLTSLVYNRRRLKRFRSDHIPIPDSYWLGKVAPETYAVMKWIRSIPFVLSANFHGGDLVVSYPYDFSKHPLETNMFSPTPDEQVFKQIARTYANAHATMSNHDTDRCGANFVDKGGIVNGAEWYSIAGGMADFNYLHTNCFEITVELGCDKFPVEEDLHTGWEENKEALLTYLESVHKGIKGFVKDEDGRG--------IKRATVSVRG----IRHEITTAEKGDYWRLLTPGIHIVTASAPGYTKAMKRVHLPTHMRKAGRV-DFILKKA 596          
BLAST of carboxypeptidase E vs. Ensembl Cavefish
Match: cpda (carboxypeptidase D [Source:NCBI gene;Acc:103034353])

HSP 1 Score: 325.094 bits (832), Expect = 2.949e-97
Identity = 177/393 (45.04%), Postives = 236/393 (60.05%), Query Frame = 2
Query:  107 EYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLP----KDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKS 1273
            E+RHH+  +++  +++ + K  SIT LY      + K+V N  L+V+    +P  H  G PEFKY+GNMHGNEVVGRELLL L +YLC  +    E V  +V +TRIHI+PSMNPDG+++A   ++E  VGR N+NN DLNRNFPD  K +                     D  + ET+ V+ W+   PFVLSAN+HGG +V NYP+D    DG +Q S +PD+ VF+ LA +YSK N  M K    CP     P    KDGITNGA+WY++ GGMQD+NY+ TNCFE+T+E+GC K+P    L  +W  N +SL+ FI   H G+KG+V           +K    I N T    VE I H VTT   GDY+RLLVPG+Y +  +A G+ S
Sbjct:  413 EFRHHHYSDMELFMQKFSSKYPSITRLY-----SIGKSVENRMLWVMEISDNPGEHEQGEPEFKYIGNMHGNEVVGRELLLNLIEYLCRNYGTDLE-VTQLVNTTRIHIMPSMNPDGYEVAQEGKDELRVGRNNSNNYDLNRNFPDQFKTI--------------------TDPRQPETIAVMDWVKRYPFVLSANLHGGSLVVNYPFDDDP-DGISQYSKSPDDAVFQMLATAYSKENTLMHK-GHPCPEIAVYPDEYFKDGITNGAQWYNVPGGMQDWNYINTNCFELTIELGCEKYPLADELPRYWEQNRRSLLQFIHQVHRGVKGLVTD---------SKDGTGIPNATIT--VEGIDHSVTTNKVGDYWRLLVPGKYHLTVSAQGYTS 766          

HSP 2 Score: 274.248 bits (700), Expect = 3.516e-79
Identity = 151/399 (37.84%), Postives = 231/399 (57.89%), Query Frame = 2
Query:   89 EASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWV-VGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCP-NSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQI 1279
            E  G+   ++++ +EL  IL+ +  K   I++L       + ++V    L+V+     P   +PG P+FKYVGNMHG+E V R++L++L ++L   +   +  V  ++ ST I+I+PSMNPDG++ A     +     R+NA +VDLNR+FPD                   +   + EDE   +T  V+ WI    FVLS N+HGG VVA+YP+D S + G +  S +PD+ +F++LA  Y++ NP M   K  CP +   + KDGITNGAKWY ++GGMQD+NYL+ NC EIT+E+ C K+P    L   W  N ++L+ +++  HIG++G V  R     KP++ A+I +  +          H+V+TA  GDYYRLL+PG Y++ A A G  + I
Sbjct:   44 EEPGETYSKYYSFVELSRILKSLAQKYPHISNL-----SSIGRSVQGRELWVMRISSEPAAQVPGKPKFKYVGNMHGDETVSRQVLVYLIEHLLTGY-GEDPRVNELINSTDIYIMPSMNPDGFERAVEGDCDGDDKARSNAKDVDLNRSFPDQ-----------------FSDINVSEDEAPEKT-AVMKWILENKFVLSGNLHGGTVVASYPFDDSALHGGSIYSESPDDSLFRYLARVYAENNPIMKTGKPKCPLDPSEMFKDGITNGAKWYDVAGGMQDYNYLSGNCLEITMELSCCKYPPAAQLQTEWENNREALLAYMEKVHIGVRGFV--REAGSGKPLSDAMIMVAGIN---------HNVSTAQFGDYYRLLLPGTYNITAVASGASTDI 407          

HSP 3 Score: 172.94 bits (437), Expect = 8.467e-45
Identity = 127/417 (30.46%), Postives = 198/417 (47.48%), Query Frame = 2
Query:   92 ASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLE 1342
             S  + YRH+   EL   L  +N    +IT L  L      +T+     + +     P+   P  P+ ++V  +HGN  VG ELLL  A +LC  +   N+ +  ++  TRI ILPS+NPDG ++A        VG TNAN  DL+ +F D                             + ET  V+  I    + LS  + GG V+  YPYDK     +N+++L       ++LA  Y+  +P M      CPNS     DG+   A+ +S  G M+DF+    +C EIT+   C  FP    L   W+ N KSL++ +   H G++GIV  + +SG KP+  A+I +      G V      V T+  G ++ LL PG +++ A A G++ Q Q V+V++    ++ V+ F ++
Sbjct:  834 TSTTLRYRHYK--ELSEFLRGLNFNFPNITSLQRLGQSAEYRTI-----WALEISNKPNVPEPSEPKIRFVAGIHGNAPVGTELLLEFAAHLCINY-GKNDAITRLINETRIVILPSINPDGRELAKEKECSSPVGMTNANGKDLDTDFFDP----------------------------QPETRAVMDLIQEKGYTLSVALDGGSVLVTYPYDKPVQPVENESTL-------RYLATVYANNHPTMHLGNTGCPNSMGNIPDGVLRAAEKHSHMGSMKDFSVDFGHCPEITVYTSCCLFPQADQLSVLWVENRKSLLSMLVEVHKGVRGIV--KDKSG-KPIVGAMIVLN-----GGV-----RVFTSEGGYFHALLAPGSHNIEAVAEGYQQQRQEVIVSSYEAANSIVIEFDMD 1194          
BLAST of carboxypeptidase E vs. Ensembl Cavefish
Match: cpz (carboxypeptidase Z-like [Source:NCBI gene;Acc:103032924])

HSP 1 Score: 311.997 bits (798), Expect = 6.107e-97
Identity = 166/425 (39.06%), Postives = 250/425 (58.82%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIA----------------NRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGR-KQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKST-VDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKV 1324
            +++ +H+N ++ NIL++   KC  I+  Y      + ++V    L VI F K+P +H    PE K +GNMHGNEV+GR+LL++LA YLC +++  NE ++ ++ +TRIH+LPSMNPDG+++A                    N W  GR NA N+DLNRNFPDL  + +        + DH+    +    ++  ET  V+ WI SIPFV+SA++HGG++V +YP+D S   + +   S TPD +VFK LA +Y+  +  M         + F  K GI NGA WYS +GGM DFNYL +NC E+T+E+GC KFP  + LY  W+ N ++L++F+++ H GIKGIV   + +G K    A+I +  +            VTTA +GDY+RLLVPG Y + A+APG+    + + + +  Q   +V
Sbjct:  182 LQFTYHSNAQMINILKKTAAKCPHISRTY-----SIGRSVDGKDLLVIEFSKNPGQHDLLEPEIKLIGNMHGNEVLGRQLLIYLAQYLCSEYLLANERIQTLINNTRIHLLPSMNPDGYELAASEVADSLDPENTNQEGHIYNGWTSGRANAQNIDLNRNFPDLTSIFYNRRRFRSIRNDHIPIPDSYWISKVAPETYAVMKWIRSIPFVISASLHGGELVISYPFDFSRHPEEEKMFSPTPDEQVFKQLARTYADAHATMSNNDTDRCGASFANKGGIINGALWYSFAGGMSDFNYLHSNCLELTVELGCDKFPAEEELYPEWLRNKEALLSFMESVHRGIKGIVKDGNGNGIK---GAIISVKGLR---------RDVTTAEDGDYWRLLVPGIYVISASAPGYSKVTKRIRLPHSMQKVGQV 589          
BLAST of carboxypeptidase E vs. Ensembl Sea Lamprey
Match: cpz (carboxypeptidase Z [Source:ZFIN;Acc:ZDB-GENE-090313-267])

HSP 1 Score: 298.516 bits (763), Expect = 8.231e-93
Identity = 166/431 (38.52%), Postives = 247/431 (57.31%), Query Frame = 2
Query:  113 RHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVV------GRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMF-KRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRL--EPADSQNEVKTNN 1378
            RH  + E+   L R    C     LY      + K+  N  L VI   ++P +H   +PE + VGN+HGNEV+GRELL+ LA +LC +   G+E VR ++ +TR+HILPSMNPDG+++A  + +  V       GR N  N+DLNRNFPDL   V +  +  R+   L       + ++  ET  VI W+   PFVL+ N+HGG+++  YPYD S + G+   S TP++++F+ LA +Y++ +P M  K K  CP     P  GI NGA+WYS  GGM DF+YL + C E+TLE+GC KFP G+ L   W  N ++L+ F++A H GIKG+V  R E G      A I    ++  G     L    TA  G+++RLL PG Y V A+  G+++ ++ V +    Q S +V +F+L  +P  + + V+ ++
Sbjct:  179 RHRRHAEMTRALRRAEKSCGGAARLY-----SIGKSFENRDLLVIELSENPGKHELLVPEVRLVGNIHGNEVLGRELLVALAQHLCARLEDGDERVRRLLNTTRLHILPSMNPDGYELAADSVSGSVANAADSSGRNNMQNIDLNRNFPDLTSGVLRRPK--RRTQPLPVPDQYWDGKVAPETRAVIDWMEEFPFVLAGNLHGGELLVRYPYDASLM-GEKFYSATPEDQMFRLLARTYAEAHPLMSDKHKAPCPGETGAPSGGIVNGAEWYSFRGGMPDFSYLHSGCLELTLELGCVKFPSGEDLPIEWAHNREALLTFVEAVHQGIKGVV--RDERG------AGIGGARISIKGN----LRDTVTAPSGEFWRLLPPGSYIVRASRAGYRAVVKRVRLPARLQTSGRV-DFKLPRQPGTTASPVEPHD 588          
BLAST of carboxypeptidase E vs. Ensembl Sea Lamprey
Match: CPXM2 (carboxypeptidase X, M14 family member 2 [Source:HGNC Symbol;Acc:HGNC:26977])

HSP 1 Score: 295.819 bits (756), Expect = 6.964e-92
Identity = 162/430 (37.67%), Postives = 240/430 (55.81%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELER-------ETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGK-NQASLTPDNEVFKFLALSYSKYNPRMF-KRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPADSQ 1357
            +++RHHN  E++ +++ +N+KC ++T +Y     ++ K+    +LY +    +P  H  G PEF+YV  +HGNE +GREL LFL ++LC ++  GN  +R +VE TRIH+LPS+NPDG++ A    +E   W  GR   N +DLN NFPDL+ V++     G     + N      D           ET  V++W+  IPFVL  N+HGG++V  YP+D +    + ++ S TPD ++F++LA  Y+  +  M    +  C   DF   +G+ NGA+W++++G M DF+YL TNCFE+T+E+ C KFP    L   W  N ++L+ F++  H GIKGIV      G   +  A+I          V+ I H VTTAS GDY+RLL PG Y V A   GF    Q   V  +    A   NF L   + Q
Sbjct:  179 LDFRHHNYKEMRLLMKIVNEKCPNVTRIY-----NIGKSHEGLKLYAMEISDNPGEHEIGEPEFRYVAGVHGNEALGRELTLFLMEFLCHEYNRGNPRIRRLVEETRIHLLPSVNPDGYEKAYEAGSELSGWTFGRWTRNGIDLNHNFPDLNSVLWDAENRGHVSHGVPNHHLPLPDWFHSRNATVAVETRAVVSWMEKIPFVLGGNLHGGELVVTYPFDAAREPWRAHEPSATPDEQIFRWLAFLYASTHRTMTDANRRVCHGQDFTKDEGVINGAEWHAVTGSMGDFSYLHTNCFEVTMELSCDKFPHETELPQEWENNREALLVFLEQVHRGIKGIVTDADGEG---IPNAIIS---------VDEINHDVTTASGGDYWRLLNPGEYRVTARKEGFVPAAQNCQVGYD--MGATRCNFTLHKTNRQ 589          
BLAST of carboxypeptidase E vs. Ensembl Nematostella
Match: EDO41722 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3G8])

HSP 1 Score: 327.791 bits (839), Expect = 5.566e-107
Identity = 177/400 (44.25%), Postives = 246/400 (61.50%), Query Frame = 2
Query:  110 YRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANR--TRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPK---DGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLV 1294
            ++HHN  E  + L+ ++ +  +IT LY      + K+V    L+VIA   +P++H PG PEFKY+ NMHGNEVVG+E+LL  A YLCD +   +E V   +++TR+H+LPSMNPDG+++A +   R  W++GR+N+ NVDLNRNFPD     FK+S                  E + ET  V+ WI  +PFVLSAN+HGG +VANYP+D S   GK++ S +PD++VF+ LA +YS+ +P M          +  P    DGITNGAKWYS+SGGMQD+NY+ +NCFEIT+E GC+KFP  + L  +W  N KSL++F+   HIG+KG V        K      I    ++  G  + I     TAS+GD++RLL PG Y V A A GF+ Q + V V
Sbjct:    1 FKHHNYDETLSFLKELHGQFPNITRLY-----SIGKSVEGRDLWVIALSSTPNKHEPGKPEFKYIANMHGNEVVGKEVLLTFAKYLCDNYKKDDE-VTKALDTTRVHLLPSMNPDGYELAFKGDNRKNWIIGRSNSKNVDLNRNFPDQ---FFKSST----------------GEPQPETKAVMKWIKEVPFVLSANLHGGSLVANYPFDDSP-SGKSEYSKSPDDDVFQSLAKAYSENHPTMHLDNPPWECPEVPPDHFNDGITNGAKWYSVSGGMQDYNYVHSNCFEITVEQGCKKFPAAEELPRYWKENKKSLLSFLDMVHIGVKGFV--------KDTQGVPIPGARISVEGHKKDIF----TASDGDFWRLLNPGDYKVTAFADGFEDQTKTVTV 362          
BLAST of carboxypeptidase E vs. Ensembl Nematostella
Match: EDO46958 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNN3])

HSP 1 Score: 306.22 bits (783), Expect = 9.268e-99
Identity = 179/416 (43.03%), Postives = 251/416 (60.34%), Query Frame = 2
Query:  110 YRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKD--SCPNSD---FLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLE 1342
            +RHHN  E+  +L++ + K ++IT LY     DV  +V N +L+V+    +P +H    PE KY  N+HGNEVVG+E+LL L  YLC  +   N+ + ++V+STRIHILPS+NPDG+++A + + +   G  NAN VDLNRNFPD     F  S  G  Q                ET  ++ WI S PFVLSA++H G +VANYPYD +   G++  S TPD++VF+ LA +YS+ +P M        CP+     F+  DGITNGA+WYS+SGGMQD+NY+ +N FEITLE+GC KFP+   L ++W  N ++L+ +I+ TH G+ G+V  R E G  P+  A I ITN           H V TA +GDY+R+LVPG Y V  +A GF+ + +   V   S   A  L+F L+
Sbjct:    4 FRHHNYEEMTWLLKKYSRKYTNITRLY-----DVGTSVQNRKLWVMEISDNPGKHEVKEPEMKYTANIHGNEVVGKEMLLHLIRYLCHNY-GVNKRITDLVDSTRIHILPSLNPDGYEMAAQ-KTKTHTGTKNANGVDLNRNFPDQ----FFPSTTGPPQP---------------ETRAIMDWIKSNPFVLSASLHSGSLVANYPYDDNP-SGQSLYSATPDDDVFRQLARAYSEAHPTMHLANSPWKCPDKQREHFI--DGITNGARWYSISGGMQDYNYVHSNAFEITLELGCEKFPNASALPEYWDENKEALLGYIEQTHRGVYGVV--RDEEG-DPIENARISITNRR---------HDVFTAKDGDYWRILVPGSYEVTVSARGFEHETKVASV---SPSKATSLDFTLK 375          
BLAST of carboxypeptidase E vs. Ensembl Nematostella
Match: EDO31956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWF6])

HSP 1 Score: 301.212 bits (770), Expect = 1.049e-96
Identity = 171/403 (42.43%), Postives = 236/403 (58.56%), Query Frame = 2
Query:  104 IEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQA-SLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGR--YSVIAAAPGFKSQIQCVLVTNE 1303
            + + HHN   +K +LE+ N +   IT LY      V KTV N  L V+     P +H  G PEFKY+GNMHGNEVV RE+LL L  YL   +   +E ++ +V+STRIHI+PSMNPDG++ A     + V GR NAN +DLNRNFPD         +   ++++         + L+ ET +V++WI S PFVLSAN+HGG +VANYP+D    +GK    S +PD+ +FK LA +Y+  +  M   K  CP        GITNGA WYS+SGGMQD+NYL +N FEITLEV C KFP    L DFW  N  +L+++I   H G+KG+V    ++  KP+  A I +   +         H V +A++GD++RL++P    YSV   APG+    + V V  +
Sbjct:    3 VPFVHHNYEAMKGLLEKFNKEYPDITRLY-----SVGKTVENRDLLVLEISDKPGKHEKGEPEFKYIGNMHGNEVVSREILLQLIGYLLKNYQENSE-LKKLVDSTRIHIMPSMNPDGYEKAVMGDCQGVTGRANANGIDLNRNFPD---------QFAERKEN---------NPLQPETKLVMSWIKSNPFVLSANLHGGSLVANYPFDDYDPNGKRSGDSPSPDDPLFKSLARTYADAHKTMHLNKPPCPGDPDQFDGGITNGAHWYSVSGGMQDYNYLHSNAFEITLEVSCCKFPAASTLSDFWDKNKPALLSYINRVHTGMKGVV---QDNMGKPIKDARIILEGNS---------HAVKSAADGDFWRLVLPRNKPYSVRVEAPGYNYLTKEVRVAED 369          
BLAST of carboxypeptidase E vs. Ensembl Nematostella
Match: EDO41344 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4K6])

HSP 1 Score: 318.931 bits (816), Expect = 2.009e-95
Identity = 182/415 (43.86%), Postives = 249/415 (60.00%), Query Frame = 2
Query:  110 YRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSD--FLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEP 1345
            ++HH + E+ + L+++++    IT LY         +V    L+V+    +P  H PG PEFKYVGNMHGNEVVGRE+LL L   LC+ +   +  +  +V+ TRIHI+PSMNPDG  ++     + V GR NA++VDLNRNFPD                     +  DED   E ET  +I W++  PFVLSAN+HGG VVANYP+D  T  G+ + S +PD+ VFK+LALSYS  +P M   K +CP +D   + K+GITNGA WY++ GGMQD+NYL +NCFEIT+E+ C K+P    L  FW  N  SL+ F+   HIG++G V  +S+SG + +  AVI          VE I HHV +  +GDY+RLL+ G Y + AAA G++ Q Q V+V       A   NF L+P
Sbjct:  425 FKHHTHKEMTSFLKKVHELYPHITRLY-----SAGYSVKGRELWVMEISDNPGTHEPGEPEFKYVGNMHGNEVVGREMLLLLIQVLCENYHRISS-ITALVDYTRIHIMPSMNPDGHAVSIEGDKQSVTGRPNAHHVDLNRNFPD---------------------QFSDEDGHQEPETKAIIKWLSEYPFVLSANLHGGSVVANYPFD-DTEYGEERYSKSPDDIVFKYLALSYSLAHPTMSNNKPACPETDPGEVFKNGITNGAAWYNVKGGMQDYNYLHSNCFEITVEMSCNKYPYRTQLQHFWNDNKVSLITFMAQVHIGVRGFV--KSDSG-ESIPNAVI---------SVEGINHHVLSGKDGDYWRLLLKGNYKLTAAAKGYQQQTQNVVVKRGLATEA---NFTLQP 796          

HSP 2 Score: 264.618 bits (675), Expect = 2.943e-76
Identity = 172/429 (40.09%), Postives = 242/429 (56.41%), Query Frame = 2
Query:  116 HHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQH-VAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKN-QASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPADSQN--EVKTNNPLCN 1390
            +HN  EL  +LE  + +   I  L+      V K+V N  L+ +     PD   PG P FKYVGNMHGNE VGR++L++L  YL + +   G+E +  +V ST I+I+PSMNPDG++ +     + +VGR N NNV+LNRNFPD                   N    D    + ET  VI WI   PFVLSAN+HGG +VA+YP+D +         S +PD+E+F+ LAL+YS+++  M   K+  P      K+GITNGA WY + GGMQD NYL +NCFEITLE+ C K+P+   L   W  N  +L+ +++  H GIKG V  RS +G   +  AV+ +  +           +VTTA  GD++RLLVPG Y+V+  APGF    +  ++  +S  SA  +NF L  +  Q+    K N+P+ N
Sbjct:    1 YHNYDELTRLLESYSKRYKKIARLH-----SVGKSVLNRHLWALQITDHPDIIEPGEPMFKYVGNMHGNEAVGRQILIYLVQYLLENYGKTGHERITKLVNSTNIYIMPSMNPDGFERSKELDCDGLVGRRNENNVNLNRNFPD----------------QFNNWLDYDVSNAQPETKAVIKWIYENPFVLSANLHGGSLVASYPFDSNRYHRPFWYYSKSPDDEIFRELALTYSRHHHTM---KNGDPRCHTHFKNGITNGAYWYDVPGGMQDINYLISNCFEITLELSCCKYPNSTELPKEWKNNKNALLTYMEEVHKGIKGFVRDRSGNG---IQGAVVHVLGIKK---------NVTTARHGDFWRLLVPGNYTVLVTAPGFHQAKRTDIIVEKS--SAIEVNFVLSKSSQQSGTNFKLNDPIDN 391          

HSP 3 Score: 125.176 bits (313), Expect = 9.707e-30
Identity = 95/396 (23.99%), Postives = 188/396 (47.47%), Query Frame = 2
Query:  116 HHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFP-DLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYD-KSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVT 1297
            +H+   +  +L+    KC  I     +R   + K+    +++ +    +P +  P  P    VG++ G++V+GRE+LL L  YLC+ + +    V  ++++TR+H++P+++ DG     + R     G+ ++NN D++++F  D+ +    N+ + R+ D +        D + R           +   L+ N+    +   YP + + T +   + + T D + F  +A +Y++ +P+M K    C  S     +GIT GA W  +   MQD+ YL  N  +++  V C K+P           N   ++NFI+ +H  + GI+       + P+  A +++ N      +              +Y++L PG+Y + A+APG+ +  + VL+T
Sbjct:  816 YHDYKTMTQMLQSYYLKCPGI-----IRLQSIGKSQEGRKIWSLEISVNPGQENPYKPNVGMVGSLQGSDVIGREMLLALVGYLCEGYKSKEARVVKLLQTTRLHVVPAVDVDG---NEKAREGDCQGKLDSNN-DISKSFYYDMPE----NTRMRRESDKI--------DSVSR-----------VKRGLNFNV----IFQLYPLNAQYTGNPHVKGATTSDEKTFIDIATTYARSHPKM-KLGHGCNGSIPQFANGITKGATWREMHYTMQDYAYLDMNILQLSFFVSCCKYPPIDSFESILKSNAIPMINFIKKSHQALTGII---QTFNHTPIHNASLRVHNSKIKIDI--------GLKNSSFYKILAPGKYILKASAPGYSTATKEVLIT 1163          

HSP 4 Score: 110.153 bits (274), Expect = 6.133e-25
Identity = 59/155 (38.06%), Postives = 84/155 (54.19%), Query Frame = 2
Query:   74 VFLVLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNF 538
            V   L A+ K  + HH   E+   ++ +  +C  I H+Y      +  +V   R++V+     P  H PG PEF YV  +HGNEVVG+E++L L  +LC  +   ++ V  +V+STR+H LP MNPDG  +A         GRTNA  VDL  NF
Sbjct: 1170 VMFTLHAAPK--FSHHQPDEIGKWMQTMAKRCPKIAHVY-----SIGMSVQFRRIWVMELSDKPGVHQPGKPEFSYVAGIHGNEVVGKEMVLLLIQHLCLSY-GKDDMVTRLVDSTRLHFLPLMNPDGGVVAQEGNCNSETGRTNARKVDLWTNF 1316          
BLAST of carboxypeptidase E vs. Ensembl Nematostella
Match: EDO46885 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNN4])

HSP 1 Score: 291.967 bits (746), Expect = 1.694e-93
Identity = 172/399 (43.11%), Postives = 240/399 (60.15%), Query Frame = 2
Query:  110 YRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIAN-RTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMF--KRKDSCPN---SDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCV 1288
            ++HHN  +L   L+  + K   IT LY      +  +V N +L+ +    +P +H PG PEFKY+ N+HGNEVVGRELLL L  YLC+ +   +E VR +V++TRIHILPS+NPDG+++A+ + +    +GR NA  VDLNRNFPD     F  S  G  Q                ET  V+ WI   PFVLSA++H G +VA YPYD S   G++  S TPD++VF+ +A +YS+ +P M     K +C N     F+  DGITNGA W+S+SGGMQD+NY+ +N FE+T+EVGC +FP    L  +W  N K L+  I   H G+ G V  ++  G +P+A A IK+++           H VT+A +GDY+RLLVPG Y V A+A G++ Q + V
Sbjct:    2 FQHHNYEKLTWFLKYFSLKYPDITRLY-----SIGYSVQNRKLWAMEISDNPGQHEPGEPEFKYIANIHGNEVVGRELLLQLIRYLCENY-ESHEKVRTLVDTTRIHILPSINPDGYELASVKGKTHKFIGRRNAYGVDLNRNFPDQ----FFPSSNGPPQP---------------ETRAVMNWIRDYPFVLSASLHSGALVALYPYDDSP-SGQSLYSATPDDDVFRHVAKTYSELHPVMHLANPKWNCSNVKEEHFI--DGITNGASWFSISGGMQDYNYVHSNDFEVTVEVGCERFPKEDQLEKYWKDNKKPLLELINQVHRGVHGFV--KNIQG-EPLANAFIKVSDRR---------HDVTSAKDGDYWRLLVPGSYEVTASATGYEPQTKLV 360          
BLAST of carboxypeptidase E vs. Ensembl Medaka
Match: cpe (carboxypeptidase E [Source:NCBI gene;Acc:101160712])

HSP 1 Score: 365.54 bits (937), Expect = 2.795e-120
Identity = 196/426 (46.01%), Postives = 264/426 (61.97%), Query Frame = 2
Query:   92 ASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLN--KKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFK-RKDSCP--NSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLE 1342
            + G+I + +H   EL+  L  +  +C ++T +Y        ++     L V+    +P  H PG PEFKY+ NMHGNE VGRELL++LA YLC+Q+  GNE + +++ +TRIH++PSMNPDG++ A     E   W VGR+NA  +DLNRNFPDLD++V+ N   G    HLL   KK +DE+ +L  ET  VI WI  IPFVLSAN+HGGDVVANYPYD++     ++ S +PD+  FK LA +YS YNP M   ++  C   + D   KDGITNG  WYS+ GGMQDFNYL++NCFEITLE+ C KFP    L  +W  N  SL+N+I+  H G+KG V  R   G  P++ A I          VE I H +T+A +GDY+R+L PG Y V A APG+ + I+ V V       A  ++F LE
Sbjct:   21 SDGEISFEYHRYDELRKALVSVWLQCPTVTRIY-----TTGESFEGRELLVLEMTDNPGTHEPGEPEFKYIANMHGNEAVGRELLIYLAQYLCNQYQQGNETIIDLIHNTRIHLMPSMNPDGFEKAASQPGEIKDWFVGRSNAQGIDLNRNFPDLDRIVYINEREGGANHHLLQNMKKAVDENPKLAPETKAVIHWIMDIPFVLSANLHGGDVVANYPYDETRTGSTHEYSASPDDVTFKSLAKAYSMYNPVMSDPQRPPCRKNDDDSSFKDGITNGGAWYSVPGGMQDFNYLSSNCFEITLELSCDKFPSEDTLKTYWEQNRNSLVNYIEQVHRGVKGFV--RDLQG-NPISNATIS---------VEGIDHDITSAKDGDYWRILAPGNYKVAATAPGYLTVIKKVAVPYS---PAARVDFELE 426          
BLAST of carboxypeptidase E vs. Ensembl Medaka
Match: cpe (carboxypeptidase E [Source:NCBI gene;Acc:101160712])

HSP 1 Score: 365.54 bits (937), Expect = 2.795e-120
Identity = 196/426 (46.01%), Postives = 264/426 (61.97%), Query Frame = 2
Query:   92 ASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNE---WVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLN--KKTIDED-ELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFK-RKDSCP--NSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLE 1342
            + G+I + +H   EL+  L  +  +C ++T +Y        ++     L V+    +P  H PG PEFKY+ NMHGNE VGRELL++LA YLC+Q+  GNE + +++ +TRIH++PSMNPDG++ A     E   W VGR+NA  +DLNRNFPDLD++V+ N   G    HLL   KK +DE+ +L  ET  VI WI  IPFVLSAN+HGGDVVANYPYD++     ++ S +PD+  FK LA +YS YNP M   ++  C   + D   KDGITNG  WYS+ GGMQDFNYL++NCFEITLE+ C KFP    L  +W  N  SL+N+I+  H G+KG V  R   G  P++ A I          VE I H +T+A +GDY+R+L PG Y V A APG+ + I+ V V       A  ++F LE
Sbjct:   21 SDGEISFEYHRYDELRKALVSVWLQCPTVTRIY-----TTGESFEGRELLVLEMTDNPGTHEPGEPEFKYIANMHGNEAVGRELLIYLAQYLCNQYQQGNETIIDLIHNTRIHLMPSMNPDGFEKAASQPGEIKDWFVGRSNAQGIDLNRNFPDLDRIVYINEREGGANHHLLQNMKKAVDENPKLAPETKAVIHWIMDIPFVLSANLHGGDVVANYPYDETRTGSTHEYSASPDDVTFKSLAKAYSMYNPVMSDPQRPPCRKNDDDSSFKDGITNGGAWYSVPGGMQDFNYLSSNCFEITLELSCDKFPSEDTLKTYWEQNRNSLVNYIEQVHRGVKGFV--RDLQG-NPISNATIS---------VEGIDHDITSAKDGDYWRILAPGNYKVAATAPGYLTVIKKVAVPYS---PAARVDFELE 426          
BLAST of carboxypeptidase E vs. Ensembl Medaka
Match: cpn1 (carboxypeptidase N subunit 1 [Source:NCBI gene;Acc:101156125])

HSP 1 Score: 333.569 bits (854), Expect = 6.918e-108
Identity = 187/424 (44.10%), Postives = 260/424 (61.32%), Query Frame = 2
Query:  107 EYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTR---NEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKS---TVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPADSQN 1360
            +++HH   E+   L  + ++C  IT +Y      + ++V    LYV+ F  +P  H    PEFKYVGNMHGNEV+GRELL+ LA +LC+++ A N+ +  ++  TRIHILPSMNPDG+++A R     N ++VGR NA  +DLNRNFPDL+ +++   E    ++H L      E ++E ETL VI W+ S  FVLSAN+HGG VVANYP+DKS    + G+   + TPD+++F+ LA +YS  +  M K  +     DF   +GITNGA WYSLS GMQDFNYL TNCFEITLE+ C KFP    L   WM N ++L+++I+  H GIKG+V   + +   P+ KA I +  +          H VT+  +GDY+RLL+PG Y+V A+APG+      V V       A  L+F L+ A  QN
Sbjct:   26 DFKHHRYEEMVRALFAVQNECPYITRIY-----SIGQSVEGRHLYVLEFSDNPGIHEALEPEFKYVGNMHGNEVLGRELLIKLAQFLCEEYQARNQRITRLIHDTRIHILPSMNPDGYEVAARQGPEFNGYLVGRGNAREIDLNRNFPDLNALMYY-YEKNNGRNHHLPLPDNWEQQVEPETLAVIKWMQSYNFVLSANLHGGAVVANYPFDKSRYPRIRGRTTHADTPDDKLFRKLARTYSYAHSWMHKGWNC---GDFF-DEGITNGASWYSLSKGMQDFNYLYTNCFEITLELSCNKFPPESTLPGEWMANREALVSYIEQVHHGIKGMVYDENNN---PIRKAEISVAGIN---------HDVTSGVDGDYFRLLLPGTYTVTASAPGYLPSTSTVTV---GPAEAIQLHFYLKKAKKQN 424          
BLAST of carboxypeptidase E vs. Ensembl Medaka
Match: cpn1 (carboxypeptidase N subunit 1 [Source:NCBI gene;Acc:101156125])

HSP 1 Score: 329.717 bits (844), Expect = 8.857e-107
Identity = 183/418 (43.78%), Postives = 257/418 (61.48%), Query Frame = 2
Query:  107 EYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTR---NEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKS---TVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLE 1342
            +++HH   E+   L  + ++C  IT +Y      + ++V    LYV+ F  +P  H    PEFKYVGNMHGNEV+GRELL+ LA +LC+++ A N+ +  ++  TRIHILPSMNPDG+++A R     N ++VGR NA  +DLNRNFPDL+ +++   E    ++H L      E ++E ETL VI W+ S  FVLSAN+HGG VVANYP+DKS    + G+   + TPD+++F+ LA +YS  +  M K  +     DF   +GITNGA WYSLS GMQDFNYL TNCFEITLE+ C KFP    L   WM N ++L+++I+  H GIKG+V   + +   P+ KA I +  +          H VT+  +GDY+RLL+PG Y+V A+APG+      V V       A+ +  RL+
Sbjct:   26 DFKHHRYEEMVRALFAVQNECPYITRIY-----SIGQSVEGRHLYVLEFSDNPGIHEALEPEFKYVGNMHGNEVLGRELLIKLAQFLCEEYQARNQRITRLIHDTRIHILPSMNPDGYEVAARQGPEFNGYLVGRGNAREIDLNRNFPDLNALMYY-YEKNNGRNHHLPLPDNWEQQVEPETLAVIKWMQSYNFVLSANLHGGAVVANYPFDKSRYPRIRGRTTHADTPDDKLFRKLARTYSYAHSWMHKGWNC---GDFF-DEGITNGASWYSLSKGMQDFNYLYTNCFEITLELSCNKFPPESTLPGEWMANREALVSYIEQVHHGIKGMVYDENNN---PIRKAEISVAGIN---------HDVTSGVDGDYFRLLLPGTYTVTASAPGYLPSTSTVTVG-----PAEAIQVRLQ 416          
BLAST of carboxypeptidase E vs. Ensembl Medaka
Match: cpda (carboxypeptidase D [Source:NCBI gene;Acc:101173725])

HSP 1 Score: 320.472 bits (820), Expect = 2.440e-95
Identity = 185/449 (41.20%), Postives = 262/449 (58.35%), Query Frame = 2
Query:  107 EYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELER-ETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPN--SDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRL----EPADSQN---EVKTNNPLCNEIANELKQFKI 1423
            E+RHHN  ++   L + + K  SITHL+      + ++V N  LYV+    +P  H  G PEFKYVGNMHGNEVVGRELLL L +YLC  +    E V  ++ +TRIHI+PSMNPDG+++A     +   GR N+NN DLNRNFPD                     + +D  E  + ET  V+ W+  +PFVLSAN+HGG +V NYP+D    DG ++ S +PD+ VF+ L+ +YS+ NP M      C +  S+ + +DGITNGA+WYS+ GGMQD+NY+ TNCFE+T+E+ C K+P    L  +W  NY++L+ FI   H G+KG V    +            I N T +  VE I H++TTA  GDY+RLLVPG YSV A+A G+K      ++   S+  A++++FRL    +  + Q       T NP   E+ + +K+  +
Sbjct:  482 EFRHHNYADMDLFLRKYSSKFPSITHLH-----SIGRSVENRELYVMVISDNPKVHEHGEPEFKYVGNMHGNEVVGRELLLNLIEYLCLNYGTDPE-VTELLNNTRIHIMPSMNPDGYEVAREGDVQGYKGRNNSNNFDLNRNFPD---------------------QFVDITEPRQPETTAVMNWLKMVPFVLSANLHGGSLVVNYPFDDD-ADGSSRYSKSPDDAVFQQLSRAYSQENPLM-HNGHPCKDLYSEDVFQDGITNGAQWYSVPGGMQDWNYVNTNCFEVTIELSCVKYPMAGDLPQYWEQNYRALLQFIHQVHTGVKGTVSDIGDG---------TGIPNATIS--VEGIKHNITTAHAGDYWRLLVPGTYSVTASAHGYKP---VTILATVSKDRAEIVDFRLTRLYQDGNGQTPSGPYPTQNPSEKELQSLIKELSL 887          

HSP 2 Score: 251.136 bits (640), Expect = 3.887e-71
Identity = 162/423 (38.30%), Postives = 232/423 (54.85%), Query Frame = 2
Query:  113 RHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVG----RTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQ-ASLTPDNEVFKFLALSYSKYNPRMFKRKDSCP-NSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFL-----YDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQ-IQCVLVTNESQFSAKVLNFRLEP 1345
            +++N IEL   L+++  +  +I +L       + ++V    L+V+     PD+  PG P+FKYVGNMHG+E V R++L++L +YL  ++   +  V  +V ST I+I+PSMNPDG++   R+R     G    R NA N DLNR+FPD                      T  + E   E + VI WI    FVLS N+HGG VVA+YP+D S    +    S + D+ +F++LAL+YS+ +P M   K +CP +S    +DGITNGA+WY + GGMQD+NY+  NC EIT+E+ C K P    L       F+  N KS     Q  HIG++G V          V+ A +   ++  AG    I H++TTA  GDYYRLL+PG Y++ A A G  S+ I+ V V    +  A  LNF L P
Sbjct:   41 KYYNYIELTERLQQLARRYPTIAYL-----SSIGQSVEGRELWVMRVTVDPDKETPGKPKFKYVGNMHGDETVSRQVLVYLVEYLLARY-GEDPRVTALVNSTDIYIMPSMNPDGFE---RSREGDCAGDHGGRNNARNKDLNRSFPDQ------------------YDGTSTDAETVPEVMAVIRWIQEKKFVLSGNLHGGTVVASYPFDDSAKHQRQGFYSQSADDALFRYLALAYSQKHPVMKTGKPNCPEDSSETFEDGITNGAQWYDVPGGMQDYNYIYGNCLEITMELSCCKHPPTNELPYMEKVQFYPNNRKSNFAVFQV-HIGVQGFVT-------DAVSGAPLSDVSIVVAG----IRHNLTTAKYGDYYRLLLPGTYNITAVAAGHLSKTIRNVQVI---EGEATKLNFTLAP 421          

HSP 3 Score: 154.451 bits (389), Expect = 1.053e-38
Identity = 119/422 (28.20%), Postives = 198/422 (46.92%), Query Frame = 2
Query:   80 LVLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPN-SDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLE 1342
            LV  ++    +R+ +  +L   L+ +      IT L+ L      ++V    ++ +     P    P  P  ++V  +HGN  VG E+LL  A +LC  +   N  +  ++ STRI I+PS+NPDG + A   +     G+ NAN  DL+ +F       F N+          +++ +   E + ET  ++ +I +  F LS  + GG +V  YPYDK     + + +L       K+LA  Y+  +P+M      C N +  +  DG+   A+  S  G M+DF+    NC EIT+  GC  FP    L   W  N K+L++ +   H G++G+V  R + G KP+  A+I I               V +   G ++ LL PG + + A A G++ +   V+V+  S  +A+ L F  +
Sbjct:  894 LVSSSATDSSFRYRSFRDLSAFLKGLTLNFPKITILHRL-----GQSVEFRNIFALEISNKPTEPEPSEPNIRFVAGIHGNAPVGTEMLLEFAAFLCINY-GKNPAITKLINSTRIFIVPSVNPDGREQAVEKQCTSAQGKNNANGKDLDTDF-------FGNA----------SQRVV---EPQPETKSMMNFIMNNKFTLSVALDGGSLVVTYPYDKPVQTVEKEGTL-------KYLASVYANNHPKMHLGDTGCSNNAQGIVPDGVILAAERQSHMGSMKDFSMDFGNCPEITVYTGCCFFPPADQLSTLWAENKKALLSMLVEVHKGVRGVV--RDKKG-KPIVGAIIVINGG----------RRVYSTEGGYFHALLAPGSHDIEAVADGYQQKHLKVVVS--SYEAARFLLFEFD 1267          
BLAST of carboxypeptidase E vs. Planmine SMEST
Match: SMESG000037720.1 (SMESG000037720.1)

HSP 1 Score: 990.334 bits (2559), Expect = 0.000e+0
Identity = 475/477 (99.58%), Postives = 476/477 (99.79%), Query Frame = 2
Query:   47 MNKYLCLIFVFLVLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPADSQNEVKTNNPLCNEIANELKQFKIVRSEKDMLVKEMKGDPAI 1477
            MNKYLCLIFVFLVLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELG KQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIK+TNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPADSQNEVKTNNPLCNEIANELKQFKIVRSEKDMLVKEMKGDPAI
Sbjct:    1 MNKYLCLIFVFLVLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGGKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKVTNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPADSQNEVKTNNPLCNEIANELKQFKIVRSEKDMLVKEMKGDPAI 477          
BLAST of carboxypeptidase E vs. Planmine SMEST
Match: SMESG000062760.1 (SMESG000062760.1)

HSP 1 Score: 303.138 bits (775), Expect = 4.629e-96
Identity = 159/432 (36.81%), Postives = 251/432 (58.10%), Query Frame = 2
Query:   68 IFVFLVLEASGKIEY----RHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRK--QDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEP--ILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRL 1339
            I V L+L ++  +      + H+N EL +I+ +I+ KC +IT +YYL+ GD+DKT+ +NRLYV  FGK P RH  GIPEF ++ N+HGNE++GRE  + +ADYLC++++  +E++  ++ S RIH L SMNPDG+ +       +  G  N    DLN +FPDL    FK  E       DHL  +K   E + +RETLM + W+ ++P+VL  N+H   +V NY Y +S    K   + TPD+ +++++   +   +P M + +  CP       + +  G+ W S+  G  DF+YL+TN     L + C++      +   W  +  SL+ + +  H+G+KG+V  R E G + +  AVIK  N+T +   EP  I+  + T   GDYYR+L+PG Y+++ +  G+K  I+C  V N  +FSAKV++F L
Sbjct:    5 ILVLLILVSTVAVYCFQLNKQHSNEELVDIMIKIHKKCPNITTMYYLKYGDIDKTIMHNRLYVTVFGKYPTRHTAGIPEFGWISNLHGNEIIGREFSILMADYLCNKYLERDEYITKLIYSMRIHFLSSMNPDGYLLRTDVYG-FGEGHNNYFFQDLNHDFPDLGTEFFKKLEKLEHNVTDHLFTRKKFLEKKYQRETLMTMNWLLTVPWVLQVNLHSATLVFNYGYQQSLDQYKRVYNPTPDDNIYRYIGSRFVARHPEMKEWRVRCPTYWLYVPNALQKGSTWLSVKNGWHDFSYLSTNLMGNNLFLSCQRNMLPANIQFHWRTSLPSLLYYFRQVHMGVKGVV--RDEEGNR-IVNAVIKTVNLTDS---EPYVIMRFLRTGELGDYYRILIPGDYAIMVSKQGYKPAIRCFKVDNLDKFSAKVIDFEL 429          
BLAST of carboxypeptidase E vs. Planmine SMEST
Match: SMESG000062760.1 (SMESG000062760.1)

HSP 1 Score: 293.893 bits (751), Expect = 6.043e-93
Identity = 150/400 (37.50%), Postives = 234/400 (58.50%), Query Frame = 2
Query:  152 RINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRK--QDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEP--ILHHVTTASEGDYYRLLVPGRYSVIAAAPGFKSQIQCVLVTNESQFSAKVLNFRL 1339
            +I+ KC +IT +YYL+ GD+DKT+ +NRLYV  FGK P RH  GIPEF ++ N+HGNE++GRE  + +ADYLC++++  +E++  ++ S RIH L SMNPDG+ +       +  G  N    DLN +FPDL    FK  E       DHL  +K   E + +RETLM + W+ ++P+VL  N+H   +V NY Y +S    K   + TPD+ +++++   +   +P M + +  CP       + +  G+ W S+  G  DF+YL+TN     L + C++      +   W  +  SL+ + +  H+G+KG+V  R E G + +  AVIK  N+T +   EP  I+  + T   GDYYR+L+PG Y+++ +  G+K  I+C  V N  +FSAKV++F L
Sbjct:    3 KIHKKCPNITTMYYLKYGDIDKTIMHNRLYVTVFGKYPTRHTAGIPEFGWISNLHGNEIIGREFSILMADYLCNKYLERDEYITKLIYSMRIHFLSSMNPDGYLLRTDVYG-FGEGHNNYFFQDLNHDFPDLGTEFFKKLEKLEHNVTDHLFTRKKFLEKKYQRETLMTMNWLLTVPWVLQVNLHSATLVFNYGYQQSLDQYKRVYNPTPDDNIYRYIGSRFVARHPEMKEWRVRCPTYWLYVPNALQKGSTWLSVKNGWHDFSYLSTNLMGNNLFLSCQRNMLPANIQFHWRTSLPSLLYYFRQVHMGVKGVV--RDEEGNR-IVNAVIKTVNLTDS---EPYVIMRFLRTGELGDYYRILIPGDYAIMVSKQGYKPAIRCFKVDNLDKFSAKVIDFEL 395          
BLAST of carboxypeptidase E vs. Planmine SMEST
Match: SMESG000073389.1 (SMESG000073389.1)

HSP 1 Score: 291.967 bits (746), Expect = 8.173e-89
Identity = 163/382 (42.67%), Postives = 223/382 (58.38%), Query Frame = 2
Query:  113 RHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETLMVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKN----QASLTPDNEVFKFLALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLATNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGRSESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSV 1246
            ++H  +EL N L+ I+    +IT LY      +  +V  N L+V+   K P  HIPG+PEFKY+GNMHGNEVVGRELL+ L +  C  +   N+ + + + +TRIHI+P+MNPDG++ +         GR+N NN DLNRNFPD  K                     ++ +LE ET  V+ WI    FVLSAN HGG +VANYP+D       N    + S +PD+++F  LA SYS  +  M K    CP       +GITNGAKWYS++GGMQD+NY+ +NCFEIT+EV C+K+P    L  +W  N  SL+NF+   H+G+KG V        +P++ A I          V+ I HH+ TA +GDY+RLL PG+YSV
Sbjct:   17 KYHTQVELTNFLKNIHSLYPTITRLY-----SIGNSVSGNPLWVMEISKKPGFHIPGVPEFKYIGNMHGNEVVGRELLIGLIELFCVNY-GKNDLLTSFINNTRIHIMPTMNPDGFKKSREGDFNGEFGRSNMNNKDLNRNFPDQFKK--------------------NDKQLEPETKAVMNWIRQYSFVLSANFHGGSLVANYPFDNYQSTNANAMQIRYSASPDDKLFIQLAKSYSMAHQNM-KIGGPCPGETEQFPNGITNGAKWYSVNGGMQDWNYMNSNCFEITVEVSCKKYPLKSELNRYWNQNKYSLINFMAQVHMGLKGFV--HDTISQRPISNATI---------NVKGINHHIFTAIDGDYWRLLTPGKYSV 360          
BLAST of carboxypeptidase E vs. Planmine SMEST
Match: SMESG000048042.1 (SMESG000048042.1)

HSP 1 Score: 52.373 bits (124), Expect = 7.871e-7
Identity = 39/161 (24.22%), Postives = 71/161 (44.10%), Query Frame = 2
Query:   74 VFLVLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYLRSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELLLFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVVGRTNAN-----NVDLNRNFP 541
            +F    +S  I Y  +  IE     E I +K   + +  +++ G+   T  N +L+++   K+       +P     G +H  E +     LF+ D L     +   W   I+   + +++P +NPDG++ ++ T   W   R+         VD+NRNFP
Sbjct:  118 LFRTGSSSDHIAYLRYQQIE-----EWIKEKVQGVNYAKFVKFGE---TYENRKLFMVKLSKND-----SLPIVWLDGGIHAREWIATSSALFIIDKLLRN--SSETW--EILSKYQFYVVPLVNPDGYEYSHETHRLWRKNRSRFTFSKCIGVDMNRNFP 261          
The following BLAST results are available for this feature:
BLAST of carboxypeptidase E vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CPE5.190e-11845.12carboxypeptidase E [Source:HGNC Symbol;Acc:HGNC:23... [more]
CPZ9.877e-10740.81carboxypeptidase Z [Source:HGNC Symbol;Acc:HGNC:23... [more]
CPN12.046e-10643.43carboxypeptidase N subunit 1 [Source:HGNC Symbol;A... [more]
CPZ3.859e-10540.81carboxypeptidase Z [Source:HGNC Symbol;Acc:HGNC:23... [more]
CPZ5.665e-10540.81carboxypeptidase Z [Source:HGNC Symbol;Acc:HGNC:23... [more]
back to top
BLAST of carboxypeptidase E vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egl-215.560e-11644.87Carboxypeptidase E [Source:UniProtKB/Swiss-Prot;A... [more]
egl-215.560e-11644.87Carboxypeptidase E [Source:UniProtKB/Swiss-Prot;A... [more]
egl-215.560e-11644.87Carboxypeptidase E [Source:UniProtKB/Swiss-Prot;A... [more]
cpd-21.109e-7736.36CarboxyPeptidase D family [Source:UniProtKB/TrEMB... [more]
cpd-21.109e-7736.36CarboxyPeptidase D family [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of carboxypeptidase E vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
svr3.161e-8044.32gene:FBgn0004648 transcript:FBtr0344737[more]
svr3.161e-8044.32gene:FBgn0004648 transcript:FBtr0070086[more]
svr1.529e-7837.05gene:FBgn0004648 transcript:FBtr0290017[more]
svr1.630e-7837.05gene:FBgn0004648 transcript:FBtr0344738[more]
svr1.630e-7837.05gene:FBgn0004648 transcript:FBtr0070081[more]
back to top
BLAST of carboxypeptidase E vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpe1.649e-11946.60carboxypeptidase E [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
cpe1.649e-11946.60carboxypeptidase E [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
cpn13.401e-10843.86carboxypeptidase N, polypeptide 1 [Source:ZFIN;Acc... [more]
cpn13.242e-10643.86carboxypeptidase N, polypeptide 1 [Source:ZFIN;Acc... [more]
cpz3.547e-9641.06carboxypeptidase Z [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
back to top
BLAST of carboxypeptidase E vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpe2.209e-11946.83carboxypeptidase E [Source:NCBI gene;Acc:100127580... [more]
cpz2.179e-10239.91carboxypeptidase Z [Source:NCBI gene;Acc:100170588... [more]
cpz4.792e-10141.16carboxypeptidase Z [Source:NCBI gene;Acc:100170588... [more]
gli11.016e-10044.47GLI family zinc finger 1 [Source:Xenbase;Acc:XB-GE... [more]
gli12.209e-10044.33GLI family zinc finger 1 [Source:Xenbase;Acc:XB-GE... [more]
back to top
BLAST of carboxypeptidase E vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cpe7.310e-11745.24carboxypeptidase E [Source:MGI Symbol;Acc:MGI:1019... [more]
Cpn13.338e-10843.07carboxypeptidase N, polypeptide 1 [Source:MGI Symb... [more]
Cpz9.381e-10441.53carboxypeptidase Z [Source:MGI Symbol;Acc:MGI:8848... [more]
Cpd5.897e-9241.55carboxypeptidase D [Source:MGI Symbol;Acc:MGI:1072... [more]
Cpm6.018e-9237.89carboxypeptidase M [Source:MGI Symbol;Acc:MGI:1917... [more]
back to top
BLAST of carboxypeptidase E vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P37892|CBPE_LOPAM2.275e-11845.19Carboxypeptidase E OS=Lophius americanus OX=8073 G... [more]
sp|A5A6K7|CBPE_PANTR2.076e-11745.12Carboxypeptidase E OS=Pan troglodytes OX=9598 GN=C... [more]
sp|P16870|CBPE_HUMAN2.492e-11745.12Carboxypeptidase E OS=Homo sapiens OX=9606 GN=CPE ... [more]
sp|P15087|CBPE_RAT4.000e-11745.71Carboxypeptidase E OS=Rattus norvegicus OX=10116 G... [more]
sp|Q00493|CBPE_MOUSE5.113e-11645.24Carboxypeptidase E OS=Mus musculus OX=10090 GN=Cpe... [more]
back to top
BLAST of carboxypeptidase E vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3JWZ21.219e-13948.86carboxypeptidase E OS=Lingula unguis OX=7574 GN=LO... [more]
C7TYD88.555e-13548.87Carboxypeptidase N catalytic chain isoform 2 OS=Sc... [more]
A0A3Q0KU191.365e-13048.97Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A0V0J6525.534e-13048.80Carboxypeptidase E (Fragment) OS=Schistocephalus s... [more]
A0A158R4K07.004e-12850.12Peptidase_M14 domain-containing protein OS=Syphaci... [more]
back to top
BLAST of carboxypeptidase E vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpe2.254e-11346.34carboxypeptidase E [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
cpn15.784e-11143.32carboxypeptidase N subunit 1 [Source:NCBI gene;Acc... [more]
CPZ2.793e-10441.32carboxypeptidase Z [Source:NCBI gene;Acc:103025203... [more]
cpda2.949e-9745.04carboxypeptidase D [Source:NCBI gene;Acc:103034353... [more]
cpz6.107e-9739.06carboxypeptidase Z-like [Source:NCBI gene;Acc:1030... [more]
back to top
BLAST of carboxypeptidase E vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cpz8.231e-9338.52carboxypeptidase Z [Source:ZFIN;Acc:ZDB-GENE-09031... [more]
CPXM26.964e-9237.67carboxypeptidase X, M14 family member 2 [Source:HG... [more]
back to top
BLAST of carboxypeptidase E vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of carboxypeptidase E vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO417225.566e-10744.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469589.268e-9943.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319561.049e-9642.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413442.009e-9543.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468851.694e-9343.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of carboxypeptidase E vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpe2.795e-12046.01carboxypeptidase E [Source:NCBI gene;Acc:101160712... [more]
cpe2.795e-12046.01carboxypeptidase E [Source:NCBI gene;Acc:101160712... [more]
cpn16.918e-10844.10carboxypeptidase N subunit 1 [Source:NCBI gene;Acc... [more]
cpn18.857e-10743.78carboxypeptidase N subunit 1 [Source:NCBI gene;Acc... [more]
cpda2.440e-9541.20carboxypeptidase D [Source:NCBI gene;Acc:101173725... [more]
back to top
BLAST of carboxypeptidase E vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037720.10.000e+099.58SMESG000037720.1[more]
SMESG000062760.14.629e-9636.81SMESG000062760.1[more]
SMESG000062760.16.043e-9337.50SMESG000062760.1[more]
SMESG000073389.18.173e-8942.67SMESG000073389.1[more]
SMESG000048042.17.871e-724.22SMESG000048042.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031739 ID=SMED30031739|Name=carboxypeptidase E|organism=Schmidtea mediterranea sexual|type=transcript|length=1904bp
TGTGAATTACTTTTAACAGCAAGCATTTAATTGTTATTATTATTTCATGA
ATAAATATCTATGCTTGATTTTCGTGTTTTTGGTATTGGAGGCCAGCGGT
AAAATCGAGTATCGGCATCACAACAACATTGAACTGAAAAACATTTTGGA
ACGGATCAATGATAAATGCAGCTCCATTACTCATTTGTATTATTTGAGAA
GTGGAGATGTCGACAAAACTGTCCACAATAATAGGCTCTATGTGATCGCA
TTCGGAAAATCTCCTGACAGACATATTCCAGGGATTCCCGAATTCAAATA
TGTTGGAAACATGCACGGAAATGAAGTTGTCGGTCGAGAGCTGCTGTTGT
TCCTAGCGGATTATTTATGCGATCAACATGTTGCTGGTAACGAGTGGGTC
AGAAACATTGTTGAAAGCACAAGGATTCACATTTTGCCATCAATGAATCC
CGACGGCTGGCAGATTGCAAATCGAACGAGAAATGAATGGGTTGTCGGAA
GGACCAATGCTAATAATGTCGATTTGAATCGGAATTTTCCGGATTTGGAC
AAAGTCGTGTTTAAAAATTCGGAGTTGGGAAGAAAGCAAGATCATCTTTT
GAATAAGAAAACCATTGACGAGGATGAGCTTGAACGGGAAACTCTGATGG
TGATAGCCTGGATTACCTCTATTCCGTTTGTCCTATCAGCTAATATTCAC
GGTGGTGATGTGGTGGCTAACTATCCATATGATAAATCGACTGTTGACGG
TAAAAATCAGGCTTCACTGACACCAGACAACGAAGTTTTCAAATTTTTAG
CTCTTTCGTACTCAAAGTACAATCCAAGAATGTTCAAGCGAAAAGATTCG
TGCCCAAATTCAGATTTCTTGCCGAAAGATGGTATAACCAATGGAGCAAA
ATGGTATTCATTAAGTGGAGGAATGCAAGATTTCAATTATTTAGCAACAA
ATTGCTTTGAAATAACTTTGGAAGTTGGATGCAGAAAATTCCCCGACGGG
AAGTTTCTATACGATTTTTGGATGTTGAATTACAAATCTCTAATGAATTT
CATTCAAGCCACCCACATTGGAATAAAAGGCATCGTTCTTGGTCGCAGTG
AGAGCGGATATAAACCAGTCGCCAAGGCGGTAATTAAGATTACGAATGTT
ACAGCTGCTGGTCAAGTCGAGCCGATATTACATCATGTAACTACAGCGAG
CGAAGGTGATTATTATCGGCTCTTGGTTCCCGGCCGTTATTCGGTAATAG
CTGCGGCACCGGGATTTAAATCTCAAATCCAATGTGTTCTGGTCACCAAT
GAAAGTCAATTTTCCGCTAAGGTTTTGAATTTTCGTTTGGAACCAGCAGA
CAGTCAAAATGAGGTTAAAACAAATAATCCTCTGTGCAATGAAATAGCGA
ATGAATTGAAACAATTCAAAATCGTACGATCCGAGAAAGATATGCTAGTA
AAAGAAATGAAAGGTGATCCAGCAATTTGATCTGATCAACTCAATCTTAT
GTCTAATTTCATCAATGCTGTAATTGTGATGTCTTCTTATTATTATTATT
ATTATCAAGTTGTCATCTGAATTTGACAAATGCCCACCTATTTTCATTGT
GGTTTCTTTATTGTGTTGTTTGACTTTTAATCTCTTGTCACTTGTTTGAT
GAAATGCTACTGAAACTTTTGCAAAATATTTTGTCGCATAATATTTTCAC
TAAATTCGATCTTTCCAATTGTAGTGATGTGTTTTGTCTCTAGTTTTGTC
TTTTTGTTCTGTCAGTTTGTTTAAGTGTATAGAGATGATTCCTTAAGTAA
GCTTATTTTGTTGCAGGTCTATAACGAGGTCATATTTTGTCAAATGGTTT
ATTGAAATATAATTATTATAGTAAATTGTATTTATTGGTGGATACCAACT
TTAC
back to top

protein sequence of SMED30031739-orf-1

>SMED30031739-orf-1 ID=SMED30031739-orf-1|Name=SMED30031739-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=478bp
MNKYLCLIFVFLVLEASGKIEYRHHNNIELKNILERINDKCSSITHLYYL
RSGDVDKTVHNNRLYVIAFGKSPDRHIPGIPEFKYVGNMHGNEVVGRELL
LFLADYLCDQHVAGNEWVRNIVESTRIHILPSMNPDGWQIANRTRNEWVV
GRTNANNVDLNRNFPDLDKVVFKNSELGRKQDHLLNKKTIDEDELERETL
MVIAWITSIPFVLSANIHGGDVVANYPYDKSTVDGKNQASLTPDNEVFKF
LALSYSKYNPRMFKRKDSCPNSDFLPKDGITNGAKWYSLSGGMQDFNYLA
TNCFEITLEVGCRKFPDGKFLYDFWMLNYKSLMNFIQATHIGIKGIVLGR
SESGYKPVAKAVIKITNVTAAGQVEPILHHVTTASEGDYYRLLVPGRYSV
IAAAPGFKSQIQCVLVTNESQFSAKVLNFRLEPADSQNEVKTNNPLCNEI
ANELKQFKIVRSEKDMLVKEMKGDPAI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004185serine-type carboxypeptidase activity
GO:0004181metallocarboxypeptidase activity
GO:0008270zinc ion binding
GO:0004180carboxypeptidase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR015567Pept_M14B_carboxypept_D2
IPR000834Peptidase_M14
IPR014766CarboxyPept_regulatory_dom
IPR008969CarboxyPept-like_regulatory
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000834Peptidase M14, carboxypeptidase APRINTSPR00765CRBOXYPTASEAcoord: 2..14
score: 31.51
coord: 127..140
score: 49.18
coord: 69..77
score: 70.94
IPR000834Peptidase M14, carboxypeptidase ASMARTSM00631zn_carbcoord: 60..361
e-value: 6.8E-25
score: 98.7
IPR000834Peptidase M14, carboxypeptidase APFAMPF00246Peptidase_M14coord: 1..233
e-value: 9.7E-54
score: 183.1
IPR000834Peptidase M14, carboxypeptidase APROSITEPS00133CARBOXYPEPT_ZN_2coord: 130..140
NoneNo IPR availablePFAMPF13620CarboxypepD_regcoord: 255..343
e-value: 3.9E-9
score: 36.7
NoneNo IPR availableGENE3DG3DSA:2.60.40.1120coord: 254..345
e-value: 2.2E-18
score: 67.9
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 1..253
e-value: 5.5E-78
score: 264.3
NoneNo IPR availablePANTHERPTHR11532PROTEASE M14 CARBOXYPEPTIDASEcoord: 1..382
NoneNo IPR availableCDDcd03858M14_CP_N-E_likecoord: 1..248
e-value: 1.44037E-121
score: 351.569
NoneNo IPR availableCDDcd11308Peptidase_M14NE-CP-C_likecoord: 254..343
e-value: 1.26972E-24
score: 94.128
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 1..254
IPR015567Peptidase M14B, caboxypeptidase DPANTHERPTHR11532:SF73CARBOXYPEPTIDASE Dcoord: 1..382
IPR008969Carboxypeptidase-like, regulatory domain superfamilySUPERFAMILYSSF49464Carboxypeptidase regulatory domain-likecoord: 254..353