SMED30031736

Overview
NameSMED30031736
Smed IDSMED30031736
Length (bp)1776
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30031736 (SMED30031736) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30031736 (SMED30031736) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30031736 (SMED30031736) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30031736 (SMED30031736) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031736

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30031736SMESG000019122.1 SmedASXL_014126SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031736SMESG000019122.1 dd_Smed_v4_8185_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031736SMESG000019122.1 dd_Smed_v4_8185_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031736SMESG000019122.1 dd_Smed_v4_8185_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30031736SMESG000019122.1 dd_Smed_v4_8185_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031736SMESG000019122.1 dd_Smed_v6_8185_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30031736SMESG000019122.1 dd_Smed_v4_8185_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031736SMESG000019122.1 dd_Smed_v4_8185_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30031736 vs. TrEMBL
Match: A0A1I8I3W0 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.645e-8
Identity = 77/314 (24.52%), Postives = 132/314 (42.04%), Query Frame = 3
Query:  633 PKATLQVDQYGFLQFNNNGNLIYFCGARNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCS-NAFPFQSDQCTPSDNIGVACSVSSLVQDPL--PIVVCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKINNIHIKDDQIFSPNCYITRNYIVIQG--PFSIKATSITDGTGSTDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFXXXXXXXXXXXXECYVTDGN----TKVYLIQNRC 1547
            P+  L + Q G L  +N G +   C A   FS  EA   C++LC   + +   + G  +T+  + P+   + L CPA ATS +DC  N +      CTP+  + V CS  SL   P+  P VVC      + +  T   +     +   Y   +C N  K+  S  +  +V    CN   T +  +VIY+    R    ++ +++    I    C I +   V     P +  A  IT G   T        +    F + +   +    G+ ++ R+     P+N+ L +  C+ +D +       Y+++N+C
Sbjct: 1865 PEEGLVLIQNGSLGGDNFGTI---CAAG--FSAIEAATICRMLCRNETANAIGMSGKYLTTAASYPVM-LSGLKCPAGATSTNDCKHNGWGAAPSYCTPNTAVSVRCSQISLTPPPIPAPFVVCHLYVANVFFTYTDVASASLLSLYGTYNETTC-NFTKNENSTTVWATVPYIGCNSVQTTNATHVIYTSMLYRNVTAVSGVYVDVPYIIPVECAIPKLKEVTAALLPDARTAPPITGGDSYTSEVKLYRSYNARGFSSEIAPGDRLVVGSRIYARVR-ETSPLNVRLTVRNCWASDKSDGTGASYYVVRNKC 2170          
BLAST of SMED30031736 vs. TrEMBL
Match: A0A1I8GSG7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 1.652e-8
Identity = 77/314 (24.52%), Postives = 132/314 (42.04%), Query Frame = 3
Query:  633 PKATLQVDQYGFLQFNNNGNLIYFCGARNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCS-NAFPFQSDQCTPSDNIGVACSVSSLVQDPL--PIVVCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKINNIHIKDDQIFSPNCYITRNYIVIQG--PFSIKATSITDGTGSTDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFXXXXXXXXXXXXECYVTDGN----TKVYLIQNRC 1547
            P+  L + Q G L  +N G +   C A   FS  EA   C++LC   + +   + G  +T+  + P+   + L CPA ATS +DC  N +      CTP+  + V CS  SL   P+  P VVC      + +  T   +     +   Y   +C N  K+  S  +  +V    CN   T +  +VIY+    R    ++ +++    I    C I +   V     P +  A  IT G   T        +    F + +   +    G+ ++ R+     P+N+ L +  C+ +D +       Y+++N+C
Sbjct: 1942 PEEGLVLIQNGSLGGDNFGTI---CAAG--FSAIEAATICRMLCRNETANAIGMSGKYLTTAASYPVM-LSGLKCPAGATSTNDCKHNGWGAAPSYCTPNTAVSVRCSQISLTPPPIPAPFVVCHLYVANVFFTYTDVASASLLSLYGTYNETTC-NFTKNENSTTVWATVPYIGCNSVQTTNATHVIYTSMLYRNVTAVSGVYVDVPYIIPVECAIPKLKEVTAALLPDARTAPPITGGDSYTSEVKLYRSYNARGFSSEIAPGDRLVVGSRIYARVR-ETSPLNVRLTVRNCWASDKSDGTGASYYVVRNKC 2247          
BLAST of SMED30031736 vs. TrEMBL
Match: A0A3R7CC15 (Deleted in malignant brain tumors 1 protein OS=Clonorchis sinensis OX=79923 GN=DMBT1 PE=4 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 3.406e-8
Identity = 118/528 (22.35%), Postives = 212/528 (40.15%), Query Frame = 3
Query:  156 KIFLMNYFLPILFMLDILGVIGQE------PGIRLIYFDPATKLYPGSNGVVILELNNGIKATICLNSSSVNDAQVACRSMNYXXXXXXXXXXXXXXXXXVKTKLAKTYFQNLQCNGD----EDSLEKCPGY----KFSNPVDFKCQNNNQDLSISCLYDYSFSKIKMPSE--------KCPKATLQV-------DQYGFLQFNN--NGNLIYFCGARNIFSTNEAQLFCKLLC--AENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQ-CTPSDNIGVACSVSSLVQDPL---PIVVCENNTLKLLWNRTIHPTILPTDVDIV-YLNASCNNVIKSNLSDVLILSVSLNDCNGDVT-GDLYNVIYSFGAKRTFPK-----INNIHIKDDQIFSPNCYITR-NYI---VIQGPFSIKATSITDGTGSTD-VTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFXXXXXXXXXXXXECYVT-----DGNTKVYLIQNRCPVLSTVQINP 1577
             +F +  FL  L++L I+ ++ Q+       GI+ + F P T LY      V+    NG   T+C        A VAC  M  T        S        +   ++    N  C G       SL     +     F++ V  +CQ++++  SI CL  Y+      P           C K +  +       D+ G +Q  +   G     C   +    + A+  C++LC  A+N    + +   +    + +PI   + + CP +AT L+ C+    + + + CT + ++G+ C+   +    +   P + C     ++ +++ ++P +  T + +V  +   C   +  N S +  + + L  C G ++  +  ++   F   R F       I+N  ++    FS  C I R N I   VI  P       ITD  G+T  V  SL +FLD  +   +        G  V+V++S  +P     L+L +C+ T         +  LI NRC     + ++P
Sbjct:   68 HLFKIMTFLRALYLL-IICILFQKIIDATIAGIKSVRFAPGTNLYEEGRDGVLEVYYNGTWGTVCNFGFDELAASVACFMMGLTPRGVAILNSP-------RRSDSQMLLSNFNCTGRLVLPSSSLSTATVHLGVCSFTDEVPERCQDSSRQTSIICLDTYTEMTTTTPVPNYMTVAPVDCSKPSSSIIRLVGGTDREGLVQIQHPETGEWGTICA--DGVDIHAARTLCRMLCTSADNLKYAQPVLYKHQEVDETVPI-HLSGIRCPEHATDLNQCTLGGGWGATRWCTHAMDVGLQCAPPQITAPAISYSPQLSCTRTDARVTYDKQVNPDLKTTMITLVGQVPVGCQFRVADNGSHIEAI-IPLEGCGGSLSLSNESDIAIKFELLRDFVAPSTGIISNFPVR----FSVTCLIPRINRIPSEVIASP-----QVITDLVGATQAVAASLKLFLDPAYSISVRQGQSIRPGQNVYVKVSLVDPKPVSKLILQDCWATISPERQSTPRQNLIINRCIAYDGLTVHP 574          
BLAST of SMED30031736 vs. TrEMBL
Match: A0A267F956 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024439g3 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 7.614e-8
Identity = 73/292 (25.00%), Postives = 125/292 (42.81%), Query Frame = 3
Query:  723 FSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCS-NAFPFQSDQCTPSDNIGVACSVSSLVQDPL--PIVVCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKINNIHIKDDQIFSPNCYITRNYIVIQG--PFSIKATSITDGTGSTDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFXXXXXXXXXXXXECYVT---DGNTKVY-LIQNRCPVLSTVQI 1571
            F  NEA +FC++LC   +T+   + G+  T     P+   + LSCPA ATS +DC+ N +   S  C+ +  + V C+  SL   P+  P V C N    + ++    P      +   Y  A+CN  +  N S+V  + +    CN   + +  +V Y+    +    +  +++    +    C I +   V     P +     +  G   T        ++  NF   +   +    GT V+VR+     P+NL LV+  C+ T   DG    Y L++++C    T  I
Sbjct:  110 FGVNEATMFCRMLCQNATTNAIGMTGLYRTVALAYPV-MLSGLSCPAGATSTNDCTHNGWGVASASCSQARAVTVRCAPVSLTAPPVPRPTVQCRNYQAFVYFSIADVPASWLLSLAGTYNAATCNFTVGQNGSNVWAI-IPYMGCNSVQSTNTTHVTYTSSLYKNVTMVGGVYLDTPYVMQIVCAIPKASDVTAALVPDARTVPPVESGDSYTSEVRIFRDYMSGNFRNEITPGSRLVVGTKVYVRVQV-TSPLNLRLVVNSCWATNRNDGTGSTYFLVKDKCASTGTTTI 398          
BLAST of SMED30031736 vs. TrEMBL
Match: A0A267GY16 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024439g1 PE=4 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 8.771e-8
Identity = 73/292 (25.00%), Postives = 125/292 (42.81%), Query Frame = 3
Query:  723 FSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCS-NAFPFQSDQCTPSDNIGVACSVSSLVQDPL--PIVVCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKINNIHIKDDQIFSPNCYITRNYIVIQG--PFSIKATSITDGTGSTDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFXXXXXXXXXXXXECYVT---DGNTKVY-LIQNRCPVLSTVQI 1571
            F  NEA +FC++LC   +T+   + G+  T     P+   + LSCPA ATS +DC+ N +   S  C+ +  + V C+  SL   P+  P V C N    + ++    P      +   Y  A+CN  +  N S+V  + +    CN   + +  +V Y+    +    +  +++    +    C I +   V     P +     +  G   T        ++  NF   +   +    GT V+VR+     P+NL LV+  C+ T   DG    Y L++++C    T  I
Sbjct:  201 FGVNEATMFCRMLCQNATTNAIGMTGLYRTVALAYPV-MLSGLSCPAGATSTNDCTHNGWGVASASCSQARAVTVRCAPVSLTAPPVPRPTVQCRNYQAFVYFSIADVPASWLLSLAGTYNAATCNFTVGQNGSNVWAI-IPYMGCNSVQSTNTTHVTYTSSLYKNVTMVGGVYLDTPYVMQIVCAIPKASDVTAALVPDARTVPPVESGDSYTSEVRIFRDYMSGNFRNEITPGSRLVVGTKVYVRVQV-TSPLNLRLVVNSCWATNRNDGTGSTYFLVKDKCASTGTTTI 489          
BLAST of SMED30031736 vs. Ensembl Medaka
Match: ENSORLT00000041321.1 (pep primary_assembly:ASM223467v1:20:9691535:9815960:1 gene:ENSORLG00000028284.1 transcript:ENSORLT00000041321.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 7.553e-8
Identity = 52/220 (23.64%), Postives = 92/220 (41.82%), Query Frame = 3
Query:  303 LNNGIKATICLNSSSVNDAQVACRSMNYXXXXXXXXXXXXXXXXXVKTKLAKTYFQNLQCNGDEDSLEKCP--GYKFSNPVDFKCQNNNQDLSISCLYDYSFSKIKMPSEKCPKATLQVDQYGFLQFNNNGNLIYFCGARNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQCTPSDNIGVACSV 956
            L++G+  T+C +  S+NDA+V CR ++        +A      +       K +  +++C+G E SL +C   GY   N       N+ +D  + C  +    ++      C    ++V Q        NG+    C   N +  N+A + CK +    + +     G    S Q        N++C  +  SL +CS+   F+  QC  S + GV C +
Sbjct:  670 LHDGVWGTVCHDKWSINDAKVVCRQLS------CGTALHAPRSALFGQGSDKIWLDDVECSGSESSLTQCGHNGYGKHNC------NHGEDAGVICSGEI---RLAGSGSTCCSGRVEVKQ--------NGSWATVC--YNGWDLNDANVVCKEMGCGPALTATESAGFGQGSGQIW----LKNVTCSGSEMSLTECSHRV-FEKHQCNHSKDAGVICQI 859          
BLAST of SMED30031736 vs. Ensembl Medaka
Match: ENSORLT00000027896.1 (pep primary_assembly:ASM223467v1:20:9689232:9803157:1 gene:ENSORLG00000028284.1 transcript:ENSORLT00000027896.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.6026 bits (122), Expect = 2.069e-6
Identity = 50/215 (23.26%), Postives = 88/215 (40.93%), Query Frame = 3
Query:  303 LNNGIKATICLNSSSVNDAQVACRSMNYXXXXXXXXXXXXXXXXXVKTKLAKTYFQNLQCNGDEDSLEKCP--GYKFSNPVDFKCQNNNQDLSISCLYDYSFSKIKMPSEKCPKATLQVDQYGFLQFNNNGNLIYFCGARNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQCTPSDNIG 941
            L++G+  T+C +  S+NDA+V CR ++        +A      +       K +  +++C+G E SL +C   GY   N       N+ +D  + C       ++      C    ++V Q        NG+    C   N +  N+A + CK +    + +     G    S Q        N++C  +  SL +CS+   F+  QC  S + G
Sbjct:  804 LHDGVWGTVCHDKWSINDAKVVCRQLS------CGTALHAPRSALFGQGSDKIWLDDVECSGSESSLTQCGHNGYGKHNC------NHGEDAGVICEI-----RLAGSGSTCCSGRVEVKQ--------NGSWATVC--YNGWDLNDANVVCKEMGCGPALTATESAGFGQGSGQIW----LKNVTCSGSEMSLTECSHRV-FEKHQCNHSKDAG 986          
BLAST of SMED30031736 vs. Planmine SMEST
Match: SMESG000019122.1 (SMESG000019122.1)

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 502/511 (98.24%), Postives = 506/511 (99.02%), Query Frame = 3
Query:  168 MNYFLPILFMLDILGVIGQEPGIRLIYFDPATKLYPGSNGVVILELNNGIKATICLNSSSVNDAQVACRSMNYXXXXXXXXXXXXXXXXXVKTKLAKTYFQNLQCNGDEDSLEKCPGYKFSNPVDFKCQNNNQDLSISCLYDYSFSKIKMPSEKCPKATLQVDQYGFLQFNNNGNLIYFCGARNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQCTPSDNIGVACSVSSLVQDPLPIVVCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKINNIHIKDDQIFSPNCYITRNYIVIQGPFSIKATSITDGTGSTDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFXXXXXXXXXXXXECYVTDGNTKVYLIQNRCPVLSTVQINPXXXXXXXXXXXXXXXXXXXXQNLVCQTSKCGKNEIGCITKC 1700
            MNYFLPILFMLDILGVIGQEPGIRLIYFDPATKLYPGSNGVVILELNNGIKATICLNSSSV DAQVACRSMNYTSSQKTSSASSFAFISSVKTKLAKTYFQNLQCNGDEDSLEKCPGYKFSNPVDFKCQNNNQDLSISCLYDYSFS IKMPS+KCP ATLQVDQYGFLQFNNNG+LIYFCG+RNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQCTPSDNIGVACSVSSLVQDPLPI VCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKINNI IKDDQIFSPNCYITRNYIVIQGPFSIKATSITDGTGSTDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISF+NPPVNLVLVLVECYVTDGNTKVYLIQNRCPVLSTVQINPISDSVSSFNFVSFSISGSSNQNLVCQTSKCGKNEIGCITKC
Sbjct:    1 MNYFLPILFMLDILGVIGQEPGIRLIYFDPATKLYPGSNGVVILELNNGIKATICLNSSSVKDAQVACRSMNYTSSQKTSSASSFAFISSVKTKLAKTYFQNLQCNGDEDSLEKCPGYKFSNPVDFKCQNNNQDLSISCLYDYSFSNIKMPSKKCPTATLQVDQYGFLQFNNNGSLIYFCGSRNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQCTPSDNIGVACSVSSLVQDPLPIAVCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKINNIQIKDDQIFSPNCYITRNYIVIQGPFSIKATSITDGTGSTDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFDNPPVNLVLVLVECYVTDGNTKVYLIQNRCPVLSTVQINPISDSVSSFNFVSFSISGSSNQNLVCQTSKCGKNEIGCITKC 511          
BLAST of SMED30031736 vs. Planmine SMEST
Match: SMESG000019122.1 (SMESG000019122.1)

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 493/502 (98.21%), Postives = 497/502 (99.00%), Query Frame = 3
Query:  195 MLDILGVIGQEPGIRLIYFDPATKLYPGSNGVVILELNNGIKATICLNSSSVNDAQVACRSMNYXXXXXXXXXXXXXXXXXVKTKLAKTYFQNLQCNGDEDSLEKCPGYKFSNPVDFKCQNNNQDLSISCLYDYSFSKIKMPSEKCPKATLQVDQYGFLQFNNNGNLIYFCGARNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQCTPSDNIGVACSVSSLVQDPLPIVVCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKINNIHIKDDQIFSPNCYITRNYIVIQGPFSIKATSITDGTGSTDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFXXXXXXXXXXXXECYVTDGNTKVYLIQNRCPVLSTVQINPXXXXXXXXXXXXXXXXXXXXQNLVCQTSKCGKNEIGCITKC 1700
            MLDILGVIGQEPGIRLIYFDPATKLYPGSNGVVILELNNGIKATICLNSSSV DAQVACRSMNYTSSQKTSSASSFAFISSVKTKLAKTYFQNLQCNGDEDSLEKCPGYKFSNPVDFKCQNNNQDLSISCLYDYSFS IKMPS+KCP ATLQVDQYGFLQFNNNG+LIYFCG+RNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQCTPSDNIGVACSVSSLVQDPLPI VCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKINNI IKDDQIFSPNCYITRNYIVIQGPFSIKATSITDGTGSTDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISF+NPPVNLVLVLVECYVTDGNTKVYLIQNRCPVLSTVQINPISDSVSSFNFVSFSISGSSNQNLVCQTSKCGKNEIGCITKC
Sbjct:    1 MLDILGVIGQEPGIRLIYFDPATKLYPGSNGVVILELNNGIKATICLNSSSVKDAQVACRSMNYTSSQKTSSASSFAFISSVKTKLAKTYFQNLQCNGDEDSLEKCPGYKFSNPVDFKCQNNNQDLSISCLYDYSFSNIKMPSKKCPTATLQVDQYGFLQFNNNGSLIYFCGSRNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQCTPSDNIGVACSVSSLVQDPLPIAVCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKINNIQIKDDQIFSPNCYITRNYIVIQGPFSIKATSITDGTGSTDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFDNPPVNLVLVLVECYVTDGNTKVYLIQNRCPVLSTVQINPISDSVSSFNFVSFSISGSSNQNLVCQTSKCGKNEIGCITKC 502          
BLAST of SMED30031736 vs. Planmine SMEST
Match: SMESG000001182.1 (SMESG000001182.1)

HSP 1 Score: 243.047 bits (619), Expect = 4.176e-73
Identity = 177/512 (34.57%), Postives = 266/512 (51.95%), Query Frame = 3
Query:  189 LFMLDILGVIG-QEPGIRLIYFDPATKLYPGS-NGVVILELNNGIKATICLN-SSSVNDAQVACRSMNYXXXXXXXXXXXXXXXXXVKTKLAKTYFQNLQCNGDEDSLEKCPGYKFSNPVDFKCQNNNQDLSISCLYDYSF--SKIKMPSEKCPKATLQVDQYGFLQFNNNGNLIYFCGARNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQCTPSDNIGVACSVSSLVQDPLPIVVCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKI-NNIHIKDDQIFSPNCYITRNYIVIQGPFSIKATSITDGTGS-TDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFXXXXXXXXXXXXECYVTDGNTKVYLIQNRCPVLSTVQINPXXXXXXXXXXXXXXXXXXXXQNLV-CQTSKCGKNEIGCITKC 1700
            +F +D+  ++      I+ IYFDP T +     +GV+++E   GI++TIC+N  S+  +A+V CR M Y       SA +        T    T+FQN++C+G E +L+ C G+++ +  DF C N+NQD+ + CL  + F  S I +    C    L     GF+       L        IF     Q        E+++  RII+G          IGGF N+ CP+NA SL +C N +P+ +++CTPSDNIG+ CS +  + D  P V C + TL L WN+TIH  I P  V+++  N  C+NV    +   + LSV   +C     GD   +IYSF  KRT+PK+ NNI IK+DQ +   C I+R        FSI AT+     G+ T +  ++ +  +  F   L N+     G+ +FV+++  NPP  LV  L  C++  GN K  LI N+CP    V I+PI +    F+F SF+I  +++   + C TS CG+   GCI  C
Sbjct:    4 VFNIDLFDILTTSHSDIKQIYFDPETTMSESKQDGVIVVETLTGIRSTICMNVESATQNAEVICRMMGYKEIIGKPSAVALISSKK-STFSNGTFFQNVKCSGSEKNLKDCSGFRYYHKTDFICSNHNQDMHVFCLGQHKFVNSTINLLKSNC-TGNLFAIHSGFIALFKQ--LFMLVAILEIFHLQYLQ--------EDTSYARIIEGFYSPGAS---IGGFKNMKCPSNANSLSECVNVYPYDNERCTPSDNIGLICSYNPDITDANPQVHCNSTTLSLFWNKTIHEEIKPEFVNVMENNKPCSNV---RIDSSVKLSVDYINCGMAKQGDKDKIIYSFQVKRTYPKLNNNIIIKNDQFYQVQCLISRFDNTTTADFSISATADLPIIGNDTPIPTTMIVSANDRFYPNLLNIKDVEIGSEIFVKVTLINPPSQLVPFLDSCWIESGNVKEPLILNKCPARQKVLISPIDNVTIMFSFKSFAIGSTADSAFIKCVTSLCGRQSTGCIPTC 497          
BLAST of SMED30031736 vs. Planmine SMEST
Match: SMESG000001182.1 (SMESG000001182.1)

HSP 1 Score: 243.047 bits (619), Expect = 4.483e-73
Identity = 177/512 (34.57%), Postives = 266/512 (51.95%), Query Frame = 3
Query:  189 LFMLDILGVIG-QEPGIRLIYFDPATKLYPGS-NGVVILELNNGIKATICLN-SSSVNDAQVACRSMNYXXXXXXXXXXXXXXXXXVKTKLAKTYFQNLQCNGDEDSLEKCPGYKFSNPVDFKCQNNNQDLSISCLYDYSF--SKIKMPSEKCPKATLQVDQYGFLQFNNNGNLIYFCGARNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQCTPSDNIGVACSVSSLVQDPLPIVVCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKI-NNIHIKDDQIFSPNCYITRNYIVIQGPFSIKATSITDGTGS-TDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFXXXXXXXXXXXXECYVTDGNTKVYLIQNRCPVLSTVQINPXXXXXXXXXXXXXXXXXXXXQNLV-CQTSKCGKNEIGCITKC 1700
            +F +D+  ++      I+ IYFDP T +     +GV+++E   GI++TIC+N  S+  +A+V CR M Y       SA +        T    T+FQN++C+G E +L+ C G+++ +  DF C N+NQD+ + CL  + F  S I +    C    L     GF+       L        IF     Q        E+++  RII+G          IGGF N+ CP+NA SL +C N +P+ +++CTPSDNIG+ CS +  + D  P V C + TL L WN+TIH  I P  V+++  N  C+NV    +   + LSV   +C     GD   +IYSF  KRT+PK+ NNI IK+DQ +   C I+R        FSI AT+     G+ T +  ++ +  +  F   L N+     G+ +FV+++  NPP  LV  L  C++  GN K  LI N+CP    V I+PI +    F+F SF+I  +++   + C TS CG+   GCI  C
Sbjct:    6 VFNIDLFDILTTSHSDIKQIYFDPETTMSESKQDGVIVVETLTGIRSTICMNVESATQNAEVICRMMGYKEIIGKPSAVALISSKK-STFSNGTFFQNVKCSGSEKNLKDCSGFRYYHKTDFICSNHNQDMHVFCLGQHKFVNSTINLLKSNC-TGNLFAIHSGFIALFKQ--LFMLVAILEIFHLQYLQ--------EDTSYARIIEGFYSPGAS---IGGFKNMKCPSNANSLSECVNVYPYDNERCTPSDNIGLICSYNPDITDANPQVHCNSTTLSLFWNKTIHEEIKPEFVNVMENNKPCSNV---RIDSSVKLSVDYINCGMAKQGDKDKIIYSFQVKRTYPKLNNNIIIKNDQFYQVQCLISRFDNTTTADFSISATADLPIIGNDTPIPTTMIVSANDRFYPNLLNIKDVEIGSEIFVKVTLINPPSQLVPFLDSCWIESGNVKEPLILNKCPARQKVLISPIDNVTIMFSFKSFAIGSTADSAFIKCVTSLCGRQSTGCIPTC 499          
BLAST of SMED30031736 vs. Planmine SMEST
Match: SMESG000052890.1 (SMESG000052890.1)

HSP 1 Score: 240.35 bits (612), Expect = 2.499e-72
Identity = 177/510 (34.71%), Postives = 265/510 (51.96%), Query Frame = 3
Query:  189 LFMLDILGVIG-QEPGIRLIYFDPATKLYPGS-NGVVILELNNGIKATICLN-SSSVNDAQVACRSMNYXXXXXXXXXXXXXXXXXVKTKLAKTYFQNLQCNGDEDSLEKCPGYKFSNPVDFKCQNNNQDLSISCLYDYSFSKIKMPSEKCPKATLQVDQYGFLQFNNNGNLIYFCGARNIFSTNEAQLFCKLLCAENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQCTPSDNIGVACSVSSLVQDPLPIVVCENNTLKLLWNRTIHPTILPTDVDIVYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFPKI-NNIHIKDDQIFSPNCYITRNYIVIQGPFSIKATSITDGTGS-TDVTVSLGIFLDSNFVTVLPNLNLASKGTTVFVRISFXXXXXXXXXXXXECYVTDGNTKVYLIQNRCPVLSTVQINPXXXXXXXXXXXXXXXXXXXXQNLV-CQTSKCGKNEIGCITKC 1700
            +F +D+  ++      I+ IYFDP T +     +GV+++E   GI++TIC+N  S+  +A+V CR M Y       SA +        T    T+FQN++C+G E +L+ C G+++ +  DF C N+NQD+ + CL  + F    +                 L+ N  GNL       + F     QLF        ++  RII+G          IGGF N+ CP+NA SL +C N +P+ +++CTPSDNIG+ CS +S + D  P V C + TL L WN+TIH  I P  V+++  N  C+NV    +   + LSV   DC     GD   +IYSF  KRT+PK+ NNI IK+DQ +   C I+R        FSI AT+     G+ T +  ++ +  +  F   L N+     G+ +FV+++  NPP  LV  L  C++  GN K  LI N+CP    V I+PI +    F+F SF+I  +++   + C TS CG+   GCI  C
Sbjct:    6 VFNIDLFDILTTSHSDIKQIYFDPETTMSESKQDGVIVVETLTGIRSTICMNVESATQNAEVICRMMGYKEIIGKPSAVALISSKK-STFSNGTFFQNVKCSGSEKNLKDCSGFRYYHKTDFICSNHNQDMHVFCLGQHKFVNSTI---------------NLLKSNCTGNLF---AIHSGFIALFKQLFL-------TSYARIIEGFYSPGAS---IGGFKNMKCPSNANSLSECVNVYPYDNERCTPSDNIGLICSYNSDITDANPQVHCNSTTLSLFWNKTIHEEIRPEFVNVMENNKPCSNV---RIDSSVKLSVDYIDCGMAKQGDKDKIIYSFQVKRTYPKLNNNIIIKNDQFYQVQCLISRFDNTTTADFSISATADLPIIGNDTPIPTTMIVSANDRFYPNLLNIKDVEIGSEIFVKVTLINPPSQLVPFLDSCWIESGNVKEPLILNKCPARQKVLISPIDNVTIMFSFKSFAIGSTADSAFIKCVTSLCGRQSTGCIPTC 483          
The following BLAST results are available for this feature:
BLAST of SMED30031736 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031736 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031736 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031736 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031736 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031736 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031736 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031736 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8I3W01.645e-824.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GSG71.652e-824.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3R7CC153.406e-822.35Deleted in malignant brain tumors 1 protein OS=Clo... [more]
A0A267F9567.614e-825.00Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GY168.771e-825.00Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of SMED30031736 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031736 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031736 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031736 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031736 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000041321.17.553e-823.64pep primary_assembly:ASM223467v1:20:9691535:981596... [more]
ENSORLT00000027896.12.069e-623.26pep primary_assembly:ASM223467v1:20:9689232:980315... [more]
back to top
BLAST of SMED30031736 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000019122.10.000e+098.24SMESG000019122.1[more]
SMESG000019122.10.000e+098.21SMESG000019122.1[more]
SMESG000001182.14.176e-7334.57SMESG000001182.1[more]
SMESG000001182.14.483e-7334.57SMESG000001182.1[more]
SMESG000052890.12.499e-7234.71SMESG000052890.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031736 ID=SMED30031736|Name=SMED30031736|organism=Schmidtea mediterranea sexual|type=transcript|length=1776bp
CACCTATTCAACCTTTCATAAATATTATGCTTAATTAAGAACCAAATATT
TGAAAATCGGATTTTATTAACTTAAAAATATTATTTTTTTGATTATAACT
CAATTCAATTTTAAGAATTTTTCTCAAAAAAACTTTTCAAGACCTTTGAT
AAAATAAAATATTTTTAATGAATTATTTTCTACCAATTTTATTTATGCTT
GATATTTTAGGCGTCATTGGACAAGAACCAGGAATCCGTTTGATTTATTT
TGATCCTGCAACAAAATTATATCCCGGTAGTAATGGAGTTGTGATTTTAG
AGTTGAACAATGGAATTAAAGCTACAATTTGTCTAAATTCAAGTAGCGTA
AACGATGCCCAAGTTGCATGCAGATCGATGAATTATACTTCGTCCCAAAA
AACATCAAGTGCGTCTAGTTTCGCCTTTATATCATCAGTCAAGACAAAAT
TAGCAAAAACCTATTTTCAAAACCTTCAATGTAATGGAGATGAAGATTCA
TTAGAGAAATGCCCGGGATATAAGTTCTCGAATCCTGTGGATTTTAAATG
TCAAAATAATAACCAAGATCTCAGCATCAGTTGCCTTTACGATTACAGTT
TTTCAAAAATTAAAATGCCCTCTGAAAAATGTCCTAAGGCTACCTTACAA
GTTGACCAGTATGGTTTCTTACAATTCAACAACAATGGGAATTTAATTTA
TTTCTGTGGAGCTAGAAACATATTCAGTACCAATGAAGCTCAATTGTTTT
GTAAACTTTTGTGCGCTGAAAATTCTACATCTCCTCGAATAATTCAAGGA
ATCAATATGACATCTTTACAAAATATACCAATAGGAGGTTTCAATAACTT
ATCCTGCCCAGCAAATGCAACTTCATTGGATGATTGTTCCAATGCGTTTC
CTTTTCAAAGTGACCAATGCACACCTTCGGATAATATTGGTGTGGCTTGT
TCTGTATCATCGCTAGTTCAAGATCCGTTGCCCATCGTCGTATGCGAAAA
CAATACTTTGAAGTTATTATGGAATCGAACTATTCATCCGACAATTCTTC
CGACGGATGTTGACATTGTATACTTAAACGCATCTTGCAACAATGTGATC
AAATCCAATTTGTCAGATGTCCTAATATTGTCGGTTTCATTGAACGATTG
CAACGGTGATGTTACAGGTGACCTATATAACGTTATTTATTCATTTGGAG
CCAAAAGAACATTTCCGAAAATAAATAATATCCACATCAAAGATGATCAG
ATATTTTCACCGAATTGTTACATCACCAGAAATTATATTGTAATACAAGG
ACCTTTTTCTATAAAGGCAACTTCAATAACAGACGGAACCGGTTCAACAG
ATGTTACAGTTTCTTTAGGAATTTTTCTTGATAGCAATTTCGTAACGGTC
TTACCAAATTTGAATCTGGCCTCTAAAGGGACAACGGTTTTTGTTAGGAT
AAGCTTTAATAATCCTCCGGTCAATCTTGTGTTGGTTCTTGTCGAATGCT
ACGTTACCGATGGCAACACAAAAGTGTATTTAATTCAAAATAGATGCCCA
GTATTATCTACTGTTCAAATTAATCCAATTAGCGATTCTGTTTCTTCTTT
TAACTTTGTAAGTTTTTCCATTTCTGGATCATCGAATCAAAACTTGGTCT
GTCAAACATCTAAATGTGGAAAAAACGAAATCGGTTGCATAACAAAATGT
TAAATCAATCAGCTTTTGAAACATTTGAAATATTTTCCTGTCAATATTCA
ACATTTATATCACTTTGTATTTGAAC
back to top

protein sequence of SMED30031736-orf-1

>SMED30031736-orf-1 ID=SMED30031736-orf-1|Name=SMED30031736-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=512bp
MNYFLPILFMLDILGVIGQEPGIRLIYFDPATKLYPGSNGVVILELNNGI
KATICLNSSSVNDAQVACRSMNYTSSQKTSSASSFAFISSVKTKLAKTYF
QNLQCNGDEDSLEKCPGYKFSNPVDFKCQNNNQDLSISCLYDYSFSKIKM
PSEKCPKATLQVDQYGFLQFNNNGNLIYFCGARNIFSTNEAQLFCKLLCA
ENSTSPRIIQGINMTSLQNIPIGGFNNLSCPANATSLDDCSNAFPFQSDQ
CTPSDNIGVACSVSSLVQDPLPIVVCENNTLKLLWNRTIHPTILPTDVDI
VYLNASCNNVIKSNLSDVLILSVSLNDCNGDVTGDLYNVIYSFGAKRTFP
KINNIHIKDDQIFSPNCYITRNYIVIQGPFSIKATSITDGTGSTDVTVSL
GIFLDSNFVTVLPNLNLASKGTTVFVRISFNNPPVNLVLVLVECYVTDGN
TKVYLIQNRCPVLSTVQINPISDSVSSFNFVSFSISGSSNQNLVCQTSKC
GKNEIGCITKC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000025nervous system
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036772SRCR-like_dom_sf
IPR017448SRCR-like_dom
IPR001507ZP_dom
IPR001190SRCR
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0005044scavenger receptor activity
Vocabulary: biological process
TermDefinition
GO:0006898receptor-mediated endocytosis
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001507Zona pellucida domainSMARTSM00241zp_4coord: 205..440
e-value: 3.7E-4
score: -25.1
IPR001507Zona pellucida domainPROSITEPS51034ZP_2coord: 205..441
score: 15.118
IPR036772SRCR-like domain superfamilyGENE3DG3DSA:3.10.250.10coord: 88..197
e-value: 3.5E-7
score: 32.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.4100coord: 323..441
e-value: 5.0E-9
score: 37.7
IPR001190SRCR domainPROSITEPS50287SRCR_2coord: 78..192
score: 10.628
IPR001190SRCR domainPROSITEPS50287SRCR_2coord: 29..70
score: 7.67