ubiquitin fusion degradation protein 1 homolog

Overview
Nameubiquitin fusion degradation protein 1 homolog
Smed IDSMED30031727
Length (bp)972
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031727

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30031727h1SMcG0002240 Contig44621newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031727h1SMcG0002240 Contig44621uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Human
Match: UFD1 (ubiquitin recognition factor in ER associated degradation 1 [Source:HGNC Symbol;Acc:HGNC:12520])

HSP 1 Score: 160.999 bits (406), Expect = 1.462e-46
Identity = 97/271 (35.79%), Postives = 149/271 (54.98%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYD---INPGALMISRFVSFSGIGQRLDGKNNKINSGENDFD--DIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK*K 923
            D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F  A L     ++++  E++ +    + G      F +FSG G RLDGK   +    +     DI RGIPNYE+  G + F R      +K E        + FSG+G + + K
Sbjct:   39 DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFD-APLGYKEPERQVQHEESTEGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFVAFSGEGQSLRKK 303          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Human
Match: UFD1 (ubiquitin recognition factor in ER associated degradation 1 [Source:HGNC Symbol;Acc:HGNC:12520])

HSP 1 Score: 150.984 bits (380), Expect = 3.269e-43
Identity = 88/234 (37.61%), Postives = 134/234 (57.26%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYD---INPGALMISRFVSFSGIGQRLDGKNNKINSGENDFD--DIPRGIPNYEYSPG 812
            D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F  A L     ++++  E++ +    + G      F +FSG G RLDGK   +    +     DI RGIPNYE+  G
Sbjct:   39 DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFD-APLGYKEPERQVQHEESTEGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLG 266          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Human
Match: UFD1 (ubiquitin recognition factor in ER associated degradation 1 [Source:HGNC Symbol;Acc:HGNC:12520])

HSP 1 Score: 117.087 bits (292), Expect = 3.803e-31
Identity = 57/130 (43.85%), Postives = 83/130 (63.85%), Query Frame = 3
Query:  210 PMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEF 599
            PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F
Sbjct:   53 PMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDF 180          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Human
Match: UFD1 (ubiquitin recognition factor in ER associated degradation 1 [Source:HGNC Symbol;Acc:HGNC:12520])

HSP 1 Score: 101.293 bits (251), Expect = 1.640e-25
Identity = 57/147 (38.78%), Postives = 86/147 (58.50%), Query Frame = 3
Query:  315 WVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYD---INPGALMISRFVSFSGIGQRLDGKNNKI 746
             +M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F  A L     ++++  E++ +    + G      F +FSG G RLDGK   +
Sbjct:    1 MMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFD-APLGYKEPERQVQHEESTEGEADHSGYAGELGFRAFSGSGNRLDGKKKGV 146          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Human
Match: UFD1 (ubiquitin recognition factor in ER associated degradation 1 [Source:HGNC Symbol;Acc:HGNC:12520])

HSP 1 Score: 66.6254 bits (161), Expect = 5.106e-13
Identity = 35/105 (33.33%), Postives = 60/105 (57.14%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEP 440
            D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P
Sbjct:   34 DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNP 133          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Celegans
Match: ufd-1 (Ubiquitin fusion degradation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19584])

HSP 1 Score: 151.369 bits (381), Expect = 4.639e-43
Identity = 101/281 (35.94%), Postives = 141/281 (50.18%), Query Frame = 3
Query:   90 MENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISRFVS------------------FSGIGQRLDGKNNKINSGE----------------NDFDDIPRGIPNYEYSPGNLNFYR 830
            + N ++ K  EI  NYGGK++LP   LN ++   Q  +P PM FK+TN  A+ +  THCGV +FS     A +P W+M+ L +   D I IE + LP  T+A+L P+S EF NIT P  VLE+ LR+Y+CLT  D +   Y  +  EF V +LKP  +V IIECD+N++F   D     +++      A    P A   S F+                   F G G+RLDGK    +S                  ND   IP  + N +Y PG ++F R
Sbjct:   27 LPNATQSKISEI--NYGGKILLPSSALNLLM---QYNIPMPMLFKLTN-MAVQR-VTHCGVLEFSAPEGQAILPLWMMQQLGLDDGDTIRIESATLPKATFAKLKPMSLEFLNITNPKAVLEVELRKYACLTKNDRIPTSYAGQTLEFLVVDLKPANSVCIIECDVNLDF---DPPEGYVEQPRQVTPAVTAKPPAPDASAFIGAGQKAGGSGGTGQNATSVFGGAGRRLDGKKKPSSSVSLSDGTGVSTSNAAPVANDLPAIPPVVVNEDYKPGRVSFLR 297          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Celegans
Match: ufd-1 (Ubiquitin fusion degradation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19584])

HSP 1 Score: 151.369 bits (381), Expect = 6.929e-43
Identity = 101/281 (35.94%), Postives = 141/281 (50.18%), Query Frame = 3
Query:   90 MENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISRFVS------------------FSGIGQRLDGKNNKINSGE----------------NDFDDIPRGIPNYEYSPGNLNFYR 830
            + N ++ K  EI  NYGGK++LP   LN ++   Q  +P PM FK+TN  A+ +  THCGV +FS     A +P W+M+ L +   D I IE + LP  T+A+L P+S EF NIT P  VLE+ LR+Y+CLT  D +   Y  +  EF V +LKP  +V IIECD+N++F   D     +++      A    P A   S F+                   F G G+RLDGK    +S                  ND   IP  + N +Y PG ++F R
Sbjct:   33 LPNATQSKISEI--NYGGKILLPSSALNLLM---QYNIPMPMLFKLTN-MAVQR-VTHCGVLEFSAPEGQAILPLWMMQQLGLDDGDTIRIESATLPKATFAKLKPMSLEFLNITNPKAVLEVELRKYACLTKNDRIPTSYAGQTLEFLVVDLKPANSVCIIECDVNLDF---DPPEGYVEQPRQVTPAVTAKPPAPDASAFIGAGQKAGGSGGTGQNATSVFGGAGRRLDGKKKPSSSVSLSDGTGVSTSNAAPVANDLPAIPPVVVNEDYKPGRVSFLR 303          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Celegans
Match: ufd-1 (Ubiquitin fusion degradation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19584])

HSP 1 Score: 151.369 bits (381), Expect = 6.929e-43
Identity = 101/281 (35.94%), Postives = 141/281 (50.18%), Query Frame = 3
Query:   90 MENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISRFVS------------------FSGIGQRLDGKNNKINSGE----------------NDFDDIPRGIPNYEYSPGNLNFYR 830
            + N ++ K  EI  NYGGK++LP   LN ++   Q  +P PM FK+TN  A+ +  THCGV +FS     A +P W+M+ L +   D I IE + LP  T+A+L P+S EF NIT P  VLE+ LR+Y+CLT  D +   Y  +  EF V +LKP  +V IIECD+N++F   D     +++      A    P A   S F+                   F G G+RLDGK    +S                  ND   IP  + N +Y PG ++F R
Sbjct:   33 LPNATQSKISEI--NYGGKILLPSSALNLLM---QYNIPMPMLFKLTN-MAVQR-VTHCGVLEFSAPEGQAILPLWMMQQLGLDDGDTIRIESATLPKATFAKLKPMSLEFLNITNPKAVLEVELRKYACLTKNDRIPTSYAGQTLEFLVVDLKPANSVCIIECDVNLDF---DPPEGYVEQPRQVTPAVTAKPPAPDASAFIGAGQKAGGSGGTGQNATSVFGGAGRRLDGKKKPSSSVSLSDGTGVSTSNAAPVANDLPAIPPVVVNEDYKPGRVSFLR 303          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Fly
Match: Ufd1-like (gene:FBgn0036136 transcript:FBtr0076223)

HSP 1 Score: 140.584 bits (353), Expect = 4.985e-39
Identity = 88/247 (35.63%), Postives = 131/247 (53.04%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFA--MADLDGSSLKKRMSEEDAYDINPG--------ALMISRFVSFSGIGQRLDGKNNKINSGENDF--DDIPRGIPNYEYSPGNLNFYR 830
            D+  GGK+I+P   L+ +    +  +  PM FK+TN +      +H GV +F  +    ++P W+M++L +   D +NIE   LPV T+++  P S +F +IT P  VLE  LR ++CLT GD++ I YN KV+E  V   KP  AV+IIECDMNVEF   +   D S  +   S +       G        A++     +F G G RLDGK  K +  E       + RG+P+Y++  G + F R
Sbjct:   36 DVEKGGKIIMPPSALDTLT---RLNVEYPMLFKLTNVKKSRS--SHAGVLEFVADEGKCYLPHWMMENLLLGEGDILNIESVSLPVATFSKFQPHSTDFLDITNPKAVLENALRNFACLTRGDVIAIKYNKKVYELCVLETKPGNAVSIIECDMNVEFEAPVGYKDHSETQASGSGQQGAAGTVGGEIAGATNAILEEVVETFKGSGVRLDGKKKKESQLETPVVKKVLARGVPDYDFQFGLIRFDR 277          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Zebrafish
Match: ufd1l (ubiquitin recognition factor in ER associated degradation 1 [Source:ZFIN;Acc:ZDB-GENE-040718-150])

HSP 1 Score: 171.014 bits (432), Expect = 1.462e-50
Identity = 104/278 (37.41%), Postives = 153/278 (55.04%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRM------SEEDA----YDINPGALMISRFVSFSGIGQRLDGKNNKINSGENDFD--DIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK*K 923
            D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F  A L     ++ M      +EE+     YD++ G      F +F+G G RLDGK   I       D  DI RGIPNYE+  G + F R    Q  K ++     N I FSG+G + + K
Sbjct:   39 DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGFCYLPHWMMQNLLLEEGGLVQVESVNLMVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFD-APLGYKEPERHMQHPEEPAEEETDPSNYDMDLG------FRAFTGSGNRLDGKKKGIEPSPAPLDPSDIKRGIPNYEFKVGRITFIRNARQQPRKTDLDETVSNFIAFSGEGQSLRKK 304          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Zebrafish
Match: ufd1l (ubiquitin recognition factor in ER associated degradation 1 [Source:ZFIN;Acc:ZDB-GENE-040718-150])

HSP 1 Score: 67.3958 bits (163), Expect = 2.675e-13
Identity = 36/108 (33.33%), Postives = 61/108 (56.48%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVV 449
            D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  V
Sbjct:   39 DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGFCYLPHWMMQNLLLEEGGLVQVESVNLMVATYSKFQPQSPDFLDITNPKAV 141          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Xenopus
Match: ufd1 (ubiquitin recognition factor in ER associated degradation 1 [Source:NCBI gene;Acc:448516])

HSP 1 Score: 166.007 bits (419), Expect = 1.664e-48
Identity = 105/300 (35.00%), Postives = 161/300 (53.67%), Query Frame = 3
Query:   39 IP*KIHIMFYSKVLCSSMENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISR---FVSFSGIGQRLDGKNNKINSGENDF--DDIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK*K 923
            IP      F ++  C S+   +   +   D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F  A L     ++   +E+  +I P     +    F +FSG G RLDGK   I+        +DI RGIPNY++  G + F R    Q +K E  +     I FSG+G + + K
Sbjct:   11 IPRVFQNRFSTQYRCYSVSMLAGPNDRS-DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNSDR--MTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLLQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFD-APLGYKEPERHTQQEEPTEIEPDHSEYAADLGFRAFSGSGNRLDGKKKGIDPSPFPLKPEDIRRGIPNYDFKIGTITFIRNSRPQAKKVEDDDAVSQFIAFSGEGQSLRKK 303          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Xenopus
Match: ufd1 (ubiquitin recognition factor in ER associated degradation 1 [Source:NCBI gene;Acc:448516])

HSP 1 Score: 157.918 bits (398), Expect = 1.696e-45
Identity = 96/264 (36.36%), Postives = 146/264 (55.30%), Query Frame = 3
Query:  147 LILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISR---FVSFSGIGQRLDGKNNKINSGENDF--DDIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK*K 923
            +I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F  A L     ++   +E+  +I P     +    F +FSG G RLDGK   I+        +DI RGIPNY++  G + F R    Q +K E  +     I FSG+G + + K
Sbjct:   33 VIMPPSALDQL---SRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLLQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFD-APLGYKEPERHTQQEEPTEIEPDHSEYAADLGFRAFSGSGNRLDGKKKGIDPSPFPLKPEDIRRGIPNYDFKIGTITFIRNSRPQAKKVEDDDAVSQFIAFSGEGQSLRKK 290          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Xenopus
Match: ufd1 (ubiquitin recognition factor in ER associated degradation 1 [Source:NCBI gene;Acc:448516])

HSP 1 Score: 151.369 bits (381), Expect = 6.730e-43
Identity = 101/304 (33.22%), Postives = 152/304 (50.00%), Query Frame = 3
Query:   39 IP*KIHIMFYSKVLCSSMENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGA-------LMISRFVSFSGIGQRLDGKNNKINSGENDF--DDIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK*K 923
            IP      F ++  C S+   +   +   D+  GGK+      L+ + +  +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F          +    EE      P          +I    +FSG G RLDGK   I+        +DI RGIPNY++  G + F R    Q +K E  +     I FSG+G + + K
Sbjct:    6 IPRVFQNRFSTQYRCYSVSMLAGPNDRS-DVEKGGKIT----NLSYLFSTGRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLLQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERHTQQEEPTVRTQPTGGRWCCIVTLIFLVQAFSGSGNRLDGKKKGIDPSPFPLKPEDIRRGIPNYDFKIGTITFIRNSRPQAKKVEDDDAVSQFIAFSGEGQSLRKK 302          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Xenopus
Match: ufd1 (ubiquitin recognition factor in ER associated degradation 1 [Source:NCBI gene;Acc:448516])

HSP 1 Score: 125.946 bits (315), Expect = 1.702e-33
Identity = 92/300 (30.67%), Postives = 144/300 (48.00%), Query Frame = 3
Query:   39 IP*KIHIMFYSKVLCSSMENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISR---FVSFSGIGQRLDGKNNKINSGENDF--DDIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK*K 923
            IP      F ++  C S+   +   +   D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN KV                   D +     A L     ++   +E+  +I P     +    F +FSG G RLDGK   I+        +DI RGIPNY++  G + F R    Q +K E  +     I FSG+G + + K
Sbjct:   11 IPRVFQNRFSTQYRCYSVSMLAGPNDRS-DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNSDR--MTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLLQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKV-------------------DFD-----APLGYKEPERHTQQEEPTEIEPDHSEYAADLGFRAFSGSGNRLDGKKKGIDPSPFPLKPEDIRRGIPNYDFKIGTITFIRNSRPQAKKVEDDDAVSQFIAFSGEGQSLRKK 280          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Mouse
Match: Ufd1 (ubiquitin recognition factor in ER-associated degradation 1 [Source:MGI Symbol;Acc:MGI:109353])

HSP 1 Score: 160.229 bits (404), Expect = 2.091e-46
Identity = 98/271 (36.16%), Postives = 148/271 (54.61%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYD---INPGALMISRFVSFSGIGQRLDGKNNKINSGENDFD--DIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK*K 923
            D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F  A L     ++ +  E++ +    + G      F +FSG G RLDGK   +    +     DI RGIPNYE+  G + F R      +K E        I FSG+G + + K
Sbjct:   39 DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFD-APLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFIAFSGEGQSLRKK 303          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Mouse
Match: Ufd1 (ubiquitin recognition factor in ER-associated degradation 1 [Source:MGI Symbol;Acc:MGI:109353])

HSP 1 Score: 160.229 bits (404), Expect = 2.091e-46
Identity = 98/271 (36.16%), Postives = 148/271 (54.61%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYD---INPGALMISRFVSFSGIGQRLDGKNNKINSGENDFD--DIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK*K 923
            D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F  A L     ++ +  E++ +    + G      F +FSG G RLDGK   +    +     DI RGIPNYE+  G + F R      +K E        I FSG+G + + K
Sbjct:   39 DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFD-APLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFIAFSGEGQSLRKK 303          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. UniProt/SwissProt
Match: sp|Q92890|UFD1_HUMAN (Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1 PE=1 SV=3)

HSP 1 Score: 160.999 bits (406), Expect = 7.019e-46
Identity = 97/271 (35.79%), Postives = 149/271 (54.98%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYD---INPGALMISRFVSFSGIGQRLDGKNNKINSGENDFD--DIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK*K 923
            D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F  A L     ++++  E++ +    + G      F +FSG G RLDGK   +    +     DI RGIPNYE+  G + F R      +K E        + FSG+G + + K
Sbjct:   39 DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFD-APLGYKEPERQVQHEESTEGEADHSGYAGELGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFVAFSGEGQSLRKK 303          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. UniProt/SwissProt
Match: sp|Q9ES53|UFD1_RAT (Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Rattus norvegicus OX=10116 GN=Ufd1 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.358e-45
Identity = 97/271 (35.79%), Postives = 148/271 (54.61%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYD---INPGALMISRFVSFSGIGQRLDGKNNKINSGENDFD--DIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK*K 923
            D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F  A L     ++ +  E++ +    + G      F +FSG G RLDGK   +    +     DI RGIPNYE+  G + F R      +K E        + FSG+G + + K
Sbjct:   39 DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFD-APLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPMVKKVEEDEAGGRFVAFSGEGQSLRKK 303          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. UniProt/SwissProt
Match: sp|P70362|UFD1_MOUSE (Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Mus musculus OX=10090 GN=Ufd1 PE=1 SV=2)

HSP 1 Score: 160.229 bits (404), Expect = 1.462e-45
Identity = 98/271 (36.16%), Postives = 148/271 (54.61%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYD---INPGALMISRFVSFSGIGQRLDGKNNKINSGENDFD--DIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK*K 923
            D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F  A L     ++ +  E++ +    + G      F +FSG G RLDGK   +    +     DI RGIPNYE+  G + F R      +K E        I FSG+G + + K
Sbjct:   39 DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFD-APLGYKEPERPVQHEESIEGEADHSGYAGEVGFRAFSGSGNRLDGKKKGVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFIAFSGEGQSLRKK 303          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. UniProt/SwissProt
Match: sp|Q19584|UFD1_CAEEL (Ubiquitin fusion degradation protein 1 homolog OS=Caenorhabditis elegans OX=6239 GN=ufd-1 PE=1 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 8.814e-42
Identity = 101/281 (35.94%), Postives = 141/281 (50.18%), Query Frame = 3
Query:   90 MENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISRFVS------------------FSGIGQRLDGKNNKINSGE----------------NDFDDIPRGIPNYEYSPGNLNFYR 830
            + N ++ K  EI  NYGGK++LP   LN ++   Q  +P PM FK+TN  A+ +  THCGV +FS     A +P W+M+ L +   D I IE + LP  T+A+L P+S EF NIT P  VLE+ LR+Y+CLT  D +   Y  +  EF V +LKP  +V IIECD+N++F   D     +++      A    P A   S F+                   F G G+RLDGK    +S                  ND   IP  + N +Y PG ++F R
Sbjct:   33 LPNATQSKISEI--NYGGKILLPSSALNLLM---QYNIPMPMLFKLTN-MAVQR-VTHCGVLEFSAPEGQAILPLWMMQQLGLDDGDTIRIESATLPKATFAKLKPMSLEFLNITNPKAVLEVELRKYACLTKNDRIPTSYAGQTLEFLVVDLKPANSVCIIECDVNLDF---DPPEGYVEQPRQVTPAVTAKPPAPDASAFIGAGQKAGGSGGTGQNATSVFGGAGRRLDGKKKPSSSVSLSDGTGVSTSNAAPVANDLPAIPPVVVNEDYKPGRVSFLR 303          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. UniProt/SwissProt
Match: sp|Q9VTF9|UFD1_DROME (Ubiquitin fusion degradation protein 1 homolog OS=Drosophila melanogaster OX=7227 GN=Ufd1-like PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 4.997e-38
Identity = 88/247 (35.63%), Postives = 131/247 (53.04%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFA--MADLDGSSLKKRMSEEDAYDINPG--------ALMISRFVSFSGIGQRLDGKNNKINSGENDF--DDIPRGIPNYEYSPGNLNFYR 830
            D+  GGK+I+P   L+ +    +  +  PM FK+TN +      +H GV +F  +    ++P W+M++L +   D +NIE   LPV T+++  P S +F +IT P  VLE  LR ++CLT GD++ I YN KV+E  V   KP  AV+IIECDMNVEF   +   D S  +   S +       G        A++     +F G G RLDGK  K +  E       + RG+P+Y++  G + F R
Sbjct:   36 DVEKGGKIIMPPSALDTLT---RLNVEYPMLFKLTNVKKSRS--SHAGVLEFVADEGKCYLPHWMMENLLLGEGDILNIESVSLPVATFSKFQPHSTDFLDITNPKAVLENALRNFACLTRGDVIAIKYNKKVYELCVLETKPGNAVSIIECDMNVEFEAPVGYKDHSETQASGSGQQGAAGTVGGEIAGATNAILEEVVETFKGSGVRLDGKKKKESQLETPVVKKVLARGVPDYDFQFGLIRFDR 277          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. TrEMBL
Match: A0A023F7S8 (Putative ubiquitin fusion degradation protein ufd1 (Fragment) OS=Triatoma infestans OX=30076 PE=2 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 7.082e-56
Identity = 110/287 (38.33%), Postives = 164/287 (57.14%), Query Frame = 3
Query:   63 FYSKVLCSSMENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMAD--LDGSSLKKRMSEEDAYDINPGALMISRFVSFSGIGQRLDGKNNKINSGEND-FDDIPRGIPNYEYSPGNLNFYR--KGVLQDEKEEIPNKDENLIPFSGKGL 908
            F + +L   +   S R+  E+D   GGK+ILP   L+ + N+    L  PM FK++N    N   THCGV +F       F P+W+++ L + A   I +E + LPV T++R  P S  F +I+ P  VLE  LR+Y+CLTVGD++ + YN++++  KVE  +P  AV IIECDM V+F+  +  +D    K++   ED +D    A+   RF  FSG G RLDGK +KI + E+D  +D P GIP+Y+Y  G + F+R  + +  + KEE    D +  P  G+ L
Sbjct:    1 FSASLLVYPVTYMSDRRRDEVDT--GGKIILPPTVLDFMANQT---LQYPMLFKLSNPE--NNIITHCGVLEFVAEEGTVFAPTWILEQLKVEAGSFIKVEAAVLPVATFSRFQPQSTNFLDISNPKAVLENQLRKYACLTVGDMIALSYNDQIYRLKVEEARPRDAVKIIECDMEVDFSAPEGYVDPRKEKQKQELEDNHDNTATAVDPFRFKPFSGKGHRLDGKESKITTPEDDEQEDTPIGIPDYDYKIGTIEFFRTERTLPTNTKEE----DTHSFPGDGRSL 276          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. TrEMBL
Match: A0A3S2PKI1 (Uncharacterized protein OS=Chilo suppressalis OX=168631 GN=evm_001423 PE=4 SV=1)

HSP 1 Score: 185.267 bits (469), Expect = 7.452e-53
Identity = 117/276 (42.39%), Postives = 156/276 (56.52%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFA--MADLDGSSLKKRMSEEDAYDINPGALM--ISRFVSFSGIGQRLDGKNNKINSGENDFD--------DIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK 917
            D+  GGK+I+P   L E++ +   E P  M FK+TN++   K  THCGV +F  +    ++P W+M +L +     + IE   LPV T++R  PLS +F +IT P  VLE CLR +SCLT GD++ I YN+KV+E  V   KP  AV IIECDMNVEFA  +   +     +  S  D  D +P A+M   S FV+FSG G RLDGK  K+ S E+D D        +  RGIP+Y+Y  G L F R       KEEIP   E    F G+G T +
Sbjct:   32 DVERGGKIIMPPSAL-ELLTRLNIEYP--MIFKLTNKKM--KRVTHCGVLEFVADEGKVYLPHWMMANLLLEEGASLQIENVSLPVATFSRFQPLSEDFLDITNPKAVLENCLRNFSCLTTGDVIAIKYNSKVYELCVLETKPGDAVIIIECDMNVEFAPPVGYKEERVPTRGESGSDGMDEDPAAMMPEPSGFVAFSGEGNRLDGKKKKLTS-ESDSDQQAAQSRQNYVRGIPDYDYVIGTLRFIRNSRPTSAKEEIPT--EPFEAFKGEGFTLR 299          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. TrEMBL
Match: A0A1E1WP70 (Uncharacterized protein OS=Pectinophora gossypiella OX=13191 GN=g.16105 PE=4 SV=1)

HSP 1 Score: 184.111 bits (466), Expect = 2.444e-52
Identity = 111/276 (40.22%), Postives = 153/276 (55.43%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFA--MADLDGSSLKKRMSEEDAYDINPGALM--ISRFVSFSGIGQRLDGKNNKINSGENDFDDIP--------RGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK 917
            D+  GGK+I+P   L ++    +  +  PM FK+TN++   K  THCGV +F  +    ++P W+M +L +     + IE   LPV T+++  PLS +F +IT P  VLE CLR +SCLT GD++ I YN+K +E  V   KP  AV IIECDMNVEFA  +   +   + +R   E+  D +P  LM   S FV+F G G RLDGK  K+ S E+D +  P        RGIP+Y +S G L F R       KEE P   E    F G+G T +
Sbjct:   35 DVERGGKIIMPPSALEQLT---RLNIEYPMIFKLTNKK--TKRITHCGVLEFVADEGKVYLPHWMMANLVLEEGALLQIESVSLPVATFSKFQPLSEDFLDITNPKAVLENCLRNFSCLTTGDVIAIKYNSKAYELCVLQTKPGNAVIIIECDMNVEFAPPVGYKEDEHVSRREQREEGMDQDPSELMPEPSGFVAFRGEGNRLDGKKKKLTS-ESDGEPQPTASRQPYERGIPDYNWSIGTLRFIRTSRPTSAKEEAPA--EPFQAFKGEGFTLR 302          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. TrEMBL
Match: A0A224XTX7 (Putative ubiquitin fusion degradation protein ufd1 (Fragment) OS=Panstrongylus lignarius OX=156445 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 4.617e-52
Identity = 103/272 (37.87%), Postives = 161/272 (59.19%), Query Frame = 3
Query:   63 FYSKVLCSSMENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTN-ERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMAD--LDGSSLKKRMSEEDAYDINPGALMISRFVSFSGIGQRLDGKNNKINSGE-NDFDDIPRGIPNYEYSPGNLNFYR--KGVLQDEKEE 860
            F + +L   +   + R+  E+D   GGK+ILP   L+ + N+    L  PM FK++N +  +N   THCGV +F       F P+W+++ L++ A   I +E + LPV T++R  P S  F +I+ P  VLE  LR+Y+CLTVGDI+ + YN+K++  KVE  +P  AV IIECDM V+F+  +  +D    +++   E+ +  +P  +   +F  FSG G RLDGK +K+ + E N+ +D P GIP+Y+Y  G + F+R  + V  + KEE
Sbjct:    1 FSATLLVYPVTYMTDRRRDEVDT--GGKIILPPTVLDFMANQT---LQYPMLFKLSNPDLNIN---THCGVLEFVAEEGTVFTPTWMLEQLNVEAGSFIKVESASLPVATFSRFQPQSTNFLDISNPKAVLENQLRKYACLTVGDIIALSYNDKIYRLKVEEARPRDAVKIIECDMEVDFSAPEGYVDPIREQQKQELENNHSSSPTTVDSIKFKPFSGKGHRLDGKESKVTTTEDNEPEDPPVGIPDYDYKIGTIEFFRTERSVPTNAKEE 264          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. TrEMBL
Match: A0A1W4WF51 (ubiquitin fusion degradation protein 1 homolog OS=Agrilus planipennis OX=224129 GN=LOC108732363 PE=4 SV=1)

HSP 1 Score: 182.956 bits (463), Expect = 6.266e-52
Identity = 111/273 (40.66%), Postives = 159/273 (58.24%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALM--ISRFVSFSGIGQRLDGKNNK-INSGENDFDDIP--RGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDE--NLIPFSGKGLTTK*K 923
            D+  GGK+I+P   L ++    +  +  PM FK+TN++  N+  +HCGV +F  +    ++P W+M +L +   D++ IE   LPVG++A+  PLSP+F +IT P  VLE CLR ++CLT GD++ + YN KV+E  V   KP  A++IIECDMNVEFA         K++ +EE    I+P  LM   S FV+F G G RLDGK  K  +S E D   +   RGIP+Y+Y  G L F+R   LQ      P ++   +   FSG G + K K
Sbjct:   35 DVEKGGKIIMPPSALEQLT---RLNINYPMLFKITNKKT-NR-ISHCGVLEFVADEGKVYLPFWMMHNLVLEEGDQLQIESVSLPVGSFAKFQPLSPDFLDITNPKAVLENCLRTFACLTTGDVIAVQYNQKVYELCVLETKPGNAISIIECDMNVEFAPPVGYKEPQKEQDTEE--MTIDPADLMPEPSGFVAFRGQGNRLDGKRRKDASSSETDQRKVQYVRGIPDYDYEIGTLRFFRH--LQKSSSSKPEEETYPDFKAFSGTGFSLKNK 298          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Cavefish
Match: ufd1l (ubiquitin recognition factor in ER associated degradation 1 [Source:ZFIN;Acc:ZDB-GENE-040718-150])

HSP 1 Score: 163.696 bits (413), Expect = 1.531e-47
Identity = 97/264 (36.74%), Postives = 144/264 (54.55%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEF--AMADLDGSSLKKRMSEEDAYDINPGAL-MISRFVSFSGIGQRLDGKNNKINSGENDFD--DIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGK 902
            D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F   +   +     +   E    + +P +  M   F +F+G G RLDGK   I       D  DI RGIPNYE+  G + F R    Q  + E  +   N I FSG+
Sbjct:   39 DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLMVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERPTQHHEEPAEEETDPSSYEMDLGFRAFTGSGNRLDGKKKGIEPSPARIDPNDIKRGIPNYEFKIGKITFIRNSRPQPRRIEEDDSVNNFIAFSGR 297          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Cavefish
Match: ufd1l (ubiquitin recognition factor in ER associated degradation 1 [Source:ZFIN;Acc:ZDB-GENE-040718-150])

HSP 1 Score: 144.821 bits (364), Expect = 5.745e-41
Identity = 89/237 (37.55%), Postives = 123/237 (51.90%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISRFVSFSGIGQRLDGKNNKINSGENDFD--DIPRGIPNYEYSPGNLNFYR 830
            D+  GGK I         V  C+  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F     D     K       +   P         +F+G G RLDGK   I       D  DI RGIPNYE+  G + F R
Sbjct:   34 DVEKGGKSI------TFTVFLCRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLMVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDF-----DAPLGYKEPERPTQHHEEP---------AFTGSGNRLDGKKKGIEPSPARIDPNDIKRGIPNYEFKIGKITFIR 248          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Yeast
Match: UFD1 (Substrate-recruiting cofactor of the Cdc48p-Npl4p-Ufd1p segregase; polyubiquitin binding protein that assists in the dislocation of misfolded, ERAD substrates that are subsequently delivered to the proteasome for degradation; involved in regulated destruction of ER membrane proteins such as HMG-CoA reductase (Hmg1/2p) and cytoplasmic proteins (Fbp1p); involved in mobilizing membrane bound transcription factors by regulated Ub/proteasome-dependent processing (RUP) [Source:SGD;Acc:S000003280])

HSP 1 Score: 103.99 bits (258), Expect = 6.354e-26
Identity = 76/264 (28.79%), Postives = 128/264 (48.48%), Query Frame = 3
Query:   87 SMENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVT-NERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYT---AVNIIECDMNVEFA----MADLDGSSLKKRMSEEDAYDINPGALM---------ISRFVSFSGIGQRLDGKNNK-INSGENDFDDIPRGIPNYEYSPGNLNF 824
            +M N   RK+   D N+GGK+ LP   L+++       +  PM FK+T NE       TH GV +F       ++P W+M+ L I     + I  + +P+G + +L P S +F +I++P  VLE  LR +S LTV D++ I YN K F+ K+  +KP +   ++ +IE D+  +FA      + D  +LK +  +E       G ++         +S  + ++GI      K +K +  G+N     P+  P  +     + F
Sbjct:   31 AMMNDRIRKD---DANFGGKIFLPPSALSKL---SMLNIRYPMLFKLTANETGR---VTHGGVLEFIAEEGRVYLPQWMMETLGIQPGSLLQISSTDVPLGQFVKLEPQSVDFLDISDPKAVLENVLRNFSTLTVDDVIEISYNGKTFKIKILEVKPESSSKSICVIETDLVTDFAPPVGYVEPDYKALKAQQDKEKKNSFGKGQVLDPSVLGQGSMSTRIDYAGIANSSRNKLSKFVGQGQNISGKAPKAEPKQDIKDMKITF 285          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Nematostella
Match: EDO37761 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SET4])

HSP 1 Score: 130.568 bits (327), Expect = 1.030e-35
Identity = 80/244 (32.79%), Postives = 129/244 (52.87%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEI-CLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAM----ADLDGSSLKKRMSEEDAYDINPGALMISRFVSFSGIGQRLDGKNNKINSGENDFDDIP----RGIPNYEYSPGNLNFYR 830
            D+  GGK+I+P   L+++    +  +  PM FK+TN R      THCGV +F  +    ++P W+M+++ +     + +E + LPV ++A+  P S +F +IT P  VL + C       +  D  ++  + +++EF V   KP  AV+IIECDM VEFA      +      + +  EE++ + +P A +    ++F+G G RLDGK  K+N         P    RGIPNY+Y  G + F R
Sbjct:   33 DVERGGKIIMPPSALDQLT---RLNIVYPMLFKLTNNRIDRS--THCGVLEFVADEGKIYLPHWMMRNMLLDEGGLLQVESASLPVASFAKFQPQSVDFLDITNPKAVLGMYCTVVLVTASYFDCCSLFLSPQIYEFLVMETKPGKAVSIIECDMQVEFAAPVGYVEPKRQQQQVKKMEEESEEPHPAAQVTK--LAFTGEGFRLDGKKKKMNVSSEPVPLEPVVIKRGIPNYDYKKGKITFKR 269          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Nematostella
Match: EDO26153 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TCR2])

HSP 1 Score: 88.1965 bits (217), Expect = 1.125e-21
Identity = 42/104 (40.38%), Postives = 64/104 (61.54%), Query Frame = 3
Query:  210 PMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNK 521
            PM FK+TN R      THCGV +F  +    ++P W+M+++ +     + +E + LPV ++A+  P S +F +IT P  VLE  LR ++CLT GDI+ I YN+K
Sbjct:   19 PMLFKLTNNRIDRS--THCGVLEFVADEGKIYLPHWMMRNMLLDEGGLLQVESASLPVASFAKFQPQSVDFLDITNPKAVLENALRSFACLTTGDIIAIKYNDK 120          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Nematostella
Match: EDO26630 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TBH7])

HSP 1 Score: 45.0542 bits (105), Expect = 1.501e-6
Identity = 24/70 (34.29%), Postives = 37/70 (52.86%), Query Frame = 3
Query:  126 DLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLD 335
            D+  GGK+I+P   L+++    +  +  PM FK+TN R      THCGV +F  +    ++P WV    D
Sbjct:   18 DVERGGKIIMPPSALDQLT---RLNIVYPMLFKLTNNRIDRS--THCGVLEFVADEGKIYLPHWVSGTYD 82          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Medaka
Match: ufd1l (ubiquitin recognition factor in ER associated degradation 1 [Source:NCBI gene;Acc:101171919])

HSP 1 Score: 158.688 bits (400), Expect = 6.238e-46
Identity = 103/296 (34.80%), Postives = 159/296 (53.72%), Query Frame = 3
Query:   63 FYSKVLCSSMENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEF----AMADLDGSSLKKRMSEEDAYDINPGALMISRFVSFSGIGQRLDGKNNKI--NSGENDFDDIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENL---IPFSGKGLTTK*K 923
            F ++  C S+   +   +   D+  GGK+I+P   L+++    +  +  PM FK+TN+ +     THCGV +F  +    ++P W+M++L +     + +E   L V TY++  P SP+F +IT P  VLE  LR ++CLT GD++ I YN K++E +V   KP  AV+IIECDMNV+F       + +  S  +    E+  D +  A M   F +F+G G RLDGK   I  N       DI RGIPNY++  G + F R    Q  +  + + D+ L   I FSG+G + + K
Sbjct:   19 FSTQYRCYSVSMLAGPNDRS-DVEKGGKIIMPPSALDQL---SRLNITYPMLFKLTNKNS--DRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLMVATYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAVSIIECDMNVDFDAPLGYKEPERRSQNQDEPTEEEPDPSSYADMDLGFRAFTGSGNRLDGKTKGIEPNPVPLAASDIKRGIPNYDFKVGKITFIRNSRPQPRR--VVDDDDALNKFIAFSGEGQSLRKK 306          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Planmine SMEST
Match: SMESG000037430.1 (SMESG000037430.1)

HSP 1 Score: 567 bits (1460), Expect = 0.000e+0
Identity = 276/276 (100.00%), Postives = 276/276 (100.00%), Query Frame = 3
Query:   90 MENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISRFVSFSGIGQRLDGKNNKINSGENDFDDIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK 917
            MENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISRFVSFSGIGQRLDGKNNKINSGENDFDDIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK
Sbjct:    1 MENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISRFVSFSGIGQRLDGKNNKINSGENDFDDIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK 276          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Planmine SMEST
Match: SMESG000005739.1 (SMESG000005739.1)

HSP 1 Score: 173.711 bits (439), Expect = 3.985e-52
Identity = 114/270 (42.22%), Postives = 153/270 (56.67%), Query Frame = 3
Query:  138 GGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEF------AMADLDGSSLKKRMS-EEDAYDINPGALMISR-FVSFSGIGQRLDGKNNKINS-GENDFD-DIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK 917
            GGK++LP   L E++ +    +  PM FK+TN+   N  +THCGV +FS +    F P W+M +L+IS   +I +E   LP+ TYA+  PL+ EF NIT P  VLE  LR ++CLT GD++ I YNNK +E K+   KP  AV+IIECDM VEF         D++   +    S EED Y I  G    SR F  F G G RLDGK  ++ S GE+ F     RG PNY Y PG L F R   + ++ +   N+D   + F G+G T K
Sbjct:   27 GGKILLPSSAL-ELLTRLH--IQYPMLFKLTNKN--NGRYTHCGVLEFSADEGTIFAPYWMMVNLNISEGCQIRVENVALPIATYAKFQPLTVEFHNITNPKAVLENALRDFACLTKGDLLAINYNNKSYELKILETKPKEAVSIIECDMQVEFDEPLISKPEDVETPRIPNIESDEEDDYRIVSGD---SRNFKVFGGFGIRLDGKTKEVPSIGESSFAITQERGKPNYNYKPGLLTFCRSKPINNQGDTQSNED---VLFPGEGKTLK 285          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Planmine SMEST
Match: SMESG000054798.1 (SMESG000054798.1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.392e-19
Identity = 68/256 (26.56%), Postives = 116/256 (45.31%), Query Frame = 3
Query:  138 GGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISRFVSFSGIGQRLDGKNNKINSGENDFDDIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKG 905
            GGK+IL    L     K   ++  P+ F++TN   L++   HCGV +F+      ++P W+M+ L+++  ++  I+      G   +  P   EF N  +   VLE  L  ++CL+ GD + I+YN K +   + + +P   + II+CD+ V+F           K   + D+Y        I+R  + + I   L+   +K  + E    +   G PNY Y  G L+F +         E P  ++    F G G
Sbjct:   30 GGKIILCQSLLKFYSGK---DVKYPLMFEITN---LDRE-VHCGVIEFTAKEEEMYIPEWMMRQLEVTNGEKAFIKYFEPSNGKRIQFQPRDSEFLNFEDHKSVLETSLVNFACLSKGDTIPIVYNGKTYYGDIVDCEPSDVICIIDCDLEVDF-----------KSPKDYDSY--------IARMEA-AKIQNSLNHPESKTENNET--LNFEPGTPNYNYKFGFLSFPQDNFKPFTVAEEPRSNKKFTAFQGFG 256          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Planmine SMEST
Match: SMESG000037687.1 (SMESG000037687.1)

HSP 1 Score: 85.8853 bits (211), Expect = 3.637e-19
Identity = 68/256 (26.56%), Postives = 117/256 (45.70%), Query Frame = 3
Query:  138 GGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISRFVSFSGIGQRLDGKNNKINSGENDFDDIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKG 905
            GGK+IL H  +    N+   ++  P+ F++TN   L++   HCGV +F+      ++P W+M  L ++   +  I+      G   +  P + EF +  +   VLE CL  ++CL+ GD + I+YN K +   + + +P   + II+CD+ V+F           K   + D+Y        I+R +    +   L     KI + E    ++  G PNY Y  G L+F +      +  E P+  +    F G G
Sbjct:   30 GGKIILYHSLMKFYSNQ---DVKYPLMFEITN---LDRE-VHCGVIEFTAKEGEMYIPEWMMAQLGVTNGQKAFIKYFEPSKGKRIQFQPHNSEFLHFEDHKSVLEKCLVNFACLSKGDSIPIVYNGKTYYGDIVDCEPSNVICIIDCDLEVDF-----------KPPKDYDSY--------IAR-IEAEKVKTNLHHPEFKIENNET--LNVKPGTPNYNYKFGFLSFPQDNFKPFKPVEEPSSTKKFSAFQGFG 256          
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Planmine SMEST
Match: SMESG000054765.1 (SMESG000054765.1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.357e-19
Identity = 68/256 (26.56%), Postives = 117/256 (45.70%), Query Frame = 3
Query:  138 GGKLILPHRCLNEIVNKCQGELPNPMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEINIELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTILYNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAYDINPGALMISRFVSFSGIGQRLDGKNNKINSGENDFDDIPRGIPNYEYSPGNLNFYRKGVLQDEKEEIPNKDENLIPFSGKG 905
            GGK+IL H  +    N+   ++  P+ F++TN   L++   HCGV +F+      ++P W+M  L ++   +  I+      G   +  P + EF +  +   VLE CL  ++CL+ GD + I+YN K +   + + +P   + II+CD+ V+F           K   + D+Y        I+R +    +   L     KI + E    ++  G PNY Y  G L+F +      +  E P+  +    F G G
Sbjct:   30 GGKIILYHSLMKFYSNQ---DVKYPLMFEITN---LDRE-VHCGVIEFTAKEGEMYIPEWMMTQLGVTNGQKAFIKYFEPSNGKRIQFQPHNSEFLHFEDHKSVLEKCLVNFACLSKGDSIPIVYNGKTYYGDIVDCEPSNVICIIDCDLEVDF-----------KPPKDYDSY--------IAR-IEAEKVKTNLHHPEFKIENNET--LNVKPGTPNYNYKFGFLSFPQDNFKPFKPVEEPSSTKKFSAFQGFG 256          
The following BLAST results are available for this feature:
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
UFD11.462e-4635.79ubiquitin recognition factor in ER associated degr... [more]
UFD13.269e-4337.61ubiquitin recognition factor in ER associated degr... [more]
UFD13.803e-3143.85ubiquitin recognition factor in ER associated degr... [more]
UFD11.640e-2538.78ubiquitin recognition factor in ER associated degr... [more]
UFD15.106e-1333.33ubiquitin recognition factor in ER associated degr... [more]
back to top
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ufd-14.639e-4335.94Ubiquitin fusion degradation protein 1 homolog [S... [more]
ufd-16.929e-4335.94Ubiquitin fusion degradation protein 1 homolog [S... [more]
ufd-16.929e-4335.94Ubiquitin fusion degradation protein 1 homolog [S... [more]
back to top
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ufd1-like4.985e-3935.63gene:FBgn0036136 transcript:FBtr0076223[more]
back to top
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ufd1l1.462e-5037.41ubiquitin recognition factor in ER associated degr... [more]
ufd1l2.675e-1333.33ubiquitin recognition factor in ER associated degr... [more]
back to top
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ufd11.664e-4835.00ubiquitin recognition factor in ER associated degr... [more]
ufd11.696e-4536.36ubiquitin recognition factor in ER associated degr... [more]
ufd16.730e-4333.22ubiquitin recognition factor in ER associated degr... [more]
ufd11.702e-3330.67ubiquitin recognition factor in ER associated degr... [more]
back to top
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Ufd12.091e-4636.16ubiquitin recognition factor in ER-associated degr... [more]
Ufd12.091e-4636.16ubiquitin recognition factor in ER-associated degr... [more]
back to top
BLAST of ubiquitin fusion degradation protein 1 homolog vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92890|UFD1_HUMAN7.019e-4635.79Ubiquitin recognition factor in ER-associated degr... [more]
sp|Q9ES53|UFD1_RAT1.358e-4535.79Ubiquitin recognition factor in ER-associated degr... [more]
sp|P70362|UFD1_MOUSE1.462e-4536.16Ubiquitin recognition factor in ER-associated degr... [more]
sp|Q19584|UFD1_CAEEL8.814e-4235.94Ubiquitin fusion degradation protein 1 homolog OS=... [more]
sp|Q9VTF9|UFD1_DROME4.997e-3835.63Ubiquitin fusion degradation protein 1 homolog OS=... [more]
back to top
BLAST of ubiquitin fusion degradation protein 1 homolog vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A023F7S87.082e-5638.33Putative ubiquitin fusion degradation protein ufd1... [more]
A0A3S2PKI17.452e-5342.39Uncharacterized protein OS=Chilo suppressalis OX=1... [more]
A0A1E1WP702.444e-5240.22Uncharacterized protein OS=Pectinophora gossypiell... [more]
A0A224XTX74.617e-5237.87Putative ubiquitin fusion degradation protein ufd1... [more]
A0A1W4WF516.266e-5240.66ubiquitin fusion degradation protein 1 homolog OS=... [more]
back to top
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ufd1l1.531e-4736.74ubiquitin recognition factor in ER associated degr... [more]
ufd1l5.745e-4137.55ubiquitin recognition factor in ER associated degr... [more]
back to top
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
UFD16.354e-2628.79Substrate-recruiting cofactor of the Cdc48p-Npl4p-... [more]
back to top
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO377611.030e-3532.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO261531.125e-2140.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO266301.501e-634.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ufd1l6.238e-4634.80ubiquitin recognition factor in ER associated degr... [more]
back to top
BLAST of ubiquitin fusion degradation protein 1 homolog vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037430.10.000e+0100.00SMESG000037430.1[more]
SMESG000005739.13.985e-5242.22SMESG000005739.1[more]
SMESG000054798.13.392e-1926.56SMESG000054798.1[more]
SMESG000037687.13.637e-1926.56SMESG000037687.1[more]
SMESG000054765.16.357e-1926.56SMESG000054765.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031727 ID=SMED30031727|Name=ubiquitin fusion degradation protein 1 homolog|organism=Schmidtea mediterranea sexual|type=transcript|length=972bp
TGAAATCAATTAGAAAATTAAATATTTAATGAATTGATATTCCATAAAAA
ATTCATATAATGTTTTACAGTAAAGTACTCTGTTCCTCCATGGAAAATTA
TAGCAAAAGAAAAGAACATGAAATTGACTTAAATTATGGTGGAAAATTAA
TTTTGCCTCATCGATGTCTTAATGAAATTGTCAACAAGTGTCAAGGAGAA
TTGCCTAATCCAATGCAATTCAAGGTAACTAATGAAAGAGCTCTAAATAA
ACCTTTTACTCATTGTGGAGTTTTCGATTTCTCAAATAATTCCCCAAATG
CCTTTGTTCCATCATGGGTTATGAAGCATTTGGATATTTCTGCTAATGAT
GAAATAAATATTGAGTTGTCCTATTTGCCTGTAGGAACTTATGCCAGATT
GATACCACTTAGTCCAGAATTCAAAAATATAACCGAGCCTATTGTTGTAC
TCGAAATATGTTTGCGTCAATATTCATGTCTGACAGTGGGCGACATCATG
ACAATACTTTACAATAACAAGGTTTTTGAGTTCAAAGTCGAGAACCTCAA
GCCCTACACTGCTGTCAACATTATTGAATGTGACATGAATGTGGAATTTG
CAATGGCAGATCTTGATGGGAGTTCACTAAAGAAAAGAATGAGTGAAGAA
GACGCATATGACATTAATCCAGGTGCACTTATGATCTCTAGGTTTGTGTC
GTTTAGTGGAATCGGACAAAGACTTGATGGCAAGAACAATAAGATTAACT
CGGGAGAAAATGACTTCGATGATATACCAAGAGGAATACCGAATTATGAA
TACTCGCCAGGCAACTTGAATTTCTATCGTAAAGGAGTATTACAGGATGA
AAAGGAGGAAATTCCAAATAAAGATGAAAATCTGATTCCTTTCAGTGGAA
AAGGGTTAACGACGAAATGAAAAATGAATTTTTCTGATTAATTTAAAACC
ACCAGTTCAATATAAACCTTTC
back to top

protein sequence of SMED30031727-orf-1

>SMED30031727-orf-1 ID=SMED30031727-orf-1|Name=SMED30031727-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=287bp
MFYSKVLCSSMENYSKRKEHEIDLNYGGKLILPHRCLNEIVNKCQGELPN
PMQFKVTNERALNKPFTHCGVFDFSNNSPNAFVPSWVMKHLDISANDEIN
IELSYLPVGTYARLIPLSPEFKNITEPIVVLEICLRQYSCLTVGDIMTIL
YNNKVFEFKVENLKPYTAVNIIECDMNVEFAMADLDGSSLKKRMSEEDAY
DINPGALMISRFVSFSGIGQRLDGKNNKINSGENDFDDIPRGIPNYEYSP
GNLNFYRKGVLQDEKEEIPNKDENLIPFSGKGLTTK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR042299Ufd1-like_Nn
IPR004854Ufd1-like
Vocabulary: biological process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR042299Ufd1-like, Nn domainGENE3DG3DSA:2.40.40.50coord: 1..106
e-value: 5.9E-21
score: 76.0
IPR004854Ubiquitin fusion degradation protein Ufd1-likePFAMPF03152UFD1coord: 8..181
e-value: 1.7E-46
score: 157.8
IPR004854Ubiquitin fusion degradation protein Ufd1-likePANTHERPTHR12555UBIQUITIN FUSION DEGRADATON PROTEIN 1coord: 5..282
NoneNo IPR availableGENE3DG3DSA:3.10.330.10coord: 108..181
e-value: 1.4E-24
score: 87.8
NoneNo IPR availablePANTHERPTHR12555:SF13UBIQUITIN RECOGNITION FACTOR IN ER-ASSOCIATED DEGRADATION PROTEIN 1coord: 5..282