RNA binding protein fox-1

Overview
NameRNA binding protein fox-1
Smed IDSMED30031721
Length (bp)1615
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RNA binding protein fox-1 (SMED30031721) t-SNE clustered cells

Violin plots show distribution of expression levels for RNA binding protein fox-1 (SMED30031721) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RNA binding protein fox-1 (SMED30031721) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RNA binding protein fox-1 (SMED30031721) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031721

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30031721h1SMcG0006666 dd_Smed_v4_9461_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031721h1SMcG0006666 dd_Smed_v4_9461_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031721h1SMcG0006666 dd_Smed_v4_9461_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031721h1SMcG0006666 dd_Smed_v4_9461_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031721h1SMcG0006666 dd_Smed_v6_9461_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RNA binding protein fox-1 vs. Ensembl Human
Match: RBFOX1 (RNA binding fox-1 homolog 1 [Source:HGNC Symbol;Acc:HGNC:18222])

HSP 1 Score: 152.525 bits (384), Expect = 6.952e-42
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:  113 SQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 199          
BLAST of RNA binding protein fox-1 vs. Ensembl Human
Match: RBFOX1 (RNA binding fox-1 homolog 1 [Source:HGNC Symbol;Acc:HGNC:18222])

HSP 1 Score: 152.525 bits (384), Expect = 7.069e-42
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:  114 SQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 200          
BLAST of RNA binding protein fox-1 vs. Ensembl Human
Match: RBFOX2 (RNA binding fox-1 homolog 2 [Source:HGNC Symbol;Acc:HGNC:9906])

HSP 1 Score: 150.214 bits (378), Expect = 2.704e-41
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:   88 STPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 174          
BLAST of RNA binding protein fox-1 vs. Ensembl Human
Match: RBFOX2 (RNA binding fox-1 homolog 2 [Source:HGNC Symbol;Acc:HGNC:9906])

HSP 1 Score: 150.214 bits (378), Expect = 2.704e-41
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:   88 STPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 174          
BLAST of RNA binding protein fox-1 vs. Ensembl Human
Match: RBFOX1 (RNA binding fox-1 homolog 1 [Source:HGNC Symbol;Acc:HGNC:18222])

HSP 1 Score: 151.369 bits (381), Expect = 3.922e-40
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:  134 SQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 220          
BLAST of RNA binding protein fox-1 vs. Ensembl Celegans
Match: fox-1 (Sex determination protein fox-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10572])

HSP 1 Score: 134.806 bits (338), Expect = 4.372e-35
Identity = 60/89 (67.42%), Postives = 70/89 (78.65%), Query Frame = 1
Query:  403 GPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAET 669
            GPKRLHVSNIPFRFR+ DL+ +   FG + DVEIIFNERGSKGFGFVT     DAERAR+ L+G ++EGRKIEVN ATAR+ +KK   T
Sbjct:   92 GPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEIIFNERGSKGFGFVTMERPQDAERARQELHGSMIEGRKIEVNCATARVHSKKVKPT 180          
BLAST of RNA binding protein fox-1 vs. Ensembl Celegans
Match: fox-1 (Sex determination protein fox-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10572])

HSP 1 Score: 135.961 bits (341), Expect = 5.892e-35
Identity = 60/89 (67.42%), Postives = 70/89 (78.65%), Query Frame = 1
Query:  403 GPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAET 669
            GPKRLHVSNIPFRFR+ DL+ +   FG + DVEIIFNERGSKGFGFVT     DAERAR+ L+G ++EGRKIEVN ATAR+ +KK   T
Sbjct:  151 GPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEIIFNERGSKGFGFVTMERPQDAERARQELHGSMIEGRKIEVNCATARVHSKKVKPT 239          
BLAST of RNA binding protein fox-1 vs. Ensembl Celegans
Match: fox-1 (Sex determination protein fox-1 [Source:UniProtKB/Swiss-Prot;Acc:Q10572])

HSP 1 Score: 136.346 bits (342), Expect = 8.082e-35
Identity = 60/89 (67.42%), Postives = 70/89 (78.65%), Query Frame = 1
Query:  403 GPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAET 669
            GPKRLHVSNIPFRFR+ DL+ +   FG + DVEIIFNERGSKGFGFVT     DAERAR+ L+G ++EGRKIEVN ATAR+ +KK   T
Sbjct:  181 GPKRLHVSNIPFRFRDPDLKTMFEKFGVVSDVEIIFNERGSKGFGFVTMERPQDAERARQELHGSMIEGRKIEVNCATARVHSKKVKPT 269          
BLAST of RNA binding protein fox-1 vs. Ensembl Celegans
Match: asd-1 (RNA-binding protein ASD-1 [Source:UniProtKB/TrEMBL;Acc:G5EEW7])

HSP 1 Score: 129.413 bits (324), Expect = 9.589e-33
Identity = 58/103 (56.31%), Postives = 72/103 (69.90%), Query Frame = 1
Query:  403 GPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANAL 711
            GP+RLHVSNIPF++RE DL A+    G ++DVEIIFNERGSKGFGFVT  N  DA+RAR   NG  +EGR++EVN AT R+  KK    +   V + +  NAL
Sbjct:   73 GPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFNERGSKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQRVHNKKAKPLMSVGVDAMSAQNAL 175          
BLAST of RNA binding protein fox-1 vs. Ensembl Celegans
Match: asd-1 (RNA-binding protein ASD-1 [Source:UniProtKB/TrEMBL;Acc:G5EEW7])

HSP 1 Score: 129.413 bits (324), Expect = 1.407e-32
Identity = 58/103 (56.31%), Postives = 72/103 (69.90%), Query Frame = 1
Query:  403 GPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANAL 711
            GP+RLHVSNIPF++RE DL A+    G ++DVEIIFNERGSKGFGFVT  N  DA+RAR   NG  +EGR++EVN AT R+  KK    +   V + +  NAL
Sbjct:   98 GPRRLHVSNIPFKYREPDLTAMFEKVGPVVDVEIIFNERGSKGFGFVTMQNPDDADRARAEFNGTTIEGRRVEVNLATQRVHNKKAKPLMSVGVDAMSAQNAL 200          
BLAST of RNA binding protein fox-1 vs. Ensembl Fly
Match: Rbfox1 (gene:FBgn0052062 transcript:FBtr0113419)

HSP 1 Score: 162.925 bits (411), Expect = 1.432e-42
Identity = 82/124 (66.13%), Postives = 93/124 (75.00%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVK--SATNANALRSV-LARNSIGNVTLTGY 762
            S PKRLHVSNIPFRFR+ DLRA+ G FGTI+DVEIIFNERGSKGFGFVTFAN+ DAERARE L+G VVEGRKIEVN+ATAR+ TKK        V+   A  A A+R V + R  +G V  T Y
Sbjct:  374 SQPKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGSKGFGFVTFANSNDAERARERLHGTVVEGRKIEVNNATARVQTKKVTAVPNVCVQWPEAAVAAAMRGVAIQRGHVGVVGATPY 497          
BLAST of RNA binding protein fox-1 vs. Ensembl Fly
Match: Rbfox1 (gene:FBgn0052062 transcript:FBtr0305095)

HSP 1 Score: 162.925 bits (411), Expect = 2.487e-42
Identity = 82/124 (66.13%), Postives = 93/124 (75.00%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVK--SATNANALRSV-LARNSIGNVTLTGY 762
            S PKRLHVSNIPFRFR+ DLRA+ G FGTI+DVEIIFNERGSKGFGFVTFAN+ DAERARE L+G VVEGRKIEVN+ATAR+ TKK        V+   A  A A+R V + R  +G V  T Y
Sbjct:  440 SQPKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGSKGFGFVTFANSNDAERARERLHGTVVEGRKIEVNNATARVQTKKVTAVPNVCVQWPEAAVAAAMRGVAIQRGHVGVVGATPY 563          
BLAST of RNA binding protein fox-1 vs. Ensembl Fly
Match: Rbfox1 (gene:FBgn0052062 transcript:FBtr0305097)

HSP 1 Score: 162.54 bits (410), Expect = 2.849e-42
Identity = 82/124 (66.13%), Postives = 93/124 (75.00%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVK--SATNANALRSV-LARNSIGNVTLTGY 762
            S PKRLHVSNIPFRFR+ DLRA+ G FGTI+DVEIIFNERGSKGFGFVTFAN+ DAERARE L+G VVEGRKIEVN+ATAR+ TKK        V+   A  A A+R V + R  +G V  T Y
Sbjct:  391 SQPKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGSKGFGFVTFANSNDAERARERLHGTVVEGRKIEVNNATARVQTKKVTAVPNVCVQWPEAAVAAAMRGVAIQRGHVGVVGATPY 514          
BLAST of RNA binding protein fox-1 vs. Ensembl Fly
Match: Rbfox1 (gene:FBgn0052062 transcript:FBtr0113418)

HSP 1 Score: 162.54 bits (410), Expect = 2.851e-42
Identity = 82/124 (66.13%), Postives = 93/124 (75.00%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVK--SATNANALRSV-LARNSIGNVTLTGY 762
            S PKRLHVSNIPFRFR+ DLRA+ G FGTI+DVEIIFNERGSKGFGFVTFAN+ DAERARE L+G VVEGRKIEVN+ATAR+ TKK        V+   A  A A+R V + R  +G V  T Y
Sbjct:  374 SQPKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGSKGFGFVTFANSNDAERARERLHGTVVEGRKIEVNNATARVQTKKVTAVPNVCVQWPEAAVAAAMRGVAIQRGHVGVVGATPY 497          
BLAST of RNA binding protein fox-1 vs. Ensembl Fly
Match: Rbfox1 (gene:FBgn0052062 transcript:FBtr0332985)

HSP 1 Score: 156.377 bits (394), Expect = 3.561e-41
Identity = 71/86 (82.56%), Postives = 78/86 (90.70%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKK 657
            S PKRLHVSNIPFRFR+ DLRA+ G FGTI+DVEIIFNERGSKGFGFVTFAN+ DAERARE L+G VVEGRKIEVN+ATAR+ TKK
Sbjct:  215 SQPKRLHVSNIPFRFRDPDLRAMFGQFGTILDVEIIFNERGSKGFGFVTFANSNDAERARERLHGTVVEGRKIEVNNATARVQTKK 300          
BLAST of RNA binding protein fox-1 vs. Ensembl Zebrafish
Match: rbfox3b (RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-GENE-091204-46])

HSP 1 Score: 149.828 bits (377), Expect = 8.462e-42
Identity = 66/85 (77.65%), Postives = 74/85 (87.06%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF  + DA+RARE LNG +VEGRKIEVN+ATAR+MT KK
Sbjct:  107 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKK 191          
BLAST of RNA binding protein fox-1 vs. Ensembl Zebrafish
Match: rbfox1 (RNA binding fox-1 homolog 1 [Source:NCBI gene;Acc:449554])

HSP 1 Score: 147.132 bits (370), Expect = 8.436e-41
Identity = 66/85 (77.65%), Postives = 75/85 (88.24%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF ++ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:   96 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFESSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 180          
BLAST of RNA binding protein fox-1 vs. Ensembl Zebrafish
Match: rbfox3b (RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-GENE-091204-46])

HSP 1 Score: 149.828 bits (377), Expect = 1.197e-40
Identity = 76/130 (58.46%), Postives = 92/130 (70.77%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVL-ARNSIGNVTLTGYNFPLNASMLA 792
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF  + DA+RARE LNG +VEGRKIEVN+ATAR+MT KK       V   TN+  L  V+ A  +     +TG+ +P   + +A
Sbjct:   90 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKK------VVNPYTNSWKLNPVVGAVYAPELYAVTGFPYPAAGATVA 213          
BLAST of RNA binding protein fox-1 vs. Ensembl Zebrafish
Match: rbfox3a (RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-GENE-111213-1])

HSP 1 Score: 148.288 bits (373), Expect = 7.412e-40
Identity = 75/130 (57.69%), Postives = 89/130 (68.46%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVL-ARNSIGNVTLTGYNFPLNASMLA 792
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF  + DA+RARE LNG +VEGRKIEVN+ATAR+MT KK           TN   L  V+ A        +TG+ +P   + +A
Sbjct:  111 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKK------VANPYTNGWKLNPVVGAVYGPEFYAVTGFPYPTTGATVA 234          
BLAST of RNA binding protein fox-1 vs. Ensembl Zebrafish
Match: rbfox3a (RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-GENE-111213-1])

HSP 1 Score: 148.673 bits (374), Expect = 1.479e-39
Identity = 66/85 (77.65%), Postives = 74/85 (87.06%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF  + DA+RARE LNG +VEGRKIEVN+ATAR+MT KK
Sbjct:  152 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKK 236          
BLAST of RNA binding protein fox-1 vs. Ensembl Xenopus
Match: yaf2 (YY1 associated factor 2 [Source:Xenbase;Acc:XB-GENE-949941])

HSP 1 Score: 151.369 bits (381), Expect = 4.160e-41
Identity = 76/130 (58.46%), Postives = 91/130 (70.00%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVL-ARNSIGNVTLTGYNFPLNASMLA 792
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF  ++DA+RARE LNG +VEGRKIEVN+ATAR+MT KK       V   TN   L  V+ A        +TG+ +P   + +A
Sbjct:   97 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSMDADRAREKLNGTIVEGRKIEVNNATARVMTNKK------PVNPYTNGWKLNPVVGAVYGPEFYAVTGFPYPPAGATIA 220          
BLAST of RNA binding protein fox-1 vs. Ensembl Xenopus
Match: yaf2 (YY1 associated factor 2 [Source:Xenbase;Acc:XB-GENE-949941])

HSP 1 Score: 152.14 bits (383), Expect = 8.464e-41
Identity = 76/130 (58.46%), Postives = 91/130 (70.00%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVL-ARNSIGNVTLTGYNFPLNASMLA 792
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF  ++DA+RARE LNG +VEGRKIEVN+ATAR+MT KK       V   TN   L  V+ A        +TG+ +P   + +A
Sbjct:  142 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSMDADRAREKLNGTIVEGRKIEVNNATARVMTNKK------PVNPYTNGWKLNPVVGAVYGPEFYAVTGFPYPPAGATIA 265          
BLAST of RNA binding protein fox-1 vs. Ensembl Xenopus
Match: yaf2 (YY1 associated factor 2 [Source:Xenbase;Acc:XB-GENE-949941])

HSP 1 Score: 152.525 bits (384), Expect = 9.494e-41
Identity = 76/130 (58.46%), Postives = 91/130 (70.00%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVL-ARNSIGNVTLTGYNFPLNASMLA 792
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF  ++DA+RARE LNG +VEGRKIEVN+ATAR+MT KK       V   TN   L  V+ A        +TG+ +P   + +A
Sbjct:  142 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSMDADRAREKLNGTIVEGRKIEVNNATARVMTNKK------PVNPYTNGWKLNPVVGAVYGPEFYAVTGFPYPPAGATIA 265          
BLAST of RNA binding protein fox-1 vs. Ensembl Xenopus
Match: lsm12 (LSM12 homolog [Source:Xenbase;Acc:XB-GENE-5780031])

HSP 1 Score: 150.599 bits (379), Expect = 4.053e-40
Identity = 67/85 (78.82%), Postives = 75/85 (88.24%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:  105 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 189          
BLAST of RNA binding protein fox-1 vs. Ensembl Xenopus
Match: lsm12 (LSM12 homolog [Source:Xenbase;Acc:XB-GENE-5780031])

HSP 1 Score: 150.214 bits (378), Expect = 4.425e-40
Identity = 67/85 (78.82%), Postives = 75/85 (88.24%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:   96 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 180          
BLAST of RNA binding protein fox-1 vs. Ensembl Mouse
Match: Rbfox1 (RNA binding protein, fox-1 homolog (C. elegans) 1 [Source:MGI Symbol;Acc:MGI:1926224])

HSP 1 Score: 151.369 bits (381), Expect = 2.291e-41
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:  113 SQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 199          
BLAST of RNA binding protein fox-1 vs. Ensembl Mouse
Match: Rbfox2 (RNA binding protein, fox-1 homolog (C. elegans) 2 [Source:MGI Symbol;Acc:MGI:1933973])

HSP 1 Score: 150.984 bits (380), Expect = 2.689e-41
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:  131 STPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 217          
BLAST of RNA binding protein fox-1 vs. Ensembl Mouse
Match: Rbfox2 (RNA binding protein, fox-1 homolog (C. elegans) 2 [Source:MGI Symbol;Acc:MGI:1933973])

HSP 1 Score: 149.443 bits (376), Expect = 1.714e-40
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:  123 STPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 209          
BLAST of RNA binding protein fox-1 vs. Ensembl Mouse
Match: Rbfox2 (RNA binding protein, fox-1 homolog (C. elegans) 2 [Source:MGI Symbol;Acc:MGI:1933973])

HSP 1 Score: 150.599 bits (379), Expect = 1.799e-40
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:  109 STPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 195          
BLAST of RNA binding protein fox-1 vs. Ensembl Mouse
Match: Rbfox1 (RNA binding protein, fox-1 homolog (C. elegans) 1 [Source:MGI Symbol;Acc:MGI:1926224])

HSP 1 Score: 150.984 bits (380), Expect = 1.812e-40
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:   93 SQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 179          
BLAST of RNA binding protein fox-1 vs. UniProt/SwissProt
Match: sp|Q95KI0|RFOX1_MACFA (RNA binding protein fox-1 homolog 1 OS=Macaca fascicularis OX=9541 GN=RBFOX1 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.511e-39
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:  116 SQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 202          
BLAST of RNA binding protein fox-1 vs. UniProt/SwissProt
Match: sp|Q5NVN8|RFOX1_PONAB (RNA binding protein fox-1 homolog 1 OS=Pongo abelii OX=9601 GN=RBFOX1 PE=2 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 1.802e-39
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:  114 SQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 200          
BLAST of RNA binding protein fox-1 vs. UniProt/SwissProt
Match: sp|Q9JJ43|RFOX1_MOUSE (RNA binding protein fox-1 homolog 1 OS=Mus musculus OX=10090 GN=Rbfox1 PE=1 SV=3)

HSP 1 Score: 150.984 bits (380), Expect = 2.789e-39
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:  113 SQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 199          
BLAST of RNA binding protein fox-1 vs. UniProt/SwissProt
Match: sp|Q9NWB1|RFOX1_HUMAN (RNA binding protein fox-1 homolog 1 OS=Homo sapiens OX=9606 GN=RBFOX1 PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 3.243e-39
Identity = 68/87 (78.16%), Postives = 76/87 (87.36%), Query Frame = 1
Query:  400 SGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            S PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:  114 SQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 200          
BLAST of RNA binding protein fox-1 vs. UniProt/SwissProt
Match: sp|O43251|RFOX2_HUMAN (RNA binding protein fox-1 homolog 2 OS=Homo sapiens OX=9606 GN=RBFOX2 PE=1 SV=3)

HSP 1 Score: 149.828 bits (377), Expect = 6.367e-39
Identity = 69/91 (75.82%), Postives = 77/91 (84.62%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQA 678
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF N+ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK  T  A
Sbjct:  120 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARVMTNKKMVTPYA 210          
BLAST of RNA binding protein fox-1 vs. TrEMBL
Match: A0A564ZE62 (RRM domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14780 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 9.574e-44
Identity = 86/145 (59.31%), Postives = 108/145 (74.48%), Query Frame = 1
Query:  322 GMPVSALTNSTSEPNIFNVTLQNH----------FSSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVLA 726
            G P +++T S S P++ +    N            S+GPKRLHVSNIPFR+READLR LLGPFGTI+DVEIIFNERGSKGFGFVTFA   +A++ARESLNG +VEGRKIE+N+ATAR+MTKKK+E     +K+AT    +R+ L+
Sbjct:  159 GHPSTSVTTSISNPSVTSTIPGNTPVSSSSITPIASTGPKRLHVSNIPFRYREADLRQLLGPFGTILDVEIIFNERGSKGFGFVTFATPEEADKARESLNGTIVEGRKIEINNATARVMTKKKSEA-PTLMKTATTLRGIRNALS 302          
BLAST of RNA binding protein fox-1 vs. TrEMBL
Match: W6UMG1 (Fox-1 C OS=Echinococcus granulosus OX=6210 GN=EGR_05801 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 1.097e-43
Identity = 80/109 (73.39%), Postives = 94/109 (86.24%), Query Frame = 1
Query:  397 SSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVL 723
            S+GPKRLHVSNIPFRFREADLR LLGPFGTI+DVEIIFNERGSKGFGFVTFA   +A++ARE+LNG VVEGRKIE+N+ATAR+MTKKK+E     +K+AT    +R+ L
Sbjct:   56 STGPKRLHVSNIPFRFREADLRQLLGPFGTILDVEIIFNERGSKGFGFVTFATPEEADKARENLNGTVVEGRKIEINNATARVMTKKKSEA-PTLMKTATTLRGIRNAL 163          
BLAST of RNA binding protein fox-1 vs. TrEMBL
Match: A0A564ZEY3 (RRM domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS14780 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.410e-43
Identity = 86/145 (59.31%), Postives = 108/145 (74.48%), Query Frame = 1
Query:  322 GMPVSALTNSTSEPNIFNVTLQNH----------FSSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVLA 726
            G P +++T S S P++ +    N            S+GPKRLHVSNIPFR+READLR LLGPFGTI+DVEIIFNERGSKGFGFVTFA   +A++ARESLNG +VEGRKIE+N+ATAR+MTKKK+E     +K+AT    +R+ L+
Sbjct:  171 GHPSTSVTTSISNPSVTSTIPGNTPVSSSSITPIASTGPKRLHVSNIPFRYREADLRQLLGPFGTILDVEIIFNERGSKGFGFVTFATPEEADKARESLNGTIVEGRKIEINNATARVMTKKKSEA-PTLMKTATTLRGIRNALS 314          
BLAST of RNA binding protein fox-1 vs. TrEMBL
Match: A0A3P6QUU1 (RRM domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS9634 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 2.965e-43
Identity = 80/109 (73.39%), Postives = 94/109 (86.24%), Query Frame = 1
Query:  397 SSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVL 723
            S+GPKRLHVSNIPFRFREADLR LLGPFGTI+DVEIIFNERGSKGFGFVTFA   +A++ARE+LNG VVEGRKIE+N+ATAR+MTKKK+E     +K+AT    +R+ L
Sbjct:   65 STGPKRLHVSNIPFRFREADLRQLLGPFGTILDVEIIFNERGSKGFGFVTFATPEEADKARENLNGTVVEGRKIEINNATARVMTKKKSEA-PTLMKTATTLRGIRNAL 172          
BLAST of RNA binding protein fox-1 vs. TrEMBL
Match: A0A0R3WFJ0 (RRM domain-containing protein OS=Taenia asiatica OX=60517 PE=4 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 3.347e-43
Identity = 80/109 (73.39%), Postives = 94/109 (86.24%), Query Frame = 1
Query:  397 SSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVL 723
            S+GPKRLHVSNIPFRFREADLR LLGPFGTI+DVEIIFNERGSKGFGFVTFA   +A++ARE+LNG VVEGRKIE+N+ATAR+MTKKK+E     +K+AT    +R+ L
Sbjct:   65 STGPKRLHVSNIPFRFREADLRQLLGPFGTILDVEIIFNERGSKGFGFVTFATPEEADKARENLNGTVVEGRKIEINNATARVMTKKKSEA-PTLMKTATTLRGIRNAL 172          
BLAST of RNA binding protein fox-1 vs. Ensembl Cavefish
Match: rbfox3b (RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-GENE-091204-46])

HSP 1 Score: 150.984 bits (380), Expect = 1.316e-40
Identity = 67/86 (77.91%), Postives = 75/86 (87.21%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKA 663
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF  + DA+RARE LNG +VEGRKIEVN+ATAR+MT KKA
Sbjct:  138 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSTDADRAREKLNGTIVEGRKIEVNNATARVMTNKKA 223          
BLAST of RNA binding protein fox-1 vs. Ensembl Cavefish
Match: rbfox1l (RNA binding protein fox-1 homolog 1-like [Source:NCBI gene;Acc:103045177])

HSP 1 Score: 150.599 bits (379), Expect = 3.819e-40
Identity = 67/89 (75.28%), Postives = 77/89 (86.52%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETL 672
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF NA++A+RARE LNG +VEGRKIEVN+ATAR++TKK    L
Sbjct:  146 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFENAVEADRAREKLNGTIVEGRKIEVNNATARVVTKKPQTPL 234          
BLAST of RNA binding protein fox-1 vs. Ensembl Cavefish
Match: rbfox3b (RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-GENE-091204-46])

HSP 1 Score: 150.599 bits (379), Expect = 3.985e-40
Identity = 67/86 (77.91%), Postives = 75/86 (87.21%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKA 663
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF  + DA+RARE LNG +VEGRKIEVN+ATAR+MT KKA
Sbjct:  187 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSTDADRAREKLNGTIVEGRKIEVNNATARVMTNKKA 272          
BLAST of RNA binding protein fox-1 vs. Ensembl Cavefish
Match: rbfox1 (RNA binding fox-1 homolog 1 [Source:NCBI gene;Acc:449554])

HSP 1 Score: 149.058 bits (375), Expect = 4.371e-40
Identity = 66/85 (77.65%), Postives = 75/85 (88.24%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF ++ DA+RARE L+G VVEGRKIEVN+ATAR+MT KK
Sbjct:  139 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFESSADADRAREKLHGTVVEGRKIEVNNATARVMTNKK 223          
BLAST of RNA binding protein fox-1 vs. Ensembl Cavefish
Match: rbfox3a (RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-GENE-111213-1])

HSP 1 Score: 147.902 bits (372), Expect = 9.181e-40
Identity = 75/130 (57.69%), Postives = 89/130 (68.46%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVL-ARNSIGNVTLTGYNFPLNASMLA 792
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF  + DA+RARE LNG +VEGRKIEVN+ATAR+MT KK           TN   L  V+ A        +TG+ +P   + +A
Sbjct:  116 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSADADRAREKLNGTIVEGRKIEVNNATARVMTNKK------VANPYTNGWKLNPVVGAVYGPEFYAVTGFPYPTTGATVA 239          
BLAST of RNA binding protein fox-1 vs. Ensembl Sea Lamprey
Match: rbfox3b (RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-GENE-091204-46])

HSP 1 Score: 74.7146 bits (182), Expect = 1.168e-15
Identity = 34/46 (73.91%), Postives = 41/46 (89.13%), Query Frame = 1
Query:  526 KGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKA 663
            +GFGFVTF N+ DA+RARE L+G +VEGRKIEVN+ATAR+MT KKA
Sbjct:    2 QGFGFVTFENSADADRAREKLHGTMVEGRKIEVNNATARVMTNKKA 47          
BLAST of RNA binding protein fox-1 vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 72.0182 bits (175), Expect = 1.409e-13
Identity = 36/83 (43.37%), Postives = 57/83 (68.67%), Query Frame = 1
Query:  394 FSSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFN-ERG-SKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHAT 636
             +SGP RL+V ++ F   EA L  +  PFG I +++++ + E G SKGFGF+TF++A  A++A E LNGF + GR ++VN+ +
Sbjct:  267 LASGPMRLYVGSLHFNITEAMLMGIFEPFGKIDNIQLMMDPETGRSKGFGFITFSSADCAKKALEQLNGFELAGRPMKVNYVS 349          
BLAST of RNA binding protein fox-1 vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 71.2478 bits (173), Expect = 2.180e-13
Identity = 51/167 (30.54%), Postives = 83/167 (49.70%), Query Frame = 1
Query:  163 NFLAATSNSTQNRLISDQDISNGPTEIFKLKEEASKVSFSSNEVTNISNSILPGMPV-----SALTNSTSEPNIFNVTLQNHFSSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFN-ERG-SKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATAR 642
             F +A       R+ISD++        +    E   VS +      ++   L G+P+      A  N  +       T+Q   ++GP RL+V ++ F   E  L+ +  PFG I + +++ + + G S+G+GFVTFA+A  A +A E LNGF + GR ++V H T R
Sbjct:  177 EFFSAVGKVRDVRMISDRNSRRSKGIAYIEFVEVDSVSLA----IGLTGQRLLGVPIIVQASQAEKNRAAAAAAAAATMQKS-TAGPMRLYVGSLHFNITEDMLKGIFEPFGKIENCQLMMDSDTGRSRGYGFVTFADAECARKALEQLNGFELAGRPMKVGHVTER 338          
BLAST of RNA binding protein fox-1 vs. Ensembl Sea Lamprey
Match: BOLL (boule homolog, RNA binding protein [Source:HGNC Symbol;Acc:HGNC:14273])

HSP 1 Score: 56.6102 bits (135), Expect = 4.205e-9
Identity = 27/80 (33.75%), Postives = 46/80 (57.50%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERG-SKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATAR 642
            P R+ V  I F+  EA+L+     FG + DV+II +  G SKG+GFVTF +  DA++ ++     + + +K+ +  A  +
Sbjct:   41 PNRIFVGGIDFKVNEAELKKYFTQFGVVKDVKIINDRAGVSKGYGFVTFESQEDAQKIQQEAEKIMYKDKKLNIGPAIRK 120          
BLAST of RNA binding protein fox-1 vs. Ensembl Sea Lamprey
Match: tia1l (cytotoxic granule-associated RNA binding protein 1, like [Source:ZFIN;Acc:ZDB-GENE-030131-2167])

HSP 1 Score: 55.8398 bits (133), Expect = 5.026e-9
Identity = 28/65 (43.08%), Postives = 38/65 (58.46%), Query Frame = 1
Query:  454 DLRALLGPFGTIIDVEIIFN--ERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATAR 642
            DLRA   PFG I D  ++ +     SKG+GFV+F   LDAE A + + G  + GR+I  N AT +
Sbjct:   18 DLRAAFAPFGKISDARVVKDLATGKSKGYGFVSFFQKLDAENAIQQMGGQWLGGRQIRTNWATRK 82          
BLAST of RNA binding protein fox-1 vs. Ensembl Yeast
Match: NGR1 (RNA binding protein that negatively regulates growth rate; interacts with the 3' UTR of the mitochondrial porin (POR1) mRNA and enhances its degradation; overexpression impairs mitochondrial function; interacts with Dhh1p to mediate POR1 mRNA decay; expressed in stationary phase [Source:SGD;Acc:S000000416])

HSP 1 Score: 52.7582 bits (125), Expect = 1.128e-7
Identity = 33/99 (33.33%), Postives = 49/99 (49.49%), Query Frame = 1
Query:  448 EADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVLARNSIGN 744
            E  LR+L  PFG I++V I       K  GFV F   +DAE + + L GF+V G  I ++         K   T+  A +  + +N LR+  A +S+ N
Sbjct:  373 EFQLRSLFKPFGPILNVRI----PNGKNCGFVKFEKRIDAEASIQGLQGFIVGGSPIRLSWGRPSSSNAKTNSTIMGASQYMS-SNGLRAPSAASSVDN 466          
BLAST of RNA binding protein fox-1 vs. Ensembl Yeast
Match: NOP15 (Constituent of 66S pre-ribosomal particles; involved in 60S ribosomal subunit biogenesis; localizes to both nucleolus and cytoplasm [Source:SGD;Acc:S000005054])

HSP 1 Score: 47.3654 bits (111), Expect = 1.796e-6
Identity = 23/72 (31.94%), Postives = 42/72 (58.33%), Query Frame = 1
Query:  415 LHVSNIPFRFREADLRALLGPFGTIIDVEIIFNER--GSKGFGFVTFANALDAERARESLNGFVVEGRKIEV 624
            ++VS +P  F E +L      FG + +V +  N++   S+ +GF+ F N  DA  A+ES+N +++ G  ++V
Sbjct:   93 IYVSRLPHGFHEKELSKYFAQFGDLKEVRLARNKKTGNSRHYGFLEFVNKEDAMIAQESMNNYLLMGHLLQV 164          
BLAST of RNA binding protein fox-1 vs. Ensembl Nematostella
Match: EDO44890 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUE7])

HSP 1 Score: 122.094 bits (305), Expect = 1.112e-33
Identity = 56/80 (70.00%), Postives = 66/80 (82.50%), Query Frame = 1
Query:  385 QNHFSSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEV 624
            +N  SSGPKRLHV+NIPFRFR+ DLR + G FG I DVEII+NERGSKGFGFVTF  A +A +ARE LNG +V+GRK+EV
Sbjct:    2 ENGDSSGPKRLHVTNIPFRFRDNDLRQMFGSFGVIADVEIIYNERGSKGFGFVTFNTAAEANKAREKLNGTIVDGRKVEV 81          
BLAST of RNA binding protein fox-1 vs. Ensembl Nematostella
Match: EDO33926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQW0])

HSP 1 Score: 70.4774 bits (171), Expect = 5.860e-13
Identity = 34/82 (41.46%), Postives = 52/82 (63.41%), Query Frame = 1
Query:  403 GPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNER--GSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATAR 642
            GP RL+V ++ F   EA ++A+  PFGT+  V++I++     SKG+GFV F  A  A+RA E +NGF + GR +++   T R
Sbjct:  213 GPTRLYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKIGPVTER 294          
BLAST of RNA binding protein fox-1 vs. Ensembl Nematostella
Match: EDO29715 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2V2])

HSP 1 Score: 59.3066 bits (142), Expect = 2.476e-11
Identity = 34/76 (44.74%), Postives = 45/76 (59.21%), Query Frame = 1
Query:  415 LHVSNIPFRFREADLRALLGPFGTIIDVEII---FNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHA 633
            + V ++PF   EADLR     +G +  V+II   F  R SKGFGFV   N  +A++A + LNG  VEGR I VN +
Sbjct:    3 IFVGSLPFSIEEADLRGFFEEYGAVDSVKIISDKFTGR-SKGFGFVEMPNDAEAQKAIDELNGGTVEGRTIVVNKS 77          
BLAST of RNA binding protein fox-1 vs. Ensembl Nematostella
Match: EDO29519 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T3E7])

HSP 1 Score: 60.8474 bits (146), Expect = 4.277e-11
Identity = 29/102 (28.43%), Postives = 56/102 (54.90%), Query Frame = 1
Query:  349 STSEPNIFNVTLQNHFSSGPKR-------LHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERG--SKGFGFVTFANALDAERARESLNGFVVEGRKIEVN 627
            S + P ++N  L    +  P++       L + ++P  F +ADL     PFGT+I  ++  +++   SK FGFV++ N + A+ A + +NGF +  ++++V 
Sbjct:   47 SAAFPTVYNQALYQQTARQPQKEGPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQ 148          
BLAST of RNA binding protein fox-1 vs. Ensembl Nematostella
Match: EDO30576 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T0E1])

HSP 1 Score: 62.003 bits (149), Expect = 2.694e-10
Identity = 27/85 (31.76%), Postives = 52/85 (61.18%), Query Frame = 1
Query:  385 QNHFSSGPK--RLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERG--SKGFGFVTFANALDAERARESLNGFVVEGRKIEVN 627
            ++H++ GP    L + ++P  F +ADL     PFGT+I  ++  +++   SK FGFV++ N + A+ A + +NGF +  ++++V 
Sbjct:  360 ESHYTPGPDGSNLFIYHLPQEFTDADLMQTFQPFGTVISAKVFIDKQTNMSKCFGFVSYDNVMSAQNAIQHMNGFQIGAKRLKVQ 444          
BLAST of RNA binding protein fox-1 vs. Ensembl Medaka
Match: rbfox2 (RNA binding protein fox-1 homolog 2 [Source:NCBI gene;Acc:101157754])

HSP 1 Score: 148.288 bits (373), Expect = 2.495e-39
Identity = 67/88 (76.14%), Postives = 76/88 (86.36%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAET 669
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF ++ DAERARE L+G +VEGRKIEVN+ATAR+MT KK  T
Sbjct:  112 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFESSADAERAREKLHGTLVEGRKIEVNNATARVMTNKKITT 199          
BLAST of RNA binding protein fox-1 vs. Ensembl Medaka
Match: rbfox1l (RNA binding protein fox-1 homolog 1-like [Source:NCBI gene;Acc:101163271])

HSP 1 Score: 147.902 bits (372), Expect = 3.207e-39
Identity = 74/129 (57.36%), Postives = 91/129 (70.54%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVLARNSIGNVTLTGYNFPLNASMLA 792
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF +A +A+RARE LNG +VEGRKIEVN+ATAR++TKK    L  A  +A+       V A  +    T+  + +P+    LA
Sbjct:  144 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFESAAEADRAREKLNGTIVEGRKIEVNNATARVVTKKPQTPLVNADIAASGWKINPMVGAMYAPELYTVASFPYPVATPTLA 272          
BLAST of RNA binding protein fox-1 vs. Ensembl Medaka
Match: rbfox1l (RNA binding protein fox-1 homolog 1-like [Source:NCBI gene;Acc:101163271])

HSP 1 Score: 147.517 bits (371), Expect = 4.942e-39
Identity = 74/129 (57.36%), Postives = 91/129 (70.54%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVLARNSIGNVTLTGYNFPLNASMLA 792
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF +A +A+RARE LNG +VEGRKIEVN+ATAR++TKK    L  A  +A+       V A  +    T+  + +P+    LA
Sbjct:  144 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFESAAEADRAREKLNGTIVEGRKIEVNNATARVVTKKPQTPLVNADIAASGWKINPMVGAMYAPELYTVASFPYPVATPTLA 272          
BLAST of RNA binding protein fox-1 vs. Ensembl Medaka
Match: rbfox3b (RNA binding fox-1 homolog 3 [Source:NCBI gene;Acc:101159826])

HSP 1 Score: 149.443 bits (376), Expect = 1.032e-38
Identity = 66/85 (77.65%), Postives = 74/85 (87.06%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKK 660
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF  + DA+RARE LNG +VEGRKIEVN+ATAR+MT KK
Sbjct:  329 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFETSTDADRAREKLNGTIVEGRKIEVNNATARVMTNKK 413          
BLAST of RNA binding protein fox-1 vs. Ensembl Medaka
Match: rbfox1l (RNA binding protein fox-1 homolog 1-like [Source:NCBI gene;Acc:101163271])

HSP 1 Score: 146.362 bits (368), Expect = 1.195e-38
Identity = 74/129 (57.36%), Postives = 91/129 (70.54%), Query Frame = 1
Query:  406 PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVLARNSIGNVTLTGYNFPLNASMLA 792
            PKRLHVSNIPFRFR+ DLR + G FG I+DVEIIFNERGSKGFGFVTF +A +A+RARE LNG +VEGRKIEVN+ATAR++TKK    L  A  +A+       V A  +    T+  + +P+    LA
Sbjct:  143 PKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGFGFVTFESAAEADRAREKLNGTIVEGRKIEVNNATARVVTKKPQTPLVNADIAASGWKINPMVGAMYAPELYTVASFPYPVATPTLA 271          
BLAST of RNA binding protein fox-1 vs. Planmine SMEST
Match: SMESG000033763.1 (SMESG000033763.1)

HSP 1 Score: 580.482 bits (1495), Expect = 0.000e+0
Identity = 325/325 (100.00%), Postives = 325/325 (100.00%), Query Frame = 1
Query:  106 MCDTQMVQNQQSSNPVINGNFLAATSNSTQNRLISDQDISNGPTEIFKLKEEASKVSFSSNEVTNISNSILPGMPVSALTNSTSEPNIFNVTLQNHFSSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVLARNSIGNVTLTGYNFPLNASMLAASNILRPVXXXXXXXXXXXXXTDPAILTALASTDIARLQSGLTYNNLLGYNGSTIVRNPTNXXXXXXXXXXXXXXXXXXNTINLSTPLVNASLLTS 1080
            MCDTQMVQNQQSSNPVINGNFLAATSNSTQNRLISDQDISNGPTEIFKLKEEASKVSFSSNEVTNISNSILPGMPVSALTNSTSEPNIFNVTLQNHFSSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVLARNSIGNVTLTGYNFPLNASMLAASNILRPVQSQLLQSYNSLYLTDPAILTALASTDIARLQSGLTYNNLLGYNGSTIVRNPTNLTTLTAMSAQSAAQTASANTINLSTPLVNASLLTS
Sbjct:    1 MCDTQMVQNQQSSNPVINGNFLAATSNSTQNRLISDQDISNGPTEIFKLKEEASKVSFSSNEVTNISNSILPGMPVSALTNSTSEPNIFNVTLQNHFSSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNANALRSVLARNSIGNVTLTGYNFPLNASMLAASNILRPVQSQLLQSYNSLYLTDPAILTALASTDIARLQSGLTYNNLLGYNGSTIVRNPTNLTTLTAMSAQSAAQTASANTINLSTPLVNASLLTS 325          

HSP 2 Score: 76.6406 bits (187), Expect = 6.309e-15
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 2
Query: 1082 QIRLELMPQLFILISTVQLISRSLHLIKDMRIMQITC 1192
            QIRLELMPQLFILISTVQLISRSLHLIKDMRIMQITC
Sbjct:  326 QIRLELMPQLFILISTVQLISRSLHLIKDMRIMQITC 362          
BLAST of RNA binding protein fox-1 vs. Planmine SMEST
Match: SMESG000033763.1 (SMESG000033763.1)

HSP 1 Score: 348.591 bits (893), Expect = 2.432e-112
Identity = 167/167 (100.00%), Postives = 167/167 (100.00%), Query Frame = 1
Query:  121 MVQNQQSSNPVINGNFLAATSNSTQNRLISDQDISNGPTEIFKLKEEASKVSFSSNEVTNISNSILPGMPVSALTNSTSEPNIFNVTLQNHFSSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIE 621
            MVQNQQSSNPVINGNFLAATSNSTQNRLISDQDISNGPTEIFKLKEEASKVSFSSNEVTNISNSILPGMPVSALTNSTSEPNIFNVTLQNHFSSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIE
Sbjct:    1 MVQNQQSSNPVINGNFLAATSNSTQNRLISDQDISNGPTEIFKLKEEASKVSFSSNEVTNISNSILPGMPVSALTNSTSEPNIFNVTLQNHFSSGPKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIE 167          

HSP 2 Score: 227.254 bits (578), Expect = 2.434e-75
Identity = 153/154 (99.35%), Postives = 154/154 (100.00%), Query Frame = 1
Query:  619 EVNHATARIMTKKKAETLQAAVKSATNANALRSVLARNSIGNVTLTGYNFPLNASMLAASNILRPVXXXXXXXXXXXXXTDPAILTALASTDIARLQSGLTYNNLLGYNGSTIVRNPTNXXXXXXXXXXXXXXXXXXNTINLSTPLVNASLLTS 1080
            +VNHATARIMTKKKAETLQAAVKSATNANALRSVLARNSIGNVTLTGYNFPLNASMLAASNILRPVQSQLLQSYNSLYLTDPAILTALASTDIARLQSGLTYNNLLGYNGSTIVRNPTNLTTLTAMSAQSAAQTASANTINLSTPLVNASLLTS
Sbjct:  473 KVNHATARIMTKKKAETLQAAVKSATNANALRSVLARNSIGNVTLTGYNFPLNASMLAASNILRPVQSQLLQSYNSLYLTDPAILTALASTDIARLQSGLTYNNLLGYNGSTIVRNPTNLTTLTAMSAQSAAQTASANTINLSTPLVNASLLTS 626          

HSP 3 Score: 75.485 bits (184), Expect = 2.434e-75
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 2
Query: 1082 QIRLELMPQLFILISTVQLISRSLHLIKDMRIMQITC 1192
            QIRLELMPQLFILISTVQLISRSLHLIKDMRIMQITC
Sbjct:  627 QIRLELMPQLFILISTVQLISRSLHLIKDMRIMQITC 663          
BLAST of RNA binding protein fox-1 vs. Planmine SMEST
Match: SMESG000033763.1 (SMESG000033763.1)

HSP 1 Score: 209.534 bits (532), Expect = 1.516e-70
Identity = 145/145 (100.00%), Postives = 145/145 (100.00%), Query Frame = 1
Query:  646 MTKKKAETLQAAVKSATNANALRSVLARNSIGNVTLTGYNFPLNASMLAASNILRPVXXXXXXXXXXXXXTDPAILTALASTDIARLQSGLTYNNLLGYNGSTIVRNPTNXXXXXXXXXXXXXXXXXXNTINLSTPLVNASLLTS 1080
            MTKKKAETLQAAVKSATNANALRSVLARNSIGNVTLTGYNFPLNASMLAASNILRPVQSQLLQSYNSLYLTDPAILTALASTDIARLQSGLTYNNLLGYNGSTIVRNPTNLTTLTAMSAQSAAQTASANTINLSTPLVNASLLTS
Sbjct:    1 MTKKKAETLQAAVKSATNANALRSVLARNSIGNVTLTGYNFPLNASMLAASNILRPVQSQLLQSYNSLYLTDPAILTALASTDIARLQSGLTYNNLLGYNGSTIVRNPTNLTTLTAMSAQSAAQTASANTINLSTPLVNASLLTS 145          

HSP 2 Score: 77.0258 bits (188), Expect = 1.516e-70
Identity = 37/37 (100.00%), Postives = 37/37 (100.00%), Query Frame = 2
Query: 1082 QIRLELMPQLFILISTVQLISRSLHLIKDMRIMQITC 1192
            QIRLELMPQLFILISTVQLISRSLHLIKDMRIMQITC
Sbjct:  146 QIRLELMPQLFILISTVQLISRSLHLIKDMRIMQITC 182          
BLAST of RNA binding protein fox-1 vs. Planmine SMEST
Match: SMESG000019470.1 (SMESG000019470.1)

HSP 1 Score: 142.51 bits (358), Expect = 1.585e-38
Identity = 78/152 (51.32%), Postives = 99/152 (65.13%), Query Frame = 1
Query:  409 KRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAET---------LQAAVKSATNANAL---RSV-LARNSI---GNVTLTGYNFPLNASMLAASNILRPV 816
            KR+H+SNIPFR+RE+D+R LL P+G ++DVEIIFNERGSKGFGFVTFAN  DA +AR+ LNG  VEGR+IE+N ATAR+M KKK E           Q A+    N N      SV L  NS+      T+   N  LN+++   SN+L P+
Sbjct:   29 KRMHISNIPFRYRESDVRQLLKPYGQLLDVEIIFNERGSKGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSNVRYPLSQQAMLPTNNHNVWPLSSSVPLVTNSLCIGAQNTMHSNNLILNSNLCNPSNLLMPL 180          
BLAST of RNA binding protein fox-1 vs. Planmine SMEST
Match: SMESG000019470.1 (SMESG000019470.1)

HSP 1 Score: 136.346 bits (342), Expect = 3.336e-36
Identity = 78/157 (49.68%), Postives = 99/157 (63.06%), Query Frame = 1
Query:  409 KRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSK-----GFGFVTFANALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAET---------LQAAVKSATNANAL---RSV-LARNSI---GNVTLTGYNFPLNASMLAASNILRPV 816
            KR+H+SNIPFR+RE+D+R LL P+G ++DVEIIFNERGSK     GFGFVTFAN  DA +AR+ LNG  VEGR+IE+N ATAR+M KKK E           Q A+    N N      SV L  NS+      T+   N  LN+++   SN+L P+
Sbjct:   29 KRMHISNIPFRYRESDVRQLLKPYGQLLDVEIIFNERGSKNFSGTGFGFVTFANPDDAAKARDDLNGKDVEGRRIEINVATARMMAKKKVENGVSNVRYPLSQQAMLPTNNHNVWPLSSSVPLVTNSLCIGAQNTMHSNNLILNSNLCNPSNLLMPL 185          
The following BLAST results are available for this feature:
BLAST of RNA binding protein fox-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RBFOX16.952e-4278.16RNA binding fox-1 homolog 1 [Source:HGNC Symbol;Ac... [more]
RBFOX17.069e-4278.16RNA binding fox-1 homolog 1 [Source:HGNC Symbol;Ac... [more]
RBFOX22.704e-4178.16RNA binding fox-1 homolog 2 [Source:HGNC Symbol;Ac... [more]
RBFOX22.704e-4178.16RNA binding fox-1 homolog 2 [Source:HGNC Symbol;Ac... [more]
RBFOX13.922e-4078.16RNA binding fox-1 homolog 1 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of RNA binding protein fox-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fox-14.372e-3567.42Sex determination protein fox-1 [Source:UniProtKB... [more]
fox-15.892e-3567.42Sex determination protein fox-1 [Source:UniProtKB... [more]
fox-18.082e-3567.42Sex determination protein fox-1 [Source:UniProtKB... [more]
asd-19.589e-3356.31RNA-binding protein ASD-1 [Source:UniProtKB/TrEMB... [more]
asd-11.407e-3256.31RNA-binding protein ASD-1 [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of RNA binding protein fox-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbfox11.432e-4266.13gene:FBgn0052062 transcript:FBtr0113419[more]
Rbfox12.487e-4266.13gene:FBgn0052062 transcript:FBtr0305095[more]
Rbfox12.849e-4266.13gene:FBgn0052062 transcript:FBtr0305097[more]
Rbfox12.851e-4266.13gene:FBgn0052062 transcript:FBtr0113418[more]
Rbfox13.561e-4182.56gene:FBgn0052062 transcript:FBtr0332985[more]
back to top
BLAST of RNA binding protein fox-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbfox3b8.462e-4277.65RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-... [more]
rbfox18.436e-4177.65RNA binding fox-1 homolog 1 [Source:NCBI gene;Acc:... [more]
rbfox3b1.197e-4058.46RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-... [more]
rbfox3a7.412e-4057.69RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-... [more]
rbfox3a1.479e-3977.65RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of RNA binding protein fox-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
yaf24.160e-4158.46YY1 associated factor 2 [Source:Xenbase;Acc:XB-GEN... [more]
yaf28.464e-4158.46YY1 associated factor 2 [Source:Xenbase;Acc:XB-GEN... [more]
yaf29.494e-4158.46YY1 associated factor 2 [Source:Xenbase;Acc:XB-GEN... [more]
lsm124.053e-4078.82LSM12 homolog [Source:Xenbase;Acc:XB-GENE-5780031][more]
lsm124.425e-4078.82LSM12 homolog [Source:Xenbase;Acc:XB-GENE-5780031][more]
back to top
BLAST of RNA binding protein fox-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rbfox12.291e-4178.16RNA binding protein, fox-1 homolog (C. elegans) 1 ... [more]
Rbfox22.689e-4178.16RNA binding protein, fox-1 homolog (C. elegans) 2 ... [more]
Rbfox21.714e-4078.16RNA binding protein, fox-1 homolog (C. elegans) 2 ... [more]
Rbfox21.799e-4078.16RNA binding protein, fox-1 homolog (C. elegans) 2 ... [more]
Rbfox11.812e-4078.16RNA binding protein, fox-1 homolog (C. elegans) 1 ... [more]
back to top
BLAST of RNA binding protein fox-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q95KI0|RFOX1_MACFA1.511e-3978.16RNA binding protein fox-1 homolog 1 OS=Macaca fasc... [more]
sp|Q5NVN8|RFOX1_PONAB1.802e-3978.16RNA binding protein fox-1 homolog 1 OS=Pongo abeli... [more]
sp|Q9JJ43|RFOX1_MOUSE2.789e-3978.16RNA binding protein fox-1 homolog 1 OS=Mus musculu... [more]
sp|Q9NWB1|RFOX1_HUMAN3.243e-3978.16RNA binding protein fox-1 homolog 1 OS=Homo sapien... [more]
sp|O43251|RFOX2_HUMAN6.367e-3975.82RNA binding protein fox-1 homolog 2 OS=Homo sapien... [more]
back to top
BLAST of RNA binding protein fox-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564ZE629.574e-4459.31RRM domain-containing protein OS=Hymenolepis dimin... [more]
W6UMG11.097e-4373.39Fox-1 C OS=Echinococcus granulosus OX=6210 GN=EGR_... [more]
A0A564ZEY31.410e-4359.31RRM domain-containing protein OS=Hymenolepis dimin... [more]
A0A3P6QUU12.965e-4373.39RRM domain-containing protein OS=Taenia asiatica O... [more]
A0A0R3WFJ03.347e-4373.39RRM domain-containing protein OS=Taenia asiatica O... [more]
back to top
BLAST of RNA binding protein fox-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbfox3b1.316e-4077.91RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-... [more]
rbfox1l3.819e-4075.28RNA binding protein fox-1 homolog 1-like [Source:N... [more]
rbfox3b3.985e-4077.91RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-... [more]
rbfox14.371e-4077.65RNA binding fox-1 homolog 1 [Source:NCBI gene;Acc:... [more]
rbfox3a9.181e-4057.69RNA binding fox-1 homolog 3a [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of RNA binding protein fox-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbfox3b1.168e-1573.91RNA binding fox-1 homolog 3b [Source:ZFIN;Acc:ZDB-... [more]
RBM391.409e-1343.37RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
RBM392.180e-1330.54RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
BOLL4.205e-933.75boule homolog, RNA binding protein [Source:HGNC Sy... [more]
tia1l5.026e-943.08cytotoxic granule-associated RNA binding protein 1... [more]
back to top
BLAST of RNA binding protein fox-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
NGR11.128e-733.33RNA binding protein that negatively regulates grow... [more]
NOP151.796e-631.94Constituent of 66S pre-ribosomal particles; involv... [more]
back to top
BLAST of RNA binding protein fox-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO448901.112e-3370.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339265.860e-1341.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297152.476e-1144.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO295194.277e-1128.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO305762.694e-1031.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RNA binding protein fox-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbfox22.495e-3976.14RNA binding protein fox-1 homolog 2 [Source:NCBI g... [more]
rbfox1l3.207e-3957.36RNA binding protein fox-1 homolog 1-like [Source:N... [more]
rbfox1l4.942e-3957.36RNA binding protein fox-1 homolog 1-like [Source:N... [more]
rbfox3b1.032e-3877.65RNA binding fox-1 homolog 3 [Source:NCBI gene;Acc:... [more]
rbfox1l1.195e-3857.36RNA binding protein fox-1 homolog 1-like [Source:N... [more]
back to top
BLAST of RNA binding protein fox-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033763.16.309e-15100.00SMESG000033763.1[more]
SMESG000033763.12.432e-112100.00SMESG000033763.1[more]
SMESG000033763.11.516e-70100.00SMESG000033763.1[more]
SMESG000019470.11.585e-3851.32SMESG000019470.1[more]
SMESG000019470.13.336e-3649.68SMESG000019470.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031721 ID=SMED30031721|Name=RNA binding protein fox-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1615bp
AAAATTTGTTCGATCTTTATAGTCGAAATTTGTTCGGTTTAATATTTCTG
CCATTTTACCGATTCTCAATTGTGATAGTATCGTTTTCAAAGTGGATTTT
AATTGATGTGCGATACGCAAATGGTTCAGAATCAACAGTCTTCAAATCCT
GTGATTAATGGAAATTTTCTTGCTGCAACTTCGAATTCGACACAAAATCG
CCTCATCAGTGACCAAGACATTTCAAATGGTCCAACGGAAATCTTCAAGC
TGAAGGAAGAAGCTTCAAAAGTTTCATTTTCCTCAAATGAAGTCACAAAT
ATTTCCAATTCAATATTACCAGGAATGCCAGTTTCAGCACTAACGAATTC
AACCTCTGAACCAAATATATTTAATGTGACTCTTCAAAATCACTTTTCCT
CAGGACCAAAGAGACTTCATGTATCGAACATACCATTCAGGTTTCGTGAA
GCAGATTTACGTGCATTACTTGGTCCTTTTGGTACAATAATAGATGTAGA
AATAATTTTTAATGAAAGAGGATCAAAGGGATTTGGATTTGTAACATTTG
CTAATGCTTTGGATGCCGAAAGAGCCAGGGAAAGTCTTAATGGGTTTGTT
GTAGAAGGAAGAAAGATTGAAGTCAATCATGCAACAGCGAGAATTATGAC
CAAGAAAAAAGCTGAAACATTACAAGCTGCTGTCAAATCAGCAACAAATG
CCAATGCTCTGAGAAGTGTGCTTGCCCGTAATTCAATTGGAAACGTTACT
CTGACGGGATATAATTTCCCACTCAATGCGTCCATGCTAGCCGCATCAAA
TATATTGAGACCTGTTCAGTCACAACTCTTACAGTCCTACAATTCTCTCT
ATTTGACGGATCCAGCTATTCTTACAGCTCTGGCTTCAACTGATATAGCC
CGTCTGCAAAGTGGATTAACTTACAATAATCTACTTGGATACAATGGGTC
AACAATTGTTAGAAATCCCACAAATTTGACAACCCTAACAGCGATGAGTG
CTCAATCAGCTGCTCAAACTGCTAGTGCAAATACAATTAATCTCAGTACT
CCACTCGTCAATGCGTCGTTGCTAACTTCCGCAAATCCGACTGGAATTAA
TGCCGCAGCTCTTTATCCTAATCTCCACAGTTCAATTAATCAGTCGCTCA
CTTCACTTAATCAAGGATATGCGGATTATGCAAATAACCTGCTAACAGTC
GATTCTCTGTCCCGGCTGGCGGCGGCAGGAGCGTACGGATTTACTGGGAT
CGCCTCTCCTTCTATTTATAGATCTAATCAAAGATTCTCTCCTTATTAAA
TGTCTTCTTTATCGATTATTTGAACATTTAAAGAATTGAAGTTTCTGTTT
TTCAATTATTTTAGACCCATTATAATGCATTTGTTTCGGTTTCTTTCATT
TCAATGTTCACTAGAACTTTATGCTGACCAGATGAAAGTAGTTGAAACTA
TTTTGAATTTATTATTTGGCATGCTGAATATATTGTCATTTGTTTTAATT
TCCGTACCAAAAACACAAACTGGTTCTGACAGTATTATAATGTATATAGA
TTACTTTTTGGTATTTCATGACAAATTTTATCTTTCATTTGACTAATTTC
TCTAAGCCATTTGGC
back to top

protein sequence of SMED30031721-orf-1

>SMED30031721-orf-1 ID=SMED30031721-orf-1|Name=SMED30031721-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=398bp
MCDTQMVQNQQSSNPVINGNFLAATSNSTQNRLISDQDISNGPTEIFKLK
EEASKVSFSSNEVTNISNSILPGMPVSALTNSTSEPNIFNVTLQNHFSSG
PKRLHVSNIPFRFREADLRALLGPFGTIIDVEIIFNERGSKGFGFVTFAN
ALDAERARESLNGFVVEGRKIEVNHATARIMTKKKAETLQAAVKSATNAN
ALRSVLARNSIGNVTLTGYNFPLNASMLAASNILRPVQSQLLQSYNSLYL
TDPAILTALASTDIARLQSGLTYNNLLGYNGSTIVRNPTNLTTLTAMSAQ
SAAQTASANTINLSTPLVNASLLTSANPTGINAAALYPNLHSSINQSLTS
LNQGYADYANNLLTVDSLSRLAAAGAYGFTGIASPSIYRSNQRFSPY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000504RRM_dom
IPR012677Nucleotide-bd_a/b_plait_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding