ADP-ribosylation factor-like protein 8B

Overview
NameADP-ribosylation factor-like protein 8B
Smed IDSMED30031703
Length (bp)4771
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ADP-ribosylation factor-like protein 8B (SMED30031703) t-SNE clustered cells

Violin plots show distribution of expression levels for ADP-ribosylation factor-like protein 8B (SMED30031703) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ADP-ribosylation factor-like protein 8B (SMED30031703) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ADP-ribosylation factor-like protein 8B (SMED30031703) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031703

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30031703SMESG000039067.1 Contig3195GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30031703SMESG000006523.1 Contig3195GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
parenchymal cellSMED30031703SMESG000033211.1 SMESG000033210.1 dd_Smed_v4_2667_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031703SMESG000006523.1 dd_Smed_v4_2465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30031703SMESG000006523.1 dd_Smed_v4_2465_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Human
Match: ARL8B (ADP ribosylation factor like GTPase 8B [Source:HGNC Symbol;Acc:HGNC:25564])

HSP 1 Score: 326.635 bits (836), Expect = 1.940e-102
Identity = 147/185 (79.46%), Postives = 172/185 (92.97%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   R L+W +SLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YM+D+AD +KIEA+RNELHNLLDKPQL  IPVLVLGNKRDLPNAL E +LIEK+NL+ I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Human
Match: ARL8B (ADP ribosylation factor like GTPase 8B [Source:HGNC Symbol;Acc:HGNC:25564])

HSP 1 Score: 326.635 bits (836), Expect = 1.940e-102
Identity = 147/185 (79.46%), Postives = 172/185 (92.97%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   R L+W +SLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YM+D+AD +KIEA+RNELHNLLDKPQL  IPVLVLGNKRDLPNAL E +LIEK+NL+ I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Human
Match: ARL8A (ADP ribosylation factor like GTPase 8A [Source:HGNC Symbol;Acc:HGNC:25192])

HSP 1 Score: 323.553 bits (828), Expect = 2.246e-101
Identity = 147/185 (79.46%), Postives = 171/185 (92.43%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M + F + L+W K+LFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF EDMIPTVGFNM+KITKGNV+IK+WDIGGQPRFRSMWERYCRGV+AI+YMVD+AD +KIEA++NELHNLLDKPQL  IPVLVLGNKRDLP AL E ELIEK+NL+ I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Human
Match: ARL8B (ADP ribosylation factor like GTPase 8B [Source:HGNC Symbol;Acc:HGNC:25564])

HSP 1 Score: 228.409 bits (581), Expect = 3.226e-68
Identity = 99/125 (79.20%), Postives = 116/125 (92.80%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPV 4157
            M +   R L+W +SLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YM+D+AD +KIEA+RNELHNLLDKPQL  IP+
Sbjct:    1 MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPI 125          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Human
Match: ARL8A (ADP ribosylation factor like GTPase 8A [Source:HGNC Symbol;Acc:HGNC:25192])

HSP 1 Score: 223.402 bits (568), Expect = 1.029e-66
Identity = 99/124 (79.84%), Postives = 115/124 (92.74%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIP 4154
            M + F + L+W K+LFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF EDMIPTVGFNM+KITKGNV+IK+WDIGGQPRFRSMWERYCRGV+AI+YMVD+AD +KIEA++NELHNLLDKPQL  IP
Sbjct:    1 MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIP 124          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Celegans
Match: arl-8 (ARF-Like; Novel small G protein indispensable for equal chromosome segregation [Source:UniProtKB/TrEMBL;Acc:G5EDC6])

HSP 1 Score: 313.538 bits (802), Expect = 3.078e-98
Identity = 143/185 (77.30%), Postives = 169/185 (91.35%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   + L+W++SLFWKEEMELTLVGLQ SGKTTFV+VI+SGQFTEDMIPTVGFNM+KITKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI++MVD+AD +K+EA+RNEL  LLDKPQL AIPVLVLGNK+DLP AL E +LIE++NL+ I +REICCYSISCKE+ENIDITLQWL+ +SK+QR
Sbjct:    1 MLAMVNKVLDWIRSLFWKEEMELTLVGLQNSGKTTFVNVIASGQFTEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVNAIVFMVDAADEEKLEASRNELMQLLDKPQLDAIPVLVLGNKKDLPGALDERQLIERMNLSSIQNREICCYSISCKEKENIDITLQWLIDHSKAQR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Celegans
Match: larp-1 (La-related protein 1 [Source:UniProtKB/Swiss-Prot;Acc:D5MCN2])

HSP 1 Score: 182.956 bits (463), Expect = 6.321e-47
Identity = 88/155 (56.77%), Postives = 113/155 (72.90%), Query Frame = 3
Query: 2616 ANHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSK--RQIEIDKELAKHLENYKTVDDFR 3074
            ANHPS  LLQ + F  + Y+ ++  C+K R+  G   + EMNTLYRFWSFFLR+NFN+NMY++FRK+A+EDA  G+RYGIE LFRF+SYGLEKKFR E++K+F +D   DV  G  YGLEK +AFL  SK  +Q+ +D  L K L  YK+ DDFR
Sbjct:  657 ANHPSISLLQEDRFVQNVYSTWRQACLKQRKSLGYDCA-EMNTLYRFWSFFLRDNFNRNMYEEFRKLALEDAEIGSRYGIEALFRFYSYGLEKKFRPEIYKNFMKDVTTDVQKGELYGLEKLFAFLQRSKIAKQLVVDDYLTKELNKYKSTDDFR 810          

HSP 2 Score: 69.3218 bits (168), Expect = 2.211e-11
Identity = 37/90 (41.11%), Postives = 58/90 (64.44%), Query Frame = 3
Query: 1056 DETLDAQIVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMSRIGQALVTSNRLEVRQSP-APAVRNKDSPSRWVL 1322
            D+TL   + KQ+EYYFS+ENL +D +LR++M  EG++ + LI  F R+ +LT D S I +AL  S ++++  SP    +R   +P+ W L
Sbjct:  303 DDTLKEYVRKQIEYYFSEENLQKDFFLRRKMGPEGYLPVALIASFPRVRSLTEDYSLILEALKDSTKVDM--SPDGLQIRAPVNPTIWPL 390          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Celegans
Match: larp-1 (La-related protein 1 [Source:UniProtKB/Swiss-Prot;Acc:D5MCN2])

HSP 1 Score: 184.111 bits (466), Expect = 1.259e-46
Identity = 88/155 (56.77%), Postives = 113/155 (72.90%), Query Frame = 3
Query: 2616 ANHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSK--RQIEIDKELAKHLENYKTVDDFR 3074
            ANHPS  LLQ + F  + Y+ ++  C+K R+  G   + EMNTLYRFWSFFLR+NFN+NMY++FRK+A+EDA  G+RYGIE LFRF+SYGLEKKFR E++K+F +D   DV  G  YGLEK +AFL  SK  +Q+ +D  L K L  YK+ DDFR
Sbjct:  989 ANHPSISLLQEDRFVQNVYSTWRQACLKQRKSLGYDCA-EMNTLYRFWSFFLRDNFNRNMYEEFRKLALEDAEIGSRYGIEALFRFYSYGLEKKFRPEIYKNFMKDVTTDVQKGELYGLEKLFAFLQRSKIAKQLVVDDYLTKELNKYKSTDDFR 1142          

HSP 2 Score: 69.707 bits (169), Expect = 1.633e-11
Identity = 31/70 (44.29%), Postives = 49/70 (70.00%), Query Frame = 3
Query: 1056 DETLDAQIVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMSRIGQALVTSNRLEV 1265
            D+TL   + KQ+EYYFS+ENL +D +LR++M  EG++ + LI  F R+ +LT D S I +AL  S ++++
Sbjct:  576 DDTLKEYVRKQIEYYFSEENLQKDFFLRRKMGPEGYLPVALIASFPRVRSLTEDYSLILEALKDSTKVDM 645          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Celegans
Match: larp-1 (La-related protein 1 [Source:UniProtKB/Swiss-Prot;Acc:D5MCN2])

HSP 1 Score: 184.111 bits (466), Expect = 1.259e-46
Identity = 88/155 (56.77%), Postives = 113/155 (72.90%), Query Frame = 3
Query: 2616 ANHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSK--RQIEIDKELAKHLENYKTVDDFR 3074
            ANHPS  LLQ + F  + Y+ ++  C+K R+  G   + EMNTLYRFWSFFLR+NFN+NMY++FRK+A+EDA  G+RYGIE LFRF+SYGLEKKFR E++K+F +D   DV  G  YGLEK +AFL  SK  +Q+ +D  L K L  YK+ DDFR
Sbjct:  989 ANHPSISLLQEDRFVQNVYSTWRQACLKQRKSLGYDCA-EMNTLYRFWSFFLRDNFNRNMYEEFRKLALEDAEIGSRYGIEALFRFYSYGLEKKFRPEIYKNFMKDVTTDVQKGELYGLEKLFAFLQRSKIAKQLVVDDYLTKELNKYKSTDDFR 1142          

HSP 2 Score: 69.707 bits (169), Expect = 1.633e-11
Identity = 31/70 (44.29%), Postives = 49/70 (70.00%), Query Frame = 3
Query: 1056 DETLDAQIVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMSRIGQALVTSNRLEV 1265
            D+TL   + KQ+EYYFS+ENL +D +LR++M  EG++ + LI  F R+ +LT D S I +AL  S ++++
Sbjct:  576 DDTLKEYVRKQIEYYFSEENLQKDFFLRRKMGPEGYLPVALIASFPRVRSLTEDYSLILEALKDSTKVDM 645          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Celegans
Match: arf-6 (ADP-Ribosylation Factor related [Source:UniProtKB/TrEMBL;Acc:Q9U2S4])

HSP 1 Score: 130.954 bits (328), Expect = 1.619e-34
Identity = 61/172 (35.47%), Postives = 104/172 (60.47%), Query Frame = 3
Query: 3813 WLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSK 4328
            +L  +F K+E+ + ++GL  +GKTT ++ +  GQ +   IPTVGFN++ +T  N+   +WD+GGQ + R +W  Y  G  A+I+++D+AD D+++ AR ELH +++  ++    +LV  NK+DL +A+  HE+ +KL L +I DR            + +   L WL +N K
Sbjct:    4 FLSKIFGKKELRILMLGLDAAGKTTILYKLKLGQ-SVTTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYYTGTQALIFVMDAADRDRVDEARMELHRIINDREMKEAIILVFANKQDLADAMKPHEIQDKLGLTRIRDRNWYVQPSCASTGDGLHEGLTWLSQNCK 174          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Fly
Match: Arl8 (gene:FBgn0037551 transcript:FBtr0081794)

HSP 1 Score: 321.627 bits (823), Expect = 6.737e-101
Identity = 147/184 (79.89%), Postives = 168/184 (91.30%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQ 4334
            M +   R L W KS+FWKEEMELTLVGLQFSGKTTFV+VI+SGQF EDMIPTVGFNM+KIT+GNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD DK+EA+RNELH+LLDKPQLA IPVLVLGNKRDLP AL E  LIE++NL+ I DREICCYSISCKE++NIDITLQWL+++SKSQ
Sbjct:    1 MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQ 184          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Fly
Match: Arl8 (gene:FBgn0037551 transcript:FBtr0339723)

HSP 1 Score: 321.627 bits (823), Expect = 6.737e-101
Identity = 147/184 (79.89%), Postives = 168/184 (91.30%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQ 4334
            M +   R L W KS+FWKEEMELTLVGLQFSGKTTFV+VI+SGQF EDMIPTVGFNM+KIT+GNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD DK+EA+RNELH+LLDKPQLA IPVLVLGNKRDLP AL E  LIE++NL+ I DREICCYSISCKE++NIDITLQWL+++SKSQ
Sbjct:    1 MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQ 184          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Fly
Match: Arl8 (gene:FBgn0037551 transcript:FBtr0339724)

HSP 1 Score: 321.627 bits (823), Expect = 6.737e-101
Identity = 147/184 (79.89%), Postives = 168/184 (91.30%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQ 4334
            M +   R L W KS+FWKEEMELTLVGLQFSGKTTFV+VI+SGQF EDMIPTVGFNM+KIT+GNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD DK+EA+RNELH+LLDKPQLA IPVLVLGNKRDLP AL E  LIE++NL+ I DREICCYSISCKE++NIDITLQWL+++SKSQ
Sbjct:    1 MLALINRILEWFKSIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKPQLAGIPVLVLGNKRDLPGALDETGLIERMNLSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQ 184          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Fly
Match: larp (gene:FBgn0261618 transcript:FBtr0089680)

HSP 1 Score: 203.756 bits (517), Expect = 4.791e-53
Identity = 95/165 (57.58%), Postives = 122/165 (73.94%), Query Frame = 3
Query: 2595 SKTPNSFA--NHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSK--RQIEIDKELAKHLENYKTVDDFRA 3077
            S  P S     HPS  LL+ N FT  AY+K+ S C+K+R   G G SQEMNTLYRFWSFFLRENFNK+MY +FR +A+EDA  G RYG+ECLFRFFSYGLEKKFR  +++DFQ++T+ D   G  YGLEKFWAFL Y K   ++E+  +LA++L+++K ++DFR 
Sbjct:  612 SSVPQSLPVFQHPSHALLKENNFTQQAYHKYHSRCLKERRRLGYGQSQEMNTLYRFWSFFLRENFNKSMYNEFRSLALEDAGNGFRYGLECLFRFFSYGLEKKFRPNIYQDFQDETIADYETGQLYGLEKFWAFLKYYKNGEKLEVQPKLAEYLKSFKNIEDFRV 776          

HSP 2 Score: 74.7146 bits (182), Expect = 6.202e-13
Identity = 37/85 (43.53%), Postives = 56/85 (65.88%), Query Frame = 3
Query: 1077 IVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMSRIGQALVTSNRLEVRQSPAPAVRNKDSPSRWVLQSI 1331
            I KQVEYYFS +NL  D +LR++MD EG++ + LI  F R+ ALTTD++ I  A+  S++LE+ +     VR K +P+ W +  +
Sbjct:   25 IKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELFE--GYKVRTKTTPTTWPITEV 107          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Fly
Match: larp (gene:FBgn0261618 transcript:FBtr0301181)

HSP 1 Score: 203.756 bits (517), Expect = 4.791e-53
Identity = 95/165 (57.58%), Postives = 122/165 (73.94%), Query Frame = 3
Query: 2595 SKTPNSFA--NHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSK--RQIEIDKELAKHLENYKTVDDFRA 3077
            S  P S     HPS  LL+ N FT  AY+K+ S C+K+R   G G SQEMNTLYRFWSFFLRENFNK+MY +FR +A+EDA  G RYG+ECLFRFFSYGLEKKFR  +++DFQ++T+ D   G  YGLEKFWAFL Y K   ++E+  +LA++L+++K ++DFR 
Sbjct:  612 SSVPQSLPVFQHPSHALLKENNFTQQAYHKYHSRCLKERRRLGYGQSQEMNTLYRFWSFFLRENFNKSMYNEFRSLALEDAGNGFRYGLECLFRFFSYGLEKKFRPNIYQDFQDETIADYETGQLYGLEKFWAFLKYYKNGEKLEVQPKLAEYLKSFKNIEDFRV 776          

HSP 2 Score: 74.7146 bits (182), Expect = 6.202e-13
Identity = 37/85 (43.53%), Postives = 56/85 (65.88%), Query Frame = 3
Query: 1077 IVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMSRIGQALVTSNRLEVRQSPAPAVRNKDSPSRWVLQSI 1331
            I KQVEYYFS +NL  D +LR++MD EG++ + LI  F R+ ALTTD++ I  A+  S++LE+ +     VR K +P+ W +  +
Sbjct:   25 IKKQVEYYFSVDNLTGDFFLRRKMDPEGYIPVTLIASFHRVLALTTDVAVIVNAIKESDKLELFE--GYKVRTKTTPTTWPITEV 107          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Zebrafish
Match: arl8bb (ADP-ribosylation factor-like 8Bb [Source:ZFIN;Acc:ZDB-GENE-080516-10])

HSP 1 Score: 327.791 bits (839), Expect = 5.767e-103
Identity = 149/185 (80.54%), Postives = 172/185 (92.97%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M S F R L+W++SLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD +K+EA+RNELHNLLDKPQL  IPVLVLGNKRDL +AL E +LIEKLNL+ I DREICCYSISCKEQ+NIDITLQWL+++SKS+R
Sbjct:    1 MLSLFHRLLDWIRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADREKVEASRNELHNLLDKPQLQGIPVLVLGNKRDLASALDEKQLIEKLNLSAIQDREICCYSISCKEQDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Zebrafish
Match: arl8ba (ADP-ribosylation factor-like 8Ba [Source:NCBI gene;Acc:337424])

HSP 1 Score: 327.02 bits (837), Expect = 1.043e-102
Identity = 148/185 (80.00%), Postives = 171/185 (92.43%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   R L+W KSLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD +K+EA+RNELHNLLDKPQL  IPVLVLGNKRDLPNAL E +LIEK+NL  I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MLALINRLLDWFKSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADREKVEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLAAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Zebrafish
Match: arl8a (ADP-ribosylation factor-like 8A [Source:ZFIN;Acc:ZDB-GENE-030131-5025])

HSP 1 Score: 320.472 bits (820), Expect = 1.749e-100
Identity = 144/185 (77.84%), Postives = 172/185 (92.97%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M + F + L+W K+LFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+KITKGNV+IK+WDIGGQPRFRSMWERYCRGV+AI+YMVD+AD +KIEA++NELHNLLDKPQL  IPVLVLGNKRDLP AL E ELIE++NL+ I DREICCYSISCKE++NIDITLQWL+++S+++R
Sbjct:    1 MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADPEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIERMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSRTRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Zebrafish
Match: larp1b (La ribonucleoprotein 1B [Source:ZFIN;Acc:ZDB-GENE-030131-4154])

HSP 1 Score: 206.838 bits (525), Expect = 1.580e-56
Identity = 127/303 (41.91%), Postives = 172/303 (56.77%), Query Frame = 3
Query: 2208 LPYCPFIPVSTLSGCQPNFPGIGYGLPGVYPVYPFVPAPQPLMPTNTNKDDKPSETEQVRKVSRHMVGFYPA-GEDSGRLFRSHGSKNRLRAISSSECGGFNEVHVGFAFDXXXXXXXXXXXXXXXXEPDSK----------TPNSFAN--HPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSK-RQIEIDKELAKHLENYKTVDDFR 3074
            LP  P   V     CQ +   + + LP   P    VP       T   +D  P++T +          FYP   EDSG L      K + R  S+       E HVG+  D+R      S   SS++ P             TP S     HPS  LL+ NGFT   Y+K++  C+ +R+  G G SQEMNTL+RFWSFFLR+NFN+ MY++FR+ A+ED+ E  RYG+ECLFRF+SYGLE++FR ++FKDFQE+T++D   G  YGLEKFWAFL YSK +  +ID +L ++L  +K++DDFR
Sbjct:  116 LPIDPNQEVPPPPPCQTDDSSMAHSLPADVPESSSVPRTPRTPRTPGRQD--PTKTPR----------FYPVIKEDSGNLDGKTPRKRKTRHSSNPPL----ECHVGWVMDSREHRPRTSSISSSNASPSEGAPALSGSYGCTPQSLPKFWHPSHELLRENGFTQQVYHKYRRRCLNERKRLGVGQSQEMNTLFRFWSFFLRDNFNRKMYEEFRQFAVEDSKENYRYGLECLFRFYSYGLERRFRPDIFKDFQEETVQDYEKGQLYGLEKFWAFLKYSKVKNQDIDPKLKEYLSKFKSIDDFR 402          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Zebrafish
Match: AL928908.4 (pep chromosome:GRCz11:CHR_ALT_CTG17_1_22:26792344:26800858:1 gene:ENSDARG00000113142.1 transcript:ENSDART00000193866.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928908.4)

HSP 1 Score: 195.667 bits (496), Expect = 1.899e-56
Identity = 91/162 (56.17%), Postives = 123/162 (75.93%), Query Frame = 3
Query: 2601 TPNSFAN--HPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSK-RQIEIDKELAKHLENYKTVDDFRA 3077
            TP S     HPS  LL+ NGFT   Y+K++  C+ +R+  G G SQEMNTL+RFWSFFLR+NFN+ MY++FR+ A+ED+ E  RYG+ECLFRF+SYGLE++FR ++FKDFQE+T++D   G  YGLEKFWAFL YSK +  +ID +L ++L  +K++DDFR 
Sbjct:   34 TPQSLPKFWHPSHELLRENGFTQQVYHKYRRRCLNERKRLGVGQSQEMNTLFRFWSFFLRDNFNRKMYEEFRQFAVEDSKENYRYGLECLFRFYSYGLERRFRPDIFKDFQEETVQDYEKGQLYGLEKFWAFLKYSKVKNQDIDPKLKEYLSKFKSIDDFRV 195          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Xenopus
Match: arl10b (ADP-ribosylation factor-like 10B [Source:NCBI gene;Acc:548865])

HSP 1 Score: 321.627 bits (823), Expect = 1.121e-100
Identity = 146/184 (79.35%), Postives = 170/184 (92.39%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQ 4334
            M +   + L+W KSLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQFTEDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNA++YMVD+AD DK+EA++ ELHNLLDKPQL  IPVLVLGNKRDLPNAL E +LIEKLNL+ I DREICCYSISCKE++NIDITLQWL+++SKS+
Sbjct:    1 MLALINKLLDWFKSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFTEDMIPTVGFNMRKVTKGNVTIKVWDIGGQPRFRSMWERYCRGVNAVVYMVDAADLDKVEASKYELHNLLDKPQLHGIPVLVLGNKRDLPNALDEKQLIEKLNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSR 184          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Xenopus
Match: arl8a (ADP ribosylation factor like GTPase 8A [Source:NCBI gene;Acc:394587])

HSP 1 Score: 321.242 bits (822), Expect = 1.568e-100
Identity = 145/185 (78.38%), Postives = 170/185 (91.89%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M + F + L+W K+LFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF EDMIPTVGFNM+KITKGNV+IK+WDIGGQPRFRSMWERYCRGV+AI+YMVD+AD DKIEA++NELHNLLDK QL  IPVLVLGNKRD+P AL E ELIE++NL+ I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MLALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQDKIEASKNELHNLLDKAQLQGIPVLVLGNKRDIPGALDEKELIERMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Xenopus
Match: arl8b (ADP ribosylation factor like GTPase 8B [Source:NCBI gene;Acc:100492504])

HSP 1 Score: 320.087 bits (819), Expect = 3.769e-100
Identity = 147/185 (79.46%), Postives = 169/185 (91.35%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M S   R L+W +SLFWKEEMELTLVGLQ SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD +KIEA+RNELHNLLDKPQL  IPVLVLGNKRDL  AL E +LIEK+NL+ I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MLSLLSRLLDWFRSLFWKEEMELTLVGLQHSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLHTALDEKQLIEKMNLSLIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Xenopus
Match: arl10b (ADP-ribosylation factor-like 10B [Source:NCBI gene;Acc:548865])

HSP 1 Score: 303.523 bits (776), Expect = 6.354e-94
Identity = 141/188 (75.00%), Postives = 164/188 (87.23%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITL----QWLMKNSKSQ 4334
            M +   + L+W KSLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQFTEDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNA++YMVD+AD DK+EA++ ELHNLLDKPQL  IPVLVLGNKRDLPNAL E +LIEKLNL+ I DREICCYSISCKE++NI   L     W +++SK Q
Sbjct:    1 MLALINKLLDWFKSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFTEDMIPTVGFNMRKVTKGNVTIKVWDIGGQPRFRSMWERYCRGVNAVVYMVDAADLDKVEASKYELHNLLDKPQLHGIPVLVLGNKRDLPNALDEKQLIEKLNLSAIQDREICCYSISCKEKDNIGNLLLLLWYWTVQDSKKQ 188          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Xenopus
Match: larp1 (La ribonucleoprotein domain family member 1 [Source:NCBI gene;Acc:100216225])

HSP 1 Score: 208.379 bits (529), Expect = 3.414e-54
Identity = 107/230 (46.52%), Postives = 149/230 (64.78%), Query Frame = 3
Query: 2412 FYPAGEDSGRLFRSHGSKNRLRAISSSECGGFNEVHVGFAFDXXXXXXXXXXXXXXXXEPDSK----TPNSFA--NHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSK-RQIEIDKELAKHLENYKTVDDFRAN 3080
            FYP  ++ GR   +   + R    SS+      E HVG+  D+R      +    S   P       TP S     HPS  LL+ NGFT H Y+K++  C+ +R+  G G SQEMNTL+RFWSFFLR++FNK MY++FR++A+ED+ EG RYG+ECLFR++SYGLEKKFR ++F+DFQE+T +D   G  YGLEKFWAFL YSK + ++ID  L ++L  ++ ++DFR +
Sbjct:  671 FYPVVKE-GRTIDAKTPRKRKTRHSSNPP---MECHVGWVMDSREHRPRTASVSPSEVAPALSNYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAVEDSKEGYRYGLECLFRYYSYGLEKKFRVDIFRDFQEETRRDYETGQLYGLEKFWAFLKYSKAKNLDIDPILQEYLSKFRRLEDFRVD 896          

HSP 2 Score: 77.7962 bits (190), Expect = 1.239e-13
Identity = 45/112 (40.18%), Postives = 63/112 (56.25%), Query Frame = 3
Query: 1059 ETLDAQIVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMSRIGQALVTSNRLEVRQSPAPAVRNKDSPSRWVLQSINLNP----------DAPEFVP 1364
            E L   I +Q+EYYFS +NL RD +LR++MD EG++ + LI  F R+ ALTTD+  I +AL  S  +E+       +R KD P  W L   +L+           + PEFVP
Sbjct:  275 ELLKDYIKRQIEYYFSVDNLQRDFFLRRKMDSEGFLPVGLIASFHRVQALTTDIELIVKALKDSKVVEIIDE---KIRRKDQPDMWPLPGPSLSDASQTDFNQLINCPEFVP 383          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Mouse
Match: Arl8b (ADP-ribosylation factor-like 8B [Source:MGI Symbol;Acc:MGI:1914416])

HSP 1 Score: 326.635 bits (836), Expect = 1.332e-102
Identity = 147/185 (79.46%), Postives = 172/185 (92.97%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   R L+W +SLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YM+D+AD +KIEA+RNELHNLLDKPQL  IPVLVLGNKRDLPNAL E +LIEK+NL+ I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Mouse
Match: Arl8a (ADP-ribosylation factor-like 8A [Source:MGI Symbol;Acc:MGI:1915974])

HSP 1 Score: 321.242 bits (822), Expect = 1.248e-100
Identity = 146/185 (78.92%), Postives = 170/185 (91.89%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M + F + L+W K+LFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF EDMIPTVGFNM+KITKGNV+IK+WDIGGQPRFRSMWERYCRGV+AI+YMVD+AD +KIEA++NELHNLLDKPQL  IPVLVLGNKRDL  AL E ELIEK+NL+ I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLAGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Mouse
Match: Arl8a (ADP-ribosylation factor-like 8A [Source:MGI Symbol;Acc:MGI:1915974])

HSP 1 Score: 256.529 bits (654), Expect = 3.186e-78
Identity = 118/147 (80.27%), Postives = 135/147 (91.84%), Query Frame = 3
Query: 3897 VISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            V  SGQF EDMIPTVGFNM+KITKGNV+IK+WDIGGQPRFRSMWERYCRGV+AI+YMVD+AD +KIEA++NELHNLLDKPQL  IPVLVLGNKRDL  AL E ELIEK+NL+ I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:   18 VARSGQFNEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLAGALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 164          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Mouse
Match: Arl8b (ADP-ribosylation factor-like 8B [Source:MGI Symbol;Acc:MGI:1914416])

HSP 1 Score: 248.825 bits (634), Expect = 7.206e-76
Identity = 112/137 (81.75%), Postives = 130/137 (94.89%), Query Frame = 3
Query: 3927 MIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            MIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YM+D+AD +KIEA+RNELHNLLDKPQL  IPVLVLGNKRDLPNAL E +LIEK+NL+ I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 137          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Mouse
Match: Larp1 (La ribonucleoprotein domain family, member 1 [Source:MGI Symbol;Acc:MGI:1890165])

HSP 1 Score: 211.846 bits (538), Expect = 4.396e-55
Identity = 110/232 (47.41%), Postives = 151/232 (65.09%), Query Frame = 3
Query: 2412 FYPAGEDSGRLFRSHGSKNRLRAISSSECGGFNEVHVGFAFDXXXXXXXXXXXXXXXXEPDSK------TPNSFA--NHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSK-RQIEIDKELAKHLENYKTVDDFRAN 3080
            FYP  ++   L      K + R  S+       E HVG+  D+R      +   SS SE          TP S     HPS  LL+ NGFT H Y+K++  C+ +R+  G G SQEMNTL+RFWSFFLR++FNK MY++F+++A+EDA EG RYG+ECLFR++SYGLEKKFR ++FKDFQE+T+KD   G  YGLEKFWAFL YSK + ++ID +L ++L  ++ ++DFR +
Sbjct:  777 FYPVVKEGRTLDAKMPRKRKTRHSSNPPL----ESHVGWVMDSREHRPRTASISSSPSEGTPAVGSYGCTPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFKQLALEDAKEGYRYGLECLFRYYSYGLEKKFRLDIFKDFQEETVKDYEAGQLYGLEKFWAFLKYSKAKNLDIDPKLQEYLGKFRRLEDFRVD 1004          

HSP 2 Score: 74.7146 bits (182), Expect = 9.314e-13
Identity = 38/88 (43.18%), Postives = 56/88 (63.64%), Query Frame = 3
Query: 1059 ETLDAQIVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMSRIGQALVTSNRLEVRQSPAPAVRNKDSPSRWVL 1322
            E L   I +Q+EYYFS +NL RD +LR++MD +G++ + LI  F R+ ALTTD+S I  AL  S  +E+ +     VR ++ P +W L
Sbjct:  376 ELLKDYIKRQIEYYFSVDNLERDFFLRRKMDADGFLPITLIASFHRVQALTTDISLIFAALKDSKVVEMVEE---KVRRREEPEKWPL 460          
BLAST of ADP-ribosylation factor-like protein 8B vs. UniProt/SwissProt
Match: sp|Q6NZW8|AR8BA_DANRE (ADP-ribosylation factor-like protein 8B-A OS=Danio rerio OX=7955 GN=arl8ba PE=2 SV=1)

HSP 1 Score: 327.02 bits (837), Expect = 7.876e-102
Identity = 148/185 (80.00%), Postives = 171/185 (92.43%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   R L+W KSLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD +K+EA+RNELHNLLDKPQL  IPVLVLGNKRDLPNAL E +LIEK+NL  I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MLALINRLLDWFKSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADREKVEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLAAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. UniProt/SwissProt
Match: sp|Q66HA6|ARL8B_RAT (ADP-ribosylation factor-like protein 8B OS=Rattus norvegicus OX=10116 GN=Arl8b PE=2 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 9.317e-102
Identity = 147/185 (79.46%), Postives = 172/185 (92.97%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   R L+W +SLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YM+D+AD +KIEA+RNELHNLLDKPQL  IPVLVLGNKRDLPNAL E +LIEK+NL+ I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. UniProt/SwissProt
Match: sp|Q9CQW2|ARL8B_MOUSE (ADP-ribosylation factor-like protein 8B OS=Mus musculus OX=10090 GN=Arl8b PE=1 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 9.317e-102
Identity = 147/185 (79.46%), Postives = 172/185 (92.97%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   R L+W +SLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YM+D+AD +KIEA+RNELHNLLDKPQL  IPVLVLGNKRDLPNAL E +LIEK+NL+ I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. UniProt/SwissProt
Match: sp|Q9NVJ2|ARL8B_HUMAN (ADP-ribosylation factor-like protein 8B OS=Homo sapiens OX=9606 GN=ARL8B PE=1 SV=1)

HSP 1 Score: 326.635 bits (836), Expect = 9.317e-102
Identity = 147/185 (79.46%), Postives = 172/185 (92.97%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   R L+W +SLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YM+D+AD +KIEA+RNELHNLLDKPQL  IPVLVLGNKRDLPNAL E +LIEK+NL+ I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. UniProt/SwissProt
Match: sp|Q4R4S4|ARL8B_MACFA (ADP-ribosylation factor-like protein 8B OS=Macaca fascicularis OX=9541 GN=ARL8B PE=2 SV=1)

HSP 1 Score: 325.865 bits (834), Expect = 2.074e-101
Identity = 146/185 (78.92%), Postives = 171/185 (92.43%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   R L+W +SLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPR+RSMWERYCRGVNAI+YM+D+AD +KIEA+RNELHNLLDKPQL  IPVLVLGNKRDLPNAL E +LIEK+NL+ I DREICCYSISCKE++NIDITLQWL++ SKS+R
Sbjct:    1 MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRYRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQYSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. TrEMBL
Match: Q86F33 (Putative ADP-ribosylation factor-like 10C OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 342.428 bits (877), Expect = 6.408e-105
Identity = 156/185 (84.32%), Postives = 174/185 (94.05%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +FF+R L+W++SLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF EDMIPTVGFN++K+TKGNV+IKMWDIGGQPRFRSMWERYCRGVNAIIYMVD+ADHDK+EA+RNELH LLDKPQL  IPVLVLGNK+DLPNALAEHELI  LNL  ITDREICCYSISCKEQENIDITLQWL+K+SKS R
Sbjct:    1 MLAFFQRILDWIRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFVEDMIPTVGFNLRKVTKGNVTIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDAADHDKLEASRNELHGLLDKPQLLGIPVLVLGNKKDLPNALAEHELIAALNLGAITDREICCYSISCKEQENIDITLQWLIKHSKSNR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. TrEMBL
Match: A0A4S2LNC0 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007510 PE=3 SV=1)

HSP 1 Score: 340.502 bits (872), Expect = 2.737e-104
Identity = 154/185 (83.24%), Postives = 175/185 (94.59%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +FF+R L+W++SLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF EDMIPTVGFN++K+TKGNV+IKMWDIGGQPRFRSMWERYCRGVNAIIYMVD+ADHDK+EA+RNELH+LLDKPQL  IPVLVLGNK+DLPNALAEHELI  LNL  ITDRE+CCYSISCKEQENIDITLQWL+K+S+S R
Sbjct:    1 MLAFFQRILDWIRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFIEDMIPTVGFNLRKVTKGNVTIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDAADHDKLEASRNELHSLLDKPQLLGIPVLVLGNKKDLPNALAEHELISALNLGAITDREVCCYSISCKEQENIDITLQWLIKHSRSGR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. TrEMBL
Match: A0A183PNW2 (Uncharacterized protein OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS16048 PE=3 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 1.958e-103
Identity = 154/185 (83.24%), Postives = 174/185 (94.05%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +FF+R L+W++SLFWKEEMELTLVGLQ+SGKTTFV+VI+SG+F EDMIPTVGFN++K+TKGNV+IKMWDIGGQPRFRSMWERYCRGVNAIIYMVD+ADH+K+EA+RNELH LLDKPQL  IPVLVLGNK+DLPNALAEHELI  LNL  ITDREICCYSISCKEQENIDITLQWL+K+SKS R
Sbjct:    1 MLAFFQRILDWIRSLFWKEEMELTLVGLQYSGKTTFVNVIASGKFDEDMIPTVGFNLRKVTKGNVTIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDAADHEKLEASRNELHGLLDKPQLLGIPVLVLGNKKDLPNALAEHELITALNLGAITDREICCYSISCKEQENIDITLQWLIKHSKSNR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. TrEMBL
Match: G4VC98 (ADP-ribosylation factor-like 10, arl10 OS=Schistosoma mansoni OX=6183 GN=Smp_166930 PE=3 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 2.771e-103
Identity = 154/185 (83.24%), Postives = 174/185 (94.05%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +FF+R L+W++SLFWKEEMELTLVGLQ+SGKTTFV+VI+SG+F EDMIPTVGFN++K+TKGNV+IKMWDIGGQPRFRSMWERYCRGVNAIIYMVD+ADH+K+EA+RNELH LLDKPQL  IPVLVLGNK+DLPNALAEHELI  LNL  ITDREICCYSISCKEQENIDITLQWL+K+SKS R
Sbjct:    1 MLAFFQRILDWIRSLFWKEEMELTLVGLQYSGKTTFVNVIASGKFDEDMIPTVGFNLRKVTKGNVTIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDAADHEKLEASRNELHALLDKPQLLGIPVLVLGNKKDLPNALAEHELITALNLGAITDREICCYSISCKEQENIDITLQWLIKHSKSNR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. TrEMBL
Match: V4B0E7 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_186914 PE=3 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 2.317e-102
Identity = 154/183 (84.15%), Postives = 174/183 (95.08%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKS 4331
            MFSFF+R L+W KSLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+KITKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI++MVD+ADHDK++A+RNELHNLLDKPQL  IPVLVLGNKRDLP AL E ELIEKLNL+ I DREICCYSISCKE+ENIDITLQWL+++SKS
Sbjct:    1 MFSFFQRILDWFKSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVNAIVFMVDAADHDKLDASRNELHNLLDKPQLQGIPVLVLGNKRDLPGALDEKELIEKLNLSAIQDREICCYSISCKEKENIDITLQWLIQHSKS 183          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Cavefish
Match: arl8ba (ADP-ribosylation factor-like protein 8B-A [Source:NCBI gene;Acc:103036938])

HSP 1 Score: 327.791 bits (839), Expect = 3.932e-103
Identity = 148/185 (80.00%), Postives = 172/185 (92.97%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   RFL+W KSLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD DK+EA+RNELHNLLDKPQL  IPVLVLGNKRDLP+AL E +LIEK+NL  I DREICCYSISCKE++NIDITLQWL+++SK++R
Sbjct:    1 MLALINRFLDWFKSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADRDKVEASRNELHNLLDKPQLQGIPVLVLGNKRDLPSALDEKQLIEKMNLAAIQDREICCYSISCKEKDNIDITLQWLIQHSKTRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Cavefish
Match: arl8bb (ADP-ribosylation factor-like protein 8B-A [Source:NCBI gene;Acc:103032600])

HSP 1 Score: 323.168 bits (827), Expect = 1.944e-101
Identity = 145/185 (78.38%), Postives = 170/185 (91.89%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   R L+W ++LFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD DKIE +RNELHNLLDKPQL  IPVLVLGNKRDLP+AL E +LIEK+NL  I DREICCYS+SCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MLALINRLLDWFRALFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADRDKIEPSRNELHNLLDKPQLQGIPVLVLGNKRDLPDALDEKQLIEKMNLAAIQDREICCYSVSCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Cavefish
Match: arl8a (ADP-ribosylation factor-like protein 8A [Source:NCBI gene;Acc:103033874])

HSP 1 Score: 317.005 bits (811), Expect = 2.707e-99
Identity = 143/185 (77.30%), Postives = 171/185 (92.43%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M + F + L+W K+LFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+KITKGNV+IK+WDIGGQPRFRSMWERYCRGV+AI+YMVD+AD +KIEA++NELHNLLDKPQL  IPVLVLGNKRDL  AL E ELIE++NL+ I DREICCYSISCKE++NIDITLQWL+++S+++R
Sbjct:    1 MIALFNKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADPEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLQGALDEKELIERMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSRTRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Cavefish
Match: arl8ba (ADP-ribosylation factor-like protein 8B-A [Source:NCBI gene;Acc:103036938])

HSP 1 Score: 307.375 bits (786), Expect = 1.456e-95
Identity = 140/175 (80.00%), Postives = 159/175 (90.86%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQ 4307
            M +   RFL+W KSLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD DK+EA+RNELHNLLDKPQL  IPVLVLGNKRDLP+AL E +LIEK+NL  I DREICCYSISCKE++NI   LQ
Sbjct:    1 MLALINRFLDWFKSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADRDKVEASRNELHNLLDKPQLQGIPVLVLGNKRDLPSALDEKQLIEKMNLAAIQDREICCYSISCKEKDNIGKLLQ 175          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Cavefish
Match: larp1 (La ribonucleoprotein 1, translational regulator [Source:NCBI gene;Acc:103023110])

HSP 1 Score: 209.149 bits (531), Expect = 1.616e-54
Identity = 93/169 (55.03%), Postives = 127/169 (75.15%), Query Frame = 3
Query: 2601 TPNSFA--NHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSK-RQIEIDKELAKHLENYKTVDDFRANFEKPDG 3098
            TP S     HPS  LL+ NGFT H Y+K++  C+ +R+  G G SQEMNTL+RFWSFFLR++FN+ MY++FR++ +ED  EG RYG+ECLFR++SYGLE+KFR ++F+DFQE+T+KD   G  YGLEKFWAFL YSK + +EID +L ++L  +K ++DFR +    DG
Sbjct:  822 TPQSLPKFQHPSHELLKENGFTQHVYHKYRRRCLNERKRLGIGQSQEMNTLFRFWSFFLRDHFNRKMYEEFRQLVVEDGKEGYRYGLECLFRYYSYGLERKFRPDIFRDFQEETMKDYEAGQLYGLEKFWAFLKYSKAKTLEIDPKLQEYLSKFKRLEDFRVDPPMEDG 990          

HSP 2 Score: 75.485 bits (184), Expect = 4.637e-13
Identity = 42/112 (37.50%), Postives = 64/112 (57.14%), Query Frame = 3
Query: 1059 ETLDAQIVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMSRIGQALVTSNRLEVRQSPAPAVRNKDSPSRWVLQSINLNP----------DAPEFVP 1364
            + L   I +Q+EYYFS +NL RD +LR++MD EG++ + LI  F R+ ALTTD+S I +AL  S  +E+       +R K+ P +W L   ++            + PEF+P
Sbjct:  363 DLLKDYIKRQIEYYFSVDNLERDFFLRRKMDLEGFLPVALIASFHRVQALTTDVSLILEALKDSKEVEIIDM---KIRRKEEPEKWPLPGFSVPEHSQTDFSQLINCPEFIP 471          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Sea Lamprey
Match: arl8ba (ADP-ribosylation factor-like 8Ba [Source:NCBI gene;Acc:337424])

HSP 1 Score: 316.235 bits (809), Expect = 9.622e-100
Identity = 144/185 (77.84%), Postives = 170/185 (91.89%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   R L+W K+LFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF EDMIPTVGFNM+KI+KGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD DK+EA+RNEL+NLL+KPQL  IPVLVLGNK+DLPNAL E +LI+K+NL  I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MLALINRLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFNEDMIPTVGFNMRKISKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADPDKVEASRNELNNLLEKPQLHGIPVLVLGNKKDLPNALDEKQLIDKMNLCAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005549.1 (pep scaffold:Pmarinus_7.0:GL476953:2920:26208:1 gene:ENSPMAG00000005046.1 transcript:ENSPMAT00000005549.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 265.774 bits (678), Expect = 1.734e-82
Identity = 119/150 (79.33%), Postives = 140/150 (93.33%), Query Frame = 3
Query: 3888 FVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            F+ +  SGQ++EDMIPTVGFNM+KITKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+ADHDK+EA+RNELHNLL+KPQL  IPVLVLGNKRDL NAL E ELIEK+NL+ I DREICCYSISCKE++NIDITLQWL+++S+S+R
Sbjct:    1 FLFIFQSGQYSEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVNAIVYMVDAADHDKLEASRNELHNLLEKPQLQGIPVLVLGNKRDLANALDEKELIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSRSRR 150          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Sea Lamprey
Match: larp1b (La ribonucleoprotein 1B [Source:ZFIN;Acc:ZDB-GENE-030131-4154])

HSP 1 Score: 198.364 bits (503), Expect = 5.399e-52
Identity = 88/163 (53.99%), Postives = 123/163 (75.46%), Query Frame = 3
Query: 2601 TPNSFA--NHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYS-KRQIEIDKELAKHLENYKTVDDFRAN 3080
            TP S     HPS  +L+ NGFT   Y+K+   C+ +R+  G G SQEMNTL+RFWSFFLR++FN+ MY +F+++A+ED AEG RYG+ECLFRF+SYGLEK++R ++FKDFQE+T++D   G  YGLEKFWAFL YS ++  ++D +L +HL  +K ++DFR +
Sbjct:  736 TPQSLPKFQHPSHQMLKENGFTQQVYHKYHRKCLSERKRLGVGQSQEMNTLFRFWSFFLRDHFNRRMYDEFKRLALEDGAEGYRYGLECLFRFYSYGLEKRYRLDIFKDFQEETIRDYEAGELYGLEKFWAFLKYSHQKNADLDPKLQEHLSKFKRLEDFRVD 898          

HSP 2 Score: 78.5666 bits (192), Expect = 1.060e-14
Identity = 52/132 (39.39%), Postives = 70/132 (53.03%), Query Frame = 3
Query: 1035 HG-NVFFPDETLDAQIVK-QVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMSRIGQALVTSNRLEVRQSPAPAVRNKDSPSRWVLQSINL--NP------------------DAPEFVP 1364
            HG  ++  +ETL  + VK Q+EYYFS ENL RD +LR++MD EG++ + LI  F R+  LTTD   I +AL  S  +EV       VR +D P RW +  + L  +P                  D PEFVP
Sbjct:  231 HGPQIYTVEETLLKEYVKRQIEYYFSVENLERDFFLRRKMDQEGFLPVSLIAGFHRVQTLTTDEHLIMEALHDSTEVEVVNM---KVRRRDDPLRWPIPGMALLSSPTGSVTPSAPISTDFTRLLDCPEFVP 359          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011118.1 (pep scaffold:Pmarinus_7.0:GL482736:15659:16189:-1 gene:ENSPMAG00000010091.1 transcript:ENSPMAT00000011118.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 131.339 bits (329), Expect = 3.686e-35
Identity = 63/173 (36.42%), Postives = 100/173 (57.80%), Query Frame = 3
Query: 3813 WLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKS 4331
            +L  +F  +EM + ++GL  +GKTT ++ +  GQ     IPTVGFN++ +T  NV   +WD+GGQ + R +W  Y  G   +I++VD AD D+++ AR ELH +++  ++    +LV  NK+DL +A+  HE+ EKL L ++ DR            + +   L WL  N KS
Sbjct:    5 FLSKMFGNKEMRILMLGLDAAGKTTILYKLKLGQPVT-TIPTVGFNVETVTYKNVRFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRVDEARQELHRIINDREMRDAIILVFANKQDLTDAMRPHEVQEKLGLTRVRDRNWYVQPACASTGDGLYEGLTWLTSNYKS 176          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Sea Lamprey
Match: arf2a (ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GENE-040122-4])

HSP 1 Score: 121.324 bits (303), Expect = 1.417e-31
Identity = 62/178 (34.83%), Postives = 102/178 (57.30%), Query Frame = 3
Query: 3804 FLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            F N  K LF K+EM + +VGL  +GKTT ++ +  G+     IPT+GFN++ +   N+S  +WD+GGQ + R +W  Y +    +I++VDS D +++  AR EL  +L + +L    +LV  NK+DLPNA+   E+ +KL L+ +  R     + +    + +   L WL    K+Q+
Sbjct:    5 FANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVT-TIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQA-TPPVGDGLYEGLDWLSNQLKNQK 180          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Yeast
Match: ARF2 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated formation vesicles in intracellular trafficking within the Golgi; ARF2 has a paralog, ARF1, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002296])

HSP 1 Score: 125.946 bits (315), Expect = 1.863e-33
Identity = 63/173 (36.42%), Postives = 99/173 (57.23%), Query Frame = 3
Query: 3816 LKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQ 4334
              +LF  +EM + +VGL  +GKTT ++ +  G+     IPT+GFN++ +   N+S  +WD+GGQ R RS+W  Y R    +I+++DS D  +I  AR  +  +L++ +L     LV  NK+DLP A++  E+ EKL L+ I +R     S      E +   L+WL  N K+Q
Sbjct:    9 FSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVI-TTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVIDSNDRSRIGEAREVMQRMLNEDELRNAVWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQSTCATSGEGLYEGLEWLSNNLKNQ 180          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Yeast
Match: ARF1 (ADP-ribosylation factor; GTPase of the Ras superfamily involved in regulation of coated vesicle formation in intracellular trafficking within the Golgi; ARF1 has a paralog, ARF2, that arose from the whole genome duplication; arf1 arf2 double null mutation is complemented by human ARF1, ARF4, ARF5, or ARF6 [Source:SGD;Acc:S000002351])

HSP 1 Score: 123.25 bits (308), Expect = 2.146e-32
Identity = 63/173 (36.42%), Postives = 99/173 (57.23%), Query Frame = 3
Query: 3816 LKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWL---MKNS 4325
              +LF  +EM + +VGL  +GKTT ++ +  G+     IPT+GFN++ +   N+S  +WD+GGQ R RS+W  Y R    +I++VDS D  +I  AR  +  +L++ +L     LV  NK+DLP A++  E+ EKL L+ I +R     +      E +   L+WL   +KNS
Sbjct:    9 FSNLFGNKEMRILMVGLDGAGKTTVLYKLKLGEVI-TTIPTIGFNVETVQYKNISFTVWDVGGQDRIRSLWRHYYRNTEGVIFVVDSNDRSRIGEAREVMQRMLNEDELRNAAWLVFANKQDLPEAMSAAEITEKLGLHSIRNRPWFIQATCATSGEGLYEGLEWLSNSLKNS 180          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Yeast
Match: ARL1 (Soluble GTPase with a role in regulation of membrane traffic; regulates potassium influx; role in membrane organization at trans-Golgi network; required for delivery of Atg9p to the phagophore assembly site during autophagy under high temperature stress; required with Ypt6p for starvation-induced autophagy; required for the CVT pathway under non-starvation conditions; G protein of the Ras superfamily, similar to ADP-ribosylation factor [Source:SGD;Acc:S000000368])

HSP 1 Score: 111.694 bits (278), Expect = 2.407e-28
Identity = 56/167 (33.53%), Postives = 96/167 (57.49%), Query Frame = 3
Query: 3837 EEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            +E+ + ++GL  +GKTT ++ +  G+      PT+GFN++ ++  N+ + +WD+GGQ   R  W  Y     A+I++VDS D D++  A  ELH +L + +L    +LV  NK+D P AL+  E+ ++LNL ++ DR     + S  + E I   L WL+   K ++
Sbjct:   17 KELRILILGLDGAGKTTILYRLQIGEVVTTK-PTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRSWSIVASSAIKGEGITEGLDWLIDVIKEEQ 182          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Yeast
Match: ARF3 (Glucose-repressible ADP-ribosylation factor; GTPase of Ras superfamily involved in regulating cell polarity and invasive growth; localizes to dynamic spots at plasma membrane and modulates PtdIns(4,5)P2 levels to facilitate endocytosis; required for localization of endocytic protein Lsb5p to correct cortical site in cells; also has mRNA binding activity; homolog of mammalian Arf6 [Source:SGD;Acc:S000005620])

HSP 1 Score: 105.145 bits (261), Expect = 3.700e-26
Identity = 52/171 (30.41%), Postives = 100/171 (58.48%), Query Frame = 3
Query: 3816 LKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQ-ITDREICCYSISCKEQENIDITLQWLMKNS 4325
            L  LF  +EM++ ++GL  +GKTT ++ +   +  +   PTVGFN++ +T  NV   MWD+GGQ R R +W  Y     A+I+++DS+  +++E A+ EL++++ + ++  + +LV  NK+DL +A+   E+ + L L + + ++  C    +    + +   L W+  N+
Sbjct:    9 LGKLFGSKEMKILMLGLDKAGKTTILYKLKLNKI-KTSTPTVGFNVETVTYKNVKFNMWDVGGQQRLRPLWRHYFPATTALIFVIDSSARNRMEEAKEELYSIIGEKEMENVVLLVWANKQDLKDAMKPQEVSDFLELEKNLKNQPWCVIGSNALSGQGLVEGLSWISNNT 178          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Yeast
Match: SAR1 (ARF family GTPase; component of the COPII vesicle coat; required for transport vesicle formation during ER to Golgi protein transport; lowers membrane rigidity aiding vesicle formation; localizes to ER-mitochondrial contact sites where it enhances membrane curvature, thereby reducing contact size via its N-terminal amphipathic helix; regulates mitochondrial fission and fusion dynamics [Source:SGD;Acc:S000006139])

HSP 1 Score: 93.5893 bits (231), Expect = 5.079e-22
Identity = 52/153 (33.99%), Postives = 87/153 (56.86%), Query Frame = 3
Query: 3795 FERFLNWLKSL-FWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDRE 4250
            F  F + L SL  W +  +L  +GL  +GKTT +H++ + +    + PT     +++  GN+    +D+GG  + R +W+ Y   VN I+++VD+AD ++ + AR EL  L +  +L  +P ++LGNK D PNA++E EL   L L   T  +
Sbjct:    7 FGWFRDVLASLGLWNKHGKLLFLGLDNAGKTTLLHMLKNDRLAT-LQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGSQ 158          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Nematostella
Match: EDO45333 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT65])

HSP 1 Score: 323.168 bits (827), Expect = 5.739e-102
Identity = 143/184 (77.72%), Postives = 172/184 (93.48%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQ 4334
            M +FF   L+W KSLFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K++KGNV+IK+WDIGGQPRFRSMWERYCRGVN I+YMVD+ADHDK+EA++NELHNLL+KPQLA IP+LVLGNK+DLPN+L E EL+E+LNL  + DREICCYSISCKE++NIDITLQWL+++SKS+
Sbjct:    1 MLAFFRSILDWFKSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVSKGNVTIKVWDIGGQPRFRSMWERYCRGVNCIVYMVDAADHDKLEASKNELHNLLEKPQLAGIPILVLGNKKDLPNSLDEKELVERLNLTSVQDREICCYSISCKEKDNIDITLQWLIQHSKSR 184          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Nematostella
Match: EDO35368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLT2])

HSP 1 Score: 201.83 bits (512), Expect = 1.521e-58
Identity = 94/163 (57.67%), Postives = 128/163 (78.53%), Query Frame = 3
Query: 2601 TPNSFAN--HPSRMLLQSNGFTFHAYNKFKSNCIK-DREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSKRQIEIDKELAKHLENYKTVDDFRAN 3080
            TP S  +  HPS  LL+ NGFT   Y+KF   C+K +R++ G G SQE+NTL+RFWSFFLR++FN+ MY++F+K+A+ED+A G RYG+ECLFR++SYGLEKKFR ELFKDF ++T++D + G+ YGLEKFWAFL Y K + E+D E+ K L+ YKT++DFR +
Sbjct:   82 TPQSIPHFEHPSHRLLKENGFTQQLYHKFHLKCLKAERKKLGIGQSQEVNTLFRFWSFFLRQHFNRKMYEEFKKLAVEDSAAGYRYGLECLFRYYSYGLEKKFRPELFKDFMDETIRDHDQGNLYGLEKFWAFLKYYKAKFEVDPEIQKRLDKYKTIEDFRKD 244          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Nematostella
Match: EDO48392 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK4])

HSP 1 Score: 134.42 bits (337), Expect = 8.055e-36
Identity = 71/185 (38.38%), Postives = 111/185 (60.00%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWL---MKNSK 4328
            M SFF    N    L  KEE+ + ++GL  +GKTT ++ +   +     +PT+GFN++ +T  N+S  +WDIGGQ + R++W  Y +G   II++VDSAD ++ E ARNELH LL + +L  + +LV+ NK+D+ NA+   E+ EKL LN+I  R     S    + E +   L W+   ++N+K
Sbjct:    1 MGSFFSSIFN---RLLGKEEVRILMIGLDNAGKTTILYRLKLEEVV-STVPTLGFNVETVTYKNISFTVWDIGGQDKIRALWRVYYQGCQGIIFVVDSADRERAEEARNELHKLLAEEELQQVILLVIANKQDMANAMTASEIREKLKLNEIRGRPWFVQSACAVKGEGLFEGLDWMATQIRNNK 181          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Nematostella
Match: EDO40858 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S616])

HSP 1 Score: 132.494 bits (332), Expect = 2.914e-35
Identity = 65/174 (37.36%), Postives = 100/174 (57.47%), Query Frame = 3
Query: 3810 NWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKS 4331
            N    LF  +EM + ++GL  +GKTT ++ +  GQ +   IPTVGFN++ +T   V   +WD+GGQ + R +W  Y  G   +I++VD AD D+I+ AR ELH +++  ++    +LV  NK+DLP+AL  HE+ E+L L ++ DR            + +   L WL  N KS
Sbjct:    3 NVFAKLFGSKEMRILMLGLDAAGKTTILYKLKLGQ-SVTTIPTVGFNVETVTYKKVKFNVWDVGGQDKIRPLWRHYYTGTQGLIFVVDCADRDRIDEARTELHRIINDREMKDSIILVFANKQDLPDALKPHEIQERLQLTRLKDRNWYVQPSCATTGDGLCEGLSWLTANHKS 175          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Nematostella
Match: EDO40902 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S615])

HSP 1 Score: 128.257 bits (321), Expect = 7.503e-34
Identity = 61/172 (35.47%), Postives = 101/172 (58.72%), Query Frame = 3
Query: 3816 LKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKS 4331
            L  +F  +EM + ++GL  +GKTT ++ +  GQ +   IPTVGFN++ +T   V   +WD+GGQ + R +W  Y  G   +I++VD AD D+I+ AR EL  +++  ++  + +L+  NK+DLP+A+  HE+ EK+ L +I DR            + +   L+WL  N K+
Sbjct:    5 LSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQ-SVTTIPTVGFNVETVTFQKVKFNVWDVGGQDKIRPLWRHYFAGSQGLIFVVDCADRDRIDEARKELQRIINDREMKDVIILIFANKQDLPDAMKPHEIQEKMGLTRIRDRNWYVQPSCATTGDGLYDGLKWLSTNFKT 175          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Medaka
Match: arl8ba (ADP-ribosylation factor-like protein 8B-A [Source:NCBI gene;Acc:101159157])

HSP 1 Score: 325.094 bits (832), Expect = 3.503e-102
Identity = 147/185 (79.46%), Postives = 171/185 (92.43%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            MF+   R L+W KSLFWKEEMELTLVGLQ+SGKTTFV+VI+SG F+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD +K+EA+RNELHNLLDKPQL  IPVLVLGNKRDLP+AL E +LIEK+NL  I DREICCYSISCKE++NIDITLQWL+++SKS+R
Sbjct:    1 MFALINRLLDWFKSLFWKEEMELTLVGLQYSGKTTFVNVIASGHFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADQEKVEASRNELHNLLDKPQLQGIPVLVLGNKRDLPSALDEKQLIEKMNLAAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Medaka
Match: arl8bb (ADP-ribosylation factor-like protein 8B [Source:NCBI gene;Acc:101155921])

HSP 1 Score: 322.783 bits (826), Expect = 2.597e-101
Identity = 145/185 (78.38%), Postives = 171/185 (92.43%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   R L+W ++LFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD +KIEA+RNELHNLL+KPQL  IPVLVLGNKRDLPNAL E +LIEK+NL+ I DREICCYS+SCKE++NIDITLQWL+ +SKS+R
Sbjct:    1 MLALINRLLDWFRALFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADREKIEASRNELHNLLEKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSVSCKEKDNIDITLQWLIHHSKSRR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Medaka
Match: arl8a (ADP-ribosylation factor-like protein 8A [Source:NCBI gene;Acc:101169098])

HSP 1 Score: 315.849 bits (808), Expect = 7.904e-99
Identity = 143/185 (77.30%), Postives = 170/185 (91.89%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            M +   + L+W K+LFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+KITKGNV+IK+WDIGGQPRFRSMWERYCRGV+AI+YMVD+AD +KIEA++NELHNLLDKPQL  IPVLVLGNKRDL  AL E ELIE++NL+ I DREICCYSISCKE++NIDITLQWL+++SK++R
Sbjct:    1 MIALINKLLDWFKALFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKITKGNVTIKLWDIGGQPRFRSMWERYCRGVSAIVYMVDAADPEKIEASKNELHNLLDKPQLQGIPVLVLGNKRDLLGALDEKELIERMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKTKR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Medaka
Match: arl8bb (ADP-ribosylation factor-like protein 8B [Source:NCBI gene;Acc:101155921])

HSP 1 Score: 301.212 bits (770), Expect = 1.184e-93
Identity = 134/170 (78.82%), Postives = 157/170 (92.35%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENI 4292
            M +   R L+W ++LFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD +KIEA+RNELHNLL+KPQL  IPVLVLGNKRDLPNAL E +LIEK+NL+ I DREICCYS+SCKE++NI
Sbjct:    1 MLALINRLLDWFRALFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADREKIEASRNELHNLLEKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSVSCKEKDNI 170          
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Medaka
Match: arl8bb (ADP-ribosylation factor-like protein 8B [Source:NCBI gene;Acc:101155921])

HSP 1 Score: 260.766 bits (665), Expect = 2.977e-79
Identity = 117/147 (79.59%), Postives = 136/147 (92.52%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKL 4223
            M +   R L+W ++LFWKEEMELTLVGLQ+SGKTTFV+VI+SGQF+EDMIPTVGFNM+K+TKGNV+IK+WDIGGQPRFRSMWERYCRGVNAI+YMVD+AD +KIEA+RNELHNLL+KPQL  IPVLVLGNKRDLPNAL E +LIEK+
Sbjct:    1 MLALINRLLDWFRALFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMVDAADREKIEASRNELHNLLEKPQLQGIPVLVLGNKRDLPNALDEKQLIEKI 147          
BLAST of ADP-ribosylation factor-like protein 8B vs. Planmine SMEST
Match: SMESG000033210.1 (SMESG000033210.1)

HSP 1 Score: 1873.98 bits (4853), Expect = 0.000e+0
Identity = 1039/1041 (99.81%), Postives = 1039/1041 (99.81%), Query Frame = 3
Query:   57 MDFKDEKNPETLEPXXXXXXXXXXXXXXXXXASNVKTDCEWPSLQCAVTLXXXXXXXXXXXXTTKQPPFVMECNEYDNRKSKSISNTNGHRKKWEVVNVDLQYYKTVNSNNKKPTKGVRQNESSSHPGNPIDKLSGNASNMDSNFYHGYQSQGQAHNQRGPRQFLRYPRKPNKMVQGYHKIPGNVVELQHKPNGIDTRXXXXXXXXXXXXXXXXXXXMNYKTSNKSNNPHPTNSAPIMRPQFCGGSMPPFSQAGPIFSPIPGYFPVVLPFAAAPMDYIMSAGTTNPVAPAICGTKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQHGNVFFPDETLDAQIVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMSRIGQALVTSNRLEVRQSPAPAVRNKDSPSRWVLQSINLNPDAPEFVPISRTEPFXXXXXXXXXXXXXXXXIATRPVRNDIKVYRNQRKQSELHSVSENDDEAKQEEIEIDLESQANICCATASGGSSNNNALPSSQLCLDEKIYAQQQPPRRRTSSTVSDEDIDDSMLANLWVIAGSDRNESPHTRTKSSSISKVNAVGSTSSRPVIPMRQQSTGSIESTDNKSKKVDEQLTEIIRLGLIEYEKEIFKKGGRSRTNSNTDAKVNVDNVNAAIKAALNDQLVAQIQXXXXXXXXXXXXXXXGYLTNEPLSSTAHIAPYPFQNYIGGSYILPYCPFIPVSTLSGCQPNFPGIGYGLPGVYPVYPFVPAPQPLMPTNTNKDDKPSETEQVRKVSRHMVGFYPAGEDSGRLFRSHGSKNRLRAISSSECGGFNEVHVGFAFDXXXXXXXXXXXXXXXXEPDSKTPNSFANHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSKRQIEIDKELAKHLENYKTVDDFRANFEKPDGFFVDKVRMRTKSELLNQGLLKDDKNNT 3179
            MDFKDEKNPETLEPNVISNENISSSETVTSTASNVKTDCEWPSLQCAVTLSVSPSVAVPSVATTKQPPFVMECNEYDNRKSKSISNTNGHRKKWEVVNVDLQYYKTVNSNNKKPTKGVRQNESSSHPGNPIDKLSGNASNMDSNFYHGYQSQGQAHNQRGPRQFLRYPRKPNKMVQGYHKIPGNVVELQHKPNGIDTRKNKNSASLSSVSSSYKGSNMNYKTSNKSNNPHPTNSAPIMRPQFCGGSMPPFSQAGPIFSPIPGYFPVVLPFAAAPMDYIMSAGTTNPVAPAICGTKLSTSQSSSSSVGATAATISTSTTPTATSTTQHGNVFFPDETLDAQIVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDM RIGQALVTSNRLEVRQSPAPAVRNKDSPSRWVLQSINLNPDAPEFVPISRTEPFSSTVSSSLQSPSHVSSIATRPVRNDIKVYRNQRKQSELHSVSENDDEAKQEEIEIDLESQANICCATASGGSSNNNALPSSQLCLDEKIYAQQQPPRRRTSSTVSDEDIDDSMLANLWVIAGSDRNESPHTRTKSSSISKVNAVGSTSSRPVIPMRQQSTGSIESTDNKSKKVDEQLTEIIRLGLIEYEKEIFKKGGRSRTNSNTDAKVNVDNVNAAIKAALNDQLVAQIQSLSTSEDTITSSEDSGYLTNEPLSSTAHIAPYPFQNYIGGSYILPYCPFIPVSTLSGCQPNFPGIGYGLPGVYPVYPFVPAPQP MPTNTNKDDKPSETEQVRKVSRHMVGFYPAGEDSGRLFRSHGSKNRLRAISSSECGGFNEVHVGFAFDNRNINRSRSRTVSSSSEPDSKTPNSFANHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSKRQIEIDKELAKHLENYKTVDDFRANFEKPDGFFVDKVRMRTKSELLNQGLLKDDKNNT
Sbjct:    1 MDFKDEKNPETLEPNVISNENISSSETVTSTASNVKTDCEWPSLQCAVTLSVSPSVAVPSVATTKQPPFVMECNEYDNRKSKSISNTNGHRKKWEVVNVDLQYYKTVNSNNKKPTKGVRQNESSSHPGNPIDKLSGNASNMDSNFYHGYQSQGQAHNQRGPRQFLRYPRKPNKMVQGYHKIPGNVVELQHKPNGIDTRKNKNSASLSSVSSSYKGSNMNYKTSNKSNNPHPTNSAPIMRPQFCGGSMPPFSQAGPIFSPIPGYFPVVLPFAAAPMDYIMSAGTTNPVAPAICGTKLSTSQSSSSSVGATAATISTSTTPTATSTTQHGNVFFPDETLDAQIVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMGRIGQALVTSNRLEVRQSPAPAVRNKDSPSRWVLQSINLNPDAPEFVPISRTEPFSSTVSSSLQSPSHVSSIATRPVRNDIKVYRNQRKQSELHSVSENDDEAKQEEIEIDLESQANICCATASGGSSNNNALPSSQLCLDEKIYAQQQPPRRRTSSTVSDEDIDDSMLANLWVIAGSDRNESPHTRTKSSSISKVNAVGSTSSRPVIPMRQQSTGSIESTDNKSKKVDEQLTEIIRLGLIEYEKEIFKKGGRSRTNSNTDAKVNVDNVNAAIKAALNDQLVAQIQSLSTSEDTITSSEDSGYLTNEPLSSTAHIAPYPFQNYIGGSYILPYCPFIPVSTLSGCQPNFPGIGYGLPGVYPVYPFVPAPQPPMPTNTNKDDKPSETEQVRKVSRHMVGFYPAGEDSGRLFRSHGSKNRLRAISSSECGGFNEVHVGFAFDNRNINRSRSRTVSSSSEPDSKTPNSFANHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSKRQIEIDKELAKHLENYKTVDDFRANFEKPDGFFVDKVRMRTKSELLNQGLLKDDKNNT 1041          
BLAST of ADP-ribosylation factor-like protein 8B vs. Planmine SMEST
Match: SMESG000033210.1 (SMESG000033210.1)

HSP 1 Score: 1840.85 bits (4767), Expect = 0.000e+0
Identity = 1015/1041 (97.50%), Postives = 1020/1041 (97.98%), Query Frame = 3
Query:   57 MDFKDEKNPETLEPXXXXXXXXXXXXXXXXXASNVKTDCEWPSLQCAVTLXXXXXXXXXXXXTTKQPPFVMECNEYDNRKSKSISNTNGHRKKWEVVNVDLQYYKTVNSNNKKPTKGVRQNESSSHPGNPIDKLSGNASNMDSNFYHGYQSQGQAHNQRGPRQFLRYPRKPNKMVQGYHKIPGNVVELQHKPNGIDTRXXXXXXXXXXXXXXXXXXXMNYKTSNKSNNPHPTNSAPIMRPQFCGGSMPPFSQAGPIFSPIPGYFPVVLPFAAAPMDYIMSAGTTNPVAPAICGTKLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQHGNVFFPDETLDAQIVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMSRIGQALVTSNRLEVRQSPAPAVRNKDSPSRWVLQSINLNPDAPEFVPISRTEPFXXXXXXXXXXXXXXXXIATRPVRNDIKVYRNQRKQSELHSVSENDDEAKQEEIEIDLESQANICCATASGGSSNNNALPSSQLCLDEKIYAQQQPPRRRTSSTVSDEDIDDSMLANLWVIAGSDRNESPHTRTKSSSISKVNAVGSTSSRPVIPMRQQSTGSIESTDNKSKKVDEQLTEIIRLGLIEYEKEIFKKGGRSRTNSNTDAKVNVDNVNAAIKAALNDQLVAQIQXXXXXXXXXXXXXXXGYLTNEPLSSTAHIAPYPFQNYIGGSYILPYCPFIPVSTLSGCQPNFPGIGYGLPGVYPVYPFVPAPQPLMPTNTNKDDKPSETEQVRKVSRHMVGFYPAGEDSGRLFRSHGSKNRLRAISSSECGGFNEVHVGFAFDXXXXXXXXXXXXXXXXEPDSKTPNSFANHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSKRQIEIDKELAKHLENYKTVDDFRANFEKPDGFFVDKVRMRTKSELLNQGLLKDDKNNT 3179
            MDFKDEKNPETLEPNVISNENISSSETVTSTASNVKTDCEWPSLQCAVTLSVSPSVAVPSVATTKQPPFVMECNEYDNRKSKSISNTNGHRKKWEVVNVDLQYYKTVNSNNKKPTKGVRQNESSSHPGNPIDKLSGNASNMDSNFYHGYQSQGQAHNQRGPRQFLRYPRKPNKMVQGYHKIPGNVVELQHKPNGIDTRKNKNSASLSSVSSSYKGSNMNYKTSNKSNNPHPTNSAPIMRPQFCGGSMPPFSQAGPIFSPIPGYFPVVLPFAAAPMDYIMSAGTTNPVAPAICGTKLSTSQSSSSSVGATAATISTSTTPTATSTTQHGNVFFPDETLDAQIVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDM RIGQALVTSNRLEVRQSPAPAVRNKDSPSRWVLQSINLNPDAPEFVPISRTEPFSSTVSSSLQSPSHVSSIATRPVRNDIKVYRNQRKQSELHSVSENDDEAKQEEIEIDLESQANICCATASGGSSNNNALPSSQLCLDEKIYAQQQPPRRRTSSTVSDEDIDDSMLANLWVIAGSDRNESPHTRTKSSSISKVNAVGSTSSRPVIPMRQQSTGSIESTDNKSKKVDEQLTEIIRLGLIEYEKEIFKKGGRSRTNSNTDAKVNVDNVNAAIKAALNDQLVAQIQSLST              + + ++S+   APYPFQNYIGGSYILPYCPFIPVSTLSGCQPNFPGIGYGLPGVYPVYPFVPAPQP MPTNTNKDDKPSETEQVRKVSRHMVGFYPAGEDSGRLFRSHGSKNRLRAISSSECGGFNEVHVGFAFDNRNINRSRSRTVSSSSEPDSKTPNSFANHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSKRQIEIDKELAKHLENYKTVDDFRANFEKPDGFFVDKVRMRTKSELLNQGLLKDDKNNT
Sbjct:    1 MDFKDEKNPETLEPNVISNENISSSETVTSTASNVKTDCEWPSLQCAVTLSVSPSVAVPSVATTKQPPFVMECNEYDNRKSKSISNTNGHRKKWEVVNVDLQYYKTVNSNNKKPTKGVRQNESSSHPGNPIDKLSGNASNMDSNFYHGYQSQGQAHNQRGPRQFLRYPRKPNKMVQGYHKIPGNVVELQHKPNGIDTRKNKNSASLSSVSSSYKGSNMNYKTSNKSNNPHPTNSAPIMRPQFCGGSMPPFSQAGPIFSPIPGYFPVVLPFAAAPMDYIMSAGTTNPVAPAICGTKLSTSQSSSSSVGATAATISTSTTPTATSTTQHGNVFFPDETLDAQIVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMGRIGQALVTSNRLEVRQSPAPAVRNKDSPSRWVLQSINLNPDAPEFVPISRTEPFSSTVSSSLQSPSHVSSIATRPVRNDIKVYRNQRKQSELHSVSENDDEAKQEEIEIDLESQANICCATASGGSSNNNALPSSQLCLDEKIYAQQQPPRRRTSSTVSDEDIDDSMLANLWVIAGSDRNESPHTRTKSSSISKVNAVGSTSSRPVIPMRQQSTGSIESTDNKSKKVDEQLTEIIRLGLIEYEKEIFKKGGRSRTNSNTDAKVNVDNVNAAIKAALNDQLVAQIQSLST--------------SEDTITSSEDSAPYPFQNYIGGSYILPYCPFIPVSTLSGCQPNFPGIGYGLPGVYPVYPFVPAPQPPMPTNTNKDDKPSETEQVRKVSRHMVGFYPAGEDSGRLFRSHGSKNRLRAISSSECGGFNEVHVGFAFDNRNINRSRSRTVSSSSEPDSKTPNSFANHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSKRQIEIDKELAKHLENYKTVDDFRANFEKPDGFFVDKVRMRTKSELLNQGLLKDDKNNT 1027          
BLAST of ADP-ribosylation factor-like protein 8B vs. Planmine SMEST
Match: SMESG000006523.1 (SMESG000006523.1)

HSP 1 Score: 375.941 bits (964), Expect = 1.161e-120
Identity = 178/185 (96.22%), Postives = 182/185 (98.38%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            MF F ++ L+W+KSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR
Sbjct:    1 MFGFIQKILDWIKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 185          
BLAST of ADP-ribosylation factor-like protein 8B vs. Planmine SMEST
Match: SMESG000015732.1 (SMESG000015732.1)

HSP 1 Score: 363.999 bits (933), Expect = 1.020e-106
Identity = 255/717 (35.56%), Postives = 376/717 (52.44%), Query Frame = 3
Query: 1077 IVKQVEYYFSDENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMSRIGQALVTSNRLEVRQSPAPAVRNKDSPSRWVLQS----INLNPDAPEFVPISRTEPFXXXXXXXXXXXXXXXXIATRPVRNDIKVYRNQRKQSELHSVSENDDEAKQEEIEIDLESQANICCATASGGSSNNNALPSSQLCLDEKIYAQQQPPRRRTSSTVSDEDIDDSMLANLWVIAGSDRNES-PHTRTKSSSISKVNAVGSTSSRPVIPMRQQSTGSIESTDNKSKKVDEQLTEIIRLGLIEYEKEIFKKGGRSRTNSNTDAKVNVDNVNAAIKAALNDQLVAQIQXXXXXXXXXXXXXXXGYLTNEPLSSTAHIAPYPFQNYIGGSY--ILPYCPFIPVSTLSGCQPNFPGIGYGLPGVYPVYPFVPAPQPLMPTNTNKDDKPSETEQ--------VRKV---------SRHMVGFYPAGEDSGRLFRSHGSKNRLRAISSSECGGFNEVHVGFAFDXXXXXXXXXXXXXXXXEPDSKTPNS--FA--NHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRFWSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRKELFKDFQEDTLKDVNN-GHKYGLEKFWAFLHYSKRQIEIDKELAKHLENYKTVDDFRANFEKPDGFFVDKVRMRTKSEL 3140
            ++KQVEYYFS+ENL +D YLR +MD +GWVSL +I  FKRI+    D+  I Q L TS +LEV       ++N +   R +  S    +NLNPDAPEFVP +                                              + +   +KQEE++   E++     A++S G +       ++L L  K+ A+Q   +R  SS +S+ED+DD+ML  L +I     + S P  +      SK N    + S     + +   G  +       K++ +L ++I+LGL  YEK+   K   ++ + +  +  +   VN          LV++ +  + S+     +  S    NE      + +P P    +  S+  ++P    IP ++ S          +  PG Y  +P V A      +    +    ETE+        ++K+         +R + GF+PAG D     + H  + R R  S  E     E HVGFAFD +N         +SS     K  +S  FA  NH S  +L++NGFTF+ YNKFK+  ++DRE +G G SQEMNTLYRFWSFFLRENFNK+M+++FR +A++DA + ARYG+ECLFRF+SYGLE +FRK LFK+F+EDTL+D +   HKYGLEKFWAFL YSK++I+I+  L++ L+ YKT++D RANF  PDGFF+D+ R+RT SE+
Sbjct:  293 LLKQVEYYFSEENLHKDTYLRSRMDSDGWVSLLIIAGFKRIANFGVDVGTIAQILSTSKKLEV------DIKNMNV--RLITMSKTKDVNLNPDAPEFVPQNEN--------------------------------------------TTDGKPSKQEELQFAFETETQDSMASSSKGVT---VQERNRLALQAKLNAKQNGRQRLNSSIMSEEDVDDNMLPYLLIITPESPDISEPDAKHFDRKPSKFNQNQISKS----VLDKHPGGDRKPFYVSRSKMNSELEDVIKLGLEAYEKDFRNKNVVNKNSRSRTSSNSESKVN----------LVSRQEFEALSQTLADFNVHSNKSDNEVPPPLPNHSPAPASETVFSSFSQMVPTLIGIPATSDS----------FYPPGTYMYFPPVVAVCDSGTSQKQDNKTKQETEESIPLKSILIKKLDSDLKSKSSARQIAGFFPAGSDRYGGAK-HNKQKRQRLYSEGENLQL-ETHVGFAFDTKNNVARSRTASASSDSEIVKDSSSSTFAMKNHKSHAILKANGFTFNGYNKFKAYALRDREINGVGFSQEMNTLYRFWSFFLRENFNKSMFREFRSLALDDANQNARYGLECLFRFYSYGLEIRFRKSLFKNFEEDTLRDYDTYKHKYGLEKFWAFLFYSKKKIDINSRLSELLDKYKTLEDIRANFIPPDGFFIDRSRVRTNSEI 928          
BLAST of ADP-ribosylation factor-like protein 8B vs. Planmine SMEST
Match: SMESG000033211.1 (SMESG000033211.1)

HSP 1 Score: 296.204 bits (757), Expect = 4.347e-92
Identity = 136/185 (73.51%), Postives = 159/185 (85.95%), Query Frame = 3
Query: 3783 MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMIPTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSADHDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLNQITDREICCYSISCKEQENIDITLQWLMKNSKSQR 4337
            MFSFFERFLNWLKSLFWKEE+ELTLVGLQFSGKTTF++++++G+F E+MIPTVGFNM+KITKGNVSIK+WDIGGQPRFRSMWERYCRGVNAII+MVDSAD DK+E A  EL NLL   QL  IPVLVLGNK DLPNA+ E +L++ LNL+ I DR+I CYSISC E  NID T++WL +N K  +
Sbjct:    1 MFSFFERFLNWLKSLFWKEELELTLVGLQFSGKTTFINILANGKFNENMIPTVGFNMRKITKGNVSIKIWDIGGQPRFRSMWERYCRGVNAIIFMVDSADRDKLETASTELRNLLKNSQLLGIPVLVLGNKNDLPNAMQEVDLVKTLNLSDIRDRQIACYSISCLENYNIDATIKWLTQNCKKTK 185          
The following BLAST results are available for this feature:
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARL8B1.940e-10279.46ADP ribosylation factor like GTPase 8B [Source:HGN... [more]
ARL8B1.940e-10279.46ADP ribosylation factor like GTPase 8B [Source:HGN... [more]
ARL8A2.246e-10179.46ADP ribosylation factor like GTPase 8A [Source:HGN... [more]
ARL8B3.226e-6879.20ADP ribosylation factor like GTPase 8B [Source:HGN... [more]
ARL8A1.029e-6679.84ADP ribosylation factor like GTPase 8A [Source:HGN... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl-83.078e-9877.30ARF-Like; Novel small G protein indispensable for ... [more]
larp-16.321e-4756.77La-related protein 1 [Source:UniProtKB/Swiss-Prot... [more]
larp-11.259e-4656.77La-related protein 1 [Source:UniProtKB/Swiss-Prot... [more]
larp-11.259e-4656.77La-related protein 1 [Source:UniProtKB/Swiss-Prot... [more]
arf-61.619e-3435.47ADP-Ribosylation Factor related [Source:UniProtKB... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arl86.737e-10179.89gene:FBgn0037551 transcript:FBtr0081794[more]
Arl86.737e-10179.89gene:FBgn0037551 transcript:FBtr0339723[more]
Arl86.737e-10179.89gene:FBgn0037551 transcript:FBtr0339724[more]
larp4.791e-5357.58gene:FBgn0261618 transcript:FBtr0089680[more]
larp4.791e-5357.58gene:FBgn0261618 transcript:FBtr0301181[more]
back to top
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl8bb5.767e-10380.54ADP-ribosylation factor-like 8Bb [Source:ZFIN;Acc:... [more]
arl8ba1.043e-10280.00ADP-ribosylation factor-like 8Ba [Source:NCBI gene... [more]
arl8a1.749e-10077.84ADP-ribosylation factor-like 8A [Source:ZFIN;Acc:Z... [more]
larp1b1.580e-5641.91La ribonucleoprotein 1B [Source:ZFIN;Acc:ZDB-GENE-... [more]
AL928908.41.899e-5656.17pep chromosome:GRCz11:CHR_ALT_CTG17_1_22:26792344:... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl10b1.121e-10079.35ADP-ribosylation factor-like 10B [Source:NCBI gene... [more]
arl8a1.568e-10078.38ADP ribosylation factor like GTPase 8A [Source:NCB... [more]
arl8b3.769e-10079.46ADP ribosylation factor like GTPase 8B [Source:NCB... [more]
arl10b6.354e-9475.00ADP-ribosylation factor-like 10B [Source:NCBI gene... [more]
larp13.414e-5446.52La ribonucleoprotein domain family member 1 [Sourc... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Arl8b1.332e-10279.46ADP-ribosylation factor-like 8B [Source:MGI Symbol... [more]
Arl8a1.248e-10078.92ADP-ribosylation factor-like 8A [Source:MGI Symbol... [more]
Arl8a3.186e-7880.27ADP-ribosylation factor-like 8A [Source:MGI Symbol... [more]
Arl8b7.206e-7681.75ADP-ribosylation factor-like 8B [Source:MGI Symbol... [more]
Larp14.396e-5547.41La ribonucleoprotein domain family, member 1 [Sour... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 8B vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NZW8|AR8BA_DANRE7.876e-10280.00ADP-ribosylation factor-like protein 8B-A OS=Danio... [more]
sp|Q66HA6|ARL8B_RAT9.317e-10279.46ADP-ribosylation factor-like protein 8B OS=Rattus ... [more]
sp|Q9CQW2|ARL8B_MOUSE9.317e-10279.46ADP-ribosylation factor-like protein 8B OS=Mus mus... [more]
sp|Q9NVJ2|ARL8B_HUMAN9.317e-10279.46ADP-ribosylation factor-like protein 8B OS=Homo sa... [more]
sp|Q4R4S4|ARL8B_MACFA2.074e-10178.92ADP-ribosylation factor-like protein 8B OS=Macaca ... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 8B vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q86F336.408e-10584.32Putative ADP-ribosylation factor-like 10C OS=Schis... [more]
A0A4S2LNC02.737e-10483.24Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A183PNW21.958e-10383.24Uncharacterized protein OS=Schistosoma mattheei OX... [more]
G4VC982.771e-10383.24ADP-ribosylation factor-like 10, arl10 OS=Schistos... [more]
V4B0E72.317e-10284.15Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl8ba3.932e-10380.00ADP-ribosylation factor-like protein 8B-A [Source:... [more]
arl8bb1.944e-10178.38ADP-ribosylation factor-like protein 8B-A [Source:... [more]
arl8a2.707e-9977.30ADP-ribosylation factor-like protein 8A [Source:NC... [more]
arl8ba1.456e-9580.00ADP-ribosylation factor-like protein 8B-A [Source:... [more]
larp11.616e-5455.03La ribonucleoprotein 1, translational regulator [S... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl8ba9.622e-10077.84ADP-ribosylation factor-like 8Ba [Source:NCBI gene... [more]
ENSPMAT00000005549.11.734e-8279.33pep scaffold:Pmarinus_7.0:GL476953:2920:26208:1 ge... [more]
larp1b5.399e-5253.99La ribonucleoprotein 1B [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000011118.13.686e-3536.42pep scaffold:Pmarinus_7.0:GL482736:15659:16189:-1 ... [more]
arf2a1.417e-3134.83ADP-ribosylation factor 2a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ARF21.863e-3336.42ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARF12.146e-3236.42ADP-ribosylation factor; GTPase of the Ras superfa... [more]
ARL12.407e-2833.53Soluble GTPase with a role in regulation of membra... [more]
ARF33.700e-2630.41Glucose-repressible ADP-ribosylation factor; GTPas... [more]
SAR15.079e-2233.99ARF family GTPase; component of the COPII vesicle ... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453335.739e-10277.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO353681.521e-5857.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483928.055e-3638.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408582.914e-3537.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409027.503e-3435.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 8B vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arl8ba3.503e-10279.46ADP-ribosylation factor-like protein 8B-A [Source:... [more]
arl8bb2.597e-10178.38ADP-ribosylation factor-like protein 8B [Source:NC... [more]
arl8a7.904e-9977.30ADP-ribosylation factor-like protein 8A [Source:NC... [more]
arl8bb1.184e-9378.82ADP-ribosylation factor-like protein 8B [Source:NC... [more]
arl8bb2.977e-7979.59ADP-ribosylation factor-like protein 8B [Source:NC... [more]
back to top
BLAST of ADP-ribosylation factor-like protein 8B vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000033210.10.000e+099.81SMESG000033210.1[more]
SMESG000033210.10.000e+097.50SMESG000033210.1[more]
SMESG000006523.11.161e-12096.22SMESG000006523.1[more]
SMESG000015732.11.020e-10635.56SMESG000015732.1[more]
SMESG000033211.14.347e-9273.51SMESG000033211.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031703 ID=SMED30031703|Name=ADP-ribosylation factor-like protein 8B|organism=Schmidtea mediterranea sexual|type=transcript|length=4771bp
ATTATTTGTAAAATTTTAATTAATTATATTTAATAATTAGATGATATTTT
GTAATAATGGATTTTAAAGATGAAAAAAATCCGGAAACTTTAGAGCCAAA
TGTGATTTCAAATGAAAATATTTCTAGTTCAGAAACAGTTACTAGTACCG
CAAGTAACGTTAAAACAGACTGCGAATGGCCATCACTTCAATGTGCGGTG
ACTTTGAGTGTTTCACCTAGTGTGGCTGTTCCCAGTGTAGCTACAACTAA
GCAGCCGCCTTTTGTTATGGAGTGTAATGAATATGATAATAGAAAATCTA
AGTCTATTTCTAATACTAATGGTCATAGGAAAAAATGGGAAGTTGTGAAT
GTTGATTTACAATATTATAAAACTGTGAATTCTAATAATAAAAAACCCAC
TAAAGGAGTACGACAAAATGAATCATCCAGTCATCCAGGGAATCCTATCG
ACAAATTATCAGGAAATGCTTCAAATATGGATAGTAACTTCTATCACGGT
TATCAATCACAAGGTCAAGCTCACAATCAAAGAGGACCACGCCAGTTTCT
TCGTTACCCTAGGAAACCAAATAAAATGGTGCAAGGCTACCACAAAATAC
CCGGAAATGTAGTCGAATTACAGCACAAACCGAATGGAATAGATACTAGA
AAGAATAAAAATTCTGCTTCTTTATCTTCTGTATCATCATCGTACAAAGG
ATCAAATATGAATTATAAAACATCAAATAAGTCTAACAATCCTCACCCGA
CAAACAGTGCACCGATAATGCGTCCACAATTCTGTGGAGGATCTATGCCG
CCATTTAGTCAGGCTGGACCGATTTTCAGTCCAATTCCTGGATATTTCCC
AGTCGTTTTGCCATTTGCTGCCGCTCCAATGGATTACATAATGTCTGCTG
GGACGACGAATCCCGTTGCCCCGGCAATCTGTGGGACAAAGTTGTCCACT
TCTCAGTCATCATCGTCGTCAGTCGGTGCCACAGCCGCAACGATTTCCAC
ATCAACGACTCCAACAGCCACGTCCACTACACAACACGGAAATGTATTTT
TCCCCGACGAAACACTAGATGCTCAAATTGTCAAACAAGTCGAATATTAT
TTCTCCGATGAGAATTTGATCCGGGACGAATATTTGCGCAAACAAATGGA
CCACGAAGGCTGGGTTTCGCTCGACCTCATCGGTAAATTCAAACGTATCT
CGGCATTGACTACCGATATGAGCCGGATTGGACAGGCATTGGTTACTAGT
AATCGATTGGAAGTGCGCCAAAGCCCAGCGCCAGCCGTCAGAAATAAAGA
CAGTCCATCTCGATGGGTATTACAGTCGATAAACCTGAATCCAGATGCTC
CTGAATTTGTTCCAATATCACGGACCGAGCCGTTTTCATCTACTGTATCT
TCATCTTTGCAATCACCTTCACACGTATCGTCAATAGCAACGAGACCGGT
TCGCAATGATATCAAAGTGTATAGGAATCAACGCAAGCAGTCAGAATTGC
ATAGCGTCAGTGAGAATGATGATGAAGCTAAGCAAGAAGAAATTGAAATT
GATCTTGAGTCTCAGGCGAATATTTGCTGTGCCACTGCTAGCGGAGGTAG
CAGTAATAATAACGCCTTGCCATCTTCGCAATTGTGCCTTGATGAGAAAA
TATACGCTCAACAACAACCACCGAGAAGACGCACATCATCCACAGTTTCC
GATGAAGATATCGACGATTCCATGCTTGCTAATTTATGGGTCATAGCTGG
CTCTGATCGCAATGAATCACCTCACACTAGGACCAAATCTAGCTCCATAT
CAAAAGTAAATGCTGTAGGATCAACGTCATCGAGACCCGTCATCCCCATG
CGTCAACAGTCAACTGGGAGCATTGAATCGACGGATAACAAGTCCAAAAA
AGTTGATGAACAATTAACTGAAATAATACGGTTAGGATTGATTGAATACG
AGAAAGAGATATTCAAAAAAGGTGGTCGAAGTCGCACAAATTCCAATACT
GATGCTAAAGTGAACGTTGATAATGTCAATGCAGCAATTAAAGCTGCTCT
CAATGATCAATTGGTGGCCCAAATTCAATCATTATCTACATCTGAAGACA
CAATAACTTCCTCTGAAGACTCAGGTTACCTCACAAATGAACCTTTGTCT
TCTACTGCTCATATAGCACCTTATCCATTTCAGAATTATATTGGGGGTTC
TTATATCTTGCCTTATTGCCCTTTTATACCAGTTTCAACTCTGTCTGGTT
GTCAACCTAACTTCCCAGGTATCGGATACGGTCTTCCTGGTGTCTATCCG
GTTTATCCGTTTGTCCCTGCTCCTCAGCCTCTTATGCCAACCAATACTAA
TAAAGACGATAAACCGTCTGAAACCGAACAGGTTCGTAAAGTATCGAGGC
ATATGGTTGGATTTTATCCAGCTGGAGAAGACAGTGGTCGACTATTCAGA
TCTCACGGATCCAAGAATCGATTAAGAGCAATTTCCAGCAGTGAATGTGG
TGGATTTAACGAAGTTCATGTCGGATTCGCTTTTGACAATCGTAATATCA
ACCGATCCCGATCACGTACGGTCTCGTCGTCAAGTGAACCAGACAGCAAA
ACTCCAAATTCATTTGCCAATCATCCTAGTCGCATGTTATTGCAAAGCAA
TGGTTTCACTTTTCATGCTTATAATAAATTCAAGAGCAATTGCATTAAAG
ATCGAGAAGAATCCGGTAAAGGTTTATCACAAGAAATGAACACACTTTAT
CGATTCTGGTCGTTTTTCTTGCGTGAAAACTTTAATAAAAATATGTATAA
GGACTTTAGAAAAGTTGCTATTGAAGACGCAGCAGAAGGTGCACGTTATG
GAATTGAATGTTTGTTTCGGTTTTTCAGTTATGGACTTGAAAAGAAATTT
CGTAAAGAATTATTTAAAGACTTTCAAGAAGATACACTGAAAGACGTGAA
TAATGGCCACAAATACGGATTGGAAAAATTTTGGGCGTTTTTACATTATA
GTAAAAGACAAATTGAAATCGATAAGGAATTGGCTAAACATTTAGAAAAC
TATAAAACGGTGGACGATTTTCGTGCGAATTTTGAAAAGCCAGATGGTTT
TTTTGTTGATAAAGTTCGAATGAGAACGAAATCGGAGTTGCTTAATCAAG
GACTATTGAAAGATGATAAGAATAACACTTGATTCATGCGCATTGCGATT
TCAGTGTACCACTTGCCCTTAAATATTTGTCTTGAGTATTCGGCATAATA
AAAACTATTCGAGTTTGGATGGAACCAATACAGATTCCCATCACAATTAC
TTGGATTTATAGCAACTTAAAACAATAAATTATCAACCTAGCTATTTTAT
TTGACGATTTAGACTTGCATTAATTAATGGCATTATCTGGTGGTAATTAT
CATATTTCTGAGTAGTATGTTGTATATATTCTCTATCCTTCATGCTTGTT
GATTTATATTGACTATGAGACATTTGTAAATTTGAATTTTATTATACCAT
TGGGCAGAAATTGTACAGTTTTATTTTCCGTGACATTTGTACGATTTAGT
AGTATTAATTATGGTGCTTGTTAGGTGGAAAATTTATGTGCAACTATTTA
TCACAATTTTTCACTTTGGAAAAGTTTTGTGAAATGATTTTTATTTAAAT
TGTCTGTAACATGATTTAATTTCTGTCTTTATCGTAGATTTTTTACGCTT
GATTCCCTAAAAATATTATGTTTTATTTTCTAAATTTGTTTAACTGTATC
AATTTGGAATTAAAATATGTTTATATTTAAAAATGTTTTCTTTCTTTGAA
CGATTTTTAAATTGGCTGAAAAGTTTATTTTGGAAAGAAGAAATGGAATT
GACGTTAGTCGGGTTGCAGTTTTCTGGAAAAACCACATTTGTTCATGTGA
TATCATCTGGTCAATTTACTGAAGATATGATTCCAACAGTAGGGTTTAAC
ATGAAAAAAATAACCAAGGGAAATGTTTCTATAAAAATGTGGGATATTGG
AGGGCAACCGAGATTTCGAAGTATGTGGGAACGGTATTGCCGTGGTGTCA
ATGCAATAATATATATGGTGGATTCCGCTGATCATGATAAAATCGAAGCA
GCTAGAAATGAATTGCATAATTTATTGGATAAACCTCAGTTAGCTGCCAT
TCCAGTACTAGTTTTGGGTAACAAAAGAGATCTTCCTAACGCTTTAGCTG
AACATGAATTGATTGAAAAGCTAAACCTTAATCAAATTACAGATCGAGAA
ATATGTTGTTATTCAATATCGTGTAAAGAGCAAGAAAATATTGACATAAC
CCTGCAGTGGCTGATGAAGAATTCCAAGTCTCAGCGCTAATTTAGTTTCA
TTTCATTGAATTTTTTGTGATTTATTTATGAAATTTTATGACATTTAAAA
TTGATTTATGTAGATTTTAATGTTTGTATTTTATTACATAAAAAATGCTG
ATTAATTTTGCATGCGTATGTTATACAATGTTTTCGTTTGAAATTTCCCA
CATTTTTGTGGTCATGATAATATTTCGAATTTAAAATTTTAAGAATTTTA
AAAAAAGAATAACATTTTTGATTTTCCGGTTACGCTTGATATTATAACCA
ATTCAATGAGGTAAATATTCCATTTTTATGACTTGTTTTAATCGTTCAGT
CAGTTCGAATTATATTGTAAAATAAAAAAACTGCAAGTGAATTTCTTATT
ATTTATAAAAATATGTCAATATGAGGCTCGGAGTGACAAAATTTCATTTA
GTTATTCATTTACAAATCTCG
back to top

protein sequence of SMED30031703-orf-1

>SMED30031703-orf-1 ID=SMED30031703-orf-1|Name=SMED30031703-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=186bp
MFSFFERFLNWLKSLFWKEEMELTLVGLQFSGKTTFVHVISSGQFTEDMI
PTVGFNMKKITKGNVSIKMWDIGGQPRFRSMWERYCRGVNAIIYMVDSAD
HDKIEAARNELHNLLDKPQLAAIPVLVLGNKRDLPNALAEHELIEKLNLN
QITDREICCYSISCKEQENIDITLQWLMKNSKSQR*
back to top

protein sequence of SMED30031703-orf-2

>SMED30031703-orf-2 ID=SMED30031703-orf-2|Name=SMED30031703-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1042bp
MDFKDEKNPETLEPNVISNENISSSETVTSTASNVKTDCEWPSLQCAVTL
SVSPSVAVPSVATTKQPPFVMECNEYDNRKSKSISNTNGHRKKWEVVNVD
LQYYKTVNSNNKKPTKGVRQNESSSHPGNPIDKLSGNASNMDSNFYHGYQ
SQGQAHNQRGPRQFLRYPRKPNKMVQGYHKIPGNVVELQHKPNGIDTRKN
KNSASLSSVSSSYKGSNMNYKTSNKSNNPHPTNSAPIMRPQFCGGSMPPF
SQAGPIFSPIPGYFPVVLPFAAAPMDYIMSAGTTNPVAPAICGTKLSTSQ
SSSSSVGATAATISTSTTPTATSTTQHGNVFFPDETLDAQIVKQVEYYFS
DENLIRDEYLRKQMDHEGWVSLDLIGKFKRISALTTDMSRIGQALVTSNR
LEVRQSPAPAVRNKDSPSRWVLQSINLNPDAPEFVPISRTEPFSSTVSSS
LQSPSHVSSIATRPVRNDIKVYRNQRKQSELHSVSENDDEAKQEEIEIDL
ESQANICCATASGGSSNNNALPSSQLCLDEKIYAQQQPPRRRTSSTVSDE
DIDDSMLANLWVIAGSDRNESPHTRTKSSSISKVNAVGSTSSRPVIPMRQ
QSTGSIESTDNKSKKVDEQLTEIIRLGLIEYEKEIFKKGGRSRTNSNTDA
KVNVDNVNAAIKAALNDQLVAQIQSLSTSEDTITSSEDSGYLTNEPLSST
AHIAPYPFQNYIGGSYILPYCPFIPVSTLSGCQPNFPGIGYGLPGVYPVY
PFVPAPQPLMPTNTNKDDKPSETEQVRKVSRHMVGFYPAGEDSGRLFRSH
GSKNRLRAISSSECGGFNEVHVGFAFDNRNINRSRSRTVSSSSEPDSKTP
NSFANHPSRMLLQSNGFTFHAYNKFKSNCIKDREESGKGLSQEMNTLYRF
WSFFLRENFNKNMYKDFRKVAIEDAAEGARYGIECLFRFFSYGLEKKFRK
ELFKDFQEDTLKDVNNGHKYGLEKFWAFLHYSKRQIEIDKELAKHLENYK
TVDDFRANFEKPDGFFVDKVRMRTKSELLNQGLLKDDKNNT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0015031protein transport
GO:0007264small GTPase mediated signal transduction
GO:0007049cell cycle
GO:0007059chromosome segregation
GO:0007067mitotic nuclear division
GO:0032418lysosome localization
GO:0051301cell division
Vocabulary: cellular component
TermDefinition
GO:0030054cell junction
GO:0030424axon
GO:0042995cell projection
GO:0045202synapse
GO:0005622intracellular
GO:0005737cytoplasm
GO:0005764lysosome
GO:0005765lysosomal membrane
GO:0005768endosome
GO:0005819spindle
GO:0005856cytoskeleton
GO:0016020membrane
GO:0030496midbody
GO:0031902late endosome membrane
GO:0051233spindle midzone
GO:0070062extracellular exosome
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036388WH-like_DNA-bd_sf
IPR036390WH_DNA-bd_sf
IPR006607DM15
IPR006630La_HTH
IPR011991WHTH_DNA-bd_dom
IPR006689Small_GTPase_ARF/SAR
IPR027417P-loop_NTPase
IPR024156Small_GTPase_ARF
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
GO:0019003GDP binding
GO:0043014alpha-tubulin binding
GO:0048487beta-tubulin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006607Protein of unknown function DM15SMARTSM00684dm15coord: 908..946
e-value: 2.2E-18
score: 77.1
coord: 866..907
e-value: 4.8E-14
score: 62.7
coord: 947..982
e-value: 0.29
score: 13.0
IPR006630La-type HTH domainSMARTSM00715lacoord: 335..414
e-value: 7.8E-23
score: 91.9
IPR006630La-type HTH domainPFAMPF05383Lacoord: 341..395
e-value: 2.1E-21
score: 75.7
IPR006630La-type HTH domainPROSITEPS50961HTH_LAcoord: 331..420
score: 22.938
IPR036388Winged helix-like DNA-binding domain superfamilyGENE3DG3DSA:1.10.10.10coord: 325..420
e-value: 6.6E-26
score: 91.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 108..131
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 568..613
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 198..233
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 195..233
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 575..609
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 834..855
NoneNo IPR availablePANTHERPTHR22792:SF51LA-RELATED PROTEIN 1coord: 785..1013
coord: 328..658
NoneNo IPR availablePANTHERPTHR22792LUPUS LA PROTEIN-RELATEDcoord: 785..1013
coord: 328..658
NoneNo IPR availableCDDcd07323LAMcoord: 339..412
e-value: 3.60268E-27
score: 103.38
IPR036390Winged helix DNA-binding domain superfamilySUPERFAMILYSSF46785"Winged helix" DNA-binding domaincoord: 332..408