SMED30031700

Overview
NameSMED30031700
Smed IDSMED30031700
Length (bp)2314
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30031700 (SMED30031700) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30031700 (SMED30031700) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031700

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30031700 dd_Smed_v4_20227_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30031700 vs. Ensembl Human
Match: GTF2IRD2 (GTF2I repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30775])

HSP 1 Score: 120.939 bits (302), Expect = 8.515e-35
Identity = 76/214 (35.51%), Postives = 108/214 (50.47%), Query Frame = -1
Query:    2 KLVSITTD*TPAMLGRYNCFIN--------LCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL-MAKLNSSAAI 616
            KLVS+ +  TPAM+   N  +          C+      +  S  CIIH ++LCA+ + M  +M    K  N I +R L    F   + E D   Y  L  + +++WLSR   L+RF  S++EI  F+ SRG+   QL    W+ DL FL D T  LN LN+ LQG  + + QM   ++AF  KL L    L +NN  +FP L +A  N S  +
Sbjct:  612 KLVSVASTGTPAMVDANNGLVTKLKSRVATFCK----GAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLASRNESDGL 820          

HSP 2 Score: 47.7506 bits (112), Expect = 8.515e-35
Identity = 25/61 (40.98%), Postives = 36/61 (59.02%), Query Frame = -3
Query:  645 AFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFS----SFKTF 815
            A+ + +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IFS    S K F
Sbjct:  546 AYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFSRVEKSLKNF 606          
BLAST of SMED30031700 vs. Ensembl Human
Match: GTF2IRD2 (GTF2I repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30775])

HSP 1 Score: 120.553 bits (301), Expect = 1.212e-34
Identity = 76/214 (35.51%), Postives = 108/214 (50.47%), Query Frame = -1
Query:    2 KLVSITTD*TPAMLGRYNCFIN--------LCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL-MAKLNSSAAI 616
            KLVS+ +  TPAM+   N  +          C+      +  S  CIIH ++LCA+ + M  +M    K  N I +R L    F   + E D   Y  L  + +++WLSR   L+RF  S++EI  F+ SRG+   QL    W+ DL FL D T  LN LN+ LQG  + + QM   ++AF  KL L    L +NN  +FP L +A  N S  +
Sbjct:  774 KLVSVASTGTPAMVDANNGLVTKLKSRVATFCK----GAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLASRNESDGL 982          

HSP 2 Score: 47.7506 bits (112), Expect = 1.212e-34
Identity = 25/61 (40.98%), Postives = 36/61 (59.02%), Query Frame = -3
Query:  645 AFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFS----SFKTF 815
            A+ + +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IFS    S K F
Sbjct:  708 AYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFSRVEKSLKNF 768          
BLAST of SMED30031700 vs. Ensembl Human
Match: GTF2IRD2B (GTF2I repeat domain containing 2B [Source:HGNC Symbol;Acc:HGNC:33125])

HSP 1 Score: 119.013 bits (297), Expect = 1.082e-33
Identity = 72/206 (34.95%), Postives = 105/206 (50.97%), Query Frame = -1
Query:   32 HFFKLVSITTD*TPAMLGRYNCFIN--------LCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL 625
            ++ +LVS+ +  TPAM+   N  +          C+      +  S  CIIH ++LCA+ + M  +M    K  N I +R L    F   + E D   Y  L  + +++WLSR   L+RF  S++EI  F+ SRG+   QL    W+ DL FL D T  LN LN+ LQG  + + QM   ++AF  KL L    L +NN  +FP L
Sbjct:  609 NWSRLVSVASTGTPAMVDANNGLVTKLKSRVATFCK----GAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL 809          

HSP 2 Score: 45.8246 bits (107), Expect = 1.082e-33
Identity = 21/51 (41.18%), Postives = 32/51 (62.75%), Query Frame = -3
Query:  663 AFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 815
            A+ + +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IF
Sbjct:  546 AYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIF 596          
BLAST of SMED30031700 vs. Ensembl Human
Match: GTF2IRD2B (GTF2I repeat domain containing 2B [Source:HGNC Symbol;Acc:HGNC:33125])

HSP 1 Score: 118.627 bits (296), Expect = 1.395e-33
Identity = 73/202 (36.14%), Postives = 105/202 (51.98%), Query Frame = -1
Query:   32 HFFKLVSITTD*TPAMLGRYNCFINL--CRVDD--NFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL 625
            ++ +LVS+ +  TPAM+   N  +     RV       +  S  CIIH ++LCA+ + M  +M    K  N I +R L    F   + E D   Y  L  + +++WLSR   L+RF  S++EI  F+ SRG+   QL    W+ DL FL D T  LN LN+ LQG  + + QM   ++AF  KL L    L +NN  +FP L
Sbjct:  776 NWSRLVSVASTGTPAMVDANNGLVTKLKSRVATFCKGAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL 976          

HSP 2 Score: 45.8246 bits (107), Expect = 1.395e-33
Identity = 21/51 (41.18%), Postives = 32/51 (62.75%), Query Frame = -3
Query:  663 AFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 815
            A+ + +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IF
Sbjct:  713 AYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIF 763          
BLAST of SMED30031700 vs. Ensembl Human
Match: ZBED5 (zinc finger BED-type containing 5 [Source:HGNC Symbol;Acc:HGNC:30803])

HSP 1 Score: 100.908 bits (250), Expect = 8.397e-31
Identity = 65/207 (31.40%), Postives = 112/207 (54.11%), Query Frame = -1
Query:   11 KLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVI--NMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL---MAKLNSS 616
            K V + +D + A+ G+    + L +     P+  S HC++++  L  K++  ++ +++    +I N I AR  Q RL K+  EE     +T L ++ +VRWLSR K L R     +E+ VF+ S       L +  WLL L +L D  +KLN++NL +QGK+ T+F +   + +  +KL      +E+ NF+ FP L   + ++NS+
Sbjct:  337 KCVDVCSDASRAVDGKIAEAVTLIKYVA--PESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQ-HTALLLNTEVRWLSRGKVLVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINST 540          

HSP 2 Score: 54.299 bits (129), Expect = 8.397e-31
Identity = 45/152 (29.61%), Postives = 86/152 (56.58%), Query Frame = -3
Query:  621 SKAATIASVRVSRIIAKAKKPFSDG-VIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIPF 1073
            +++AT AS  VS  IA + +  + G ++ K    +    +F +  +K      I+ +QLS ++V RR+ +++ D+++ L   L+ C  F LQ+DES DV  ++ L++F+R  F + + +E+LL    L+    GE+IF+   +F+   +I +
Sbjct:  190 NESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKK-----IDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVRYRF-NKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEW 335          
BLAST of SMED30031700 vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 163.31 bits (412), Expect = 1.039e-68
Identity = 83/205 (40.49%), Postives = 116/205 (56.59%), Query Frame = -1
Query:    2 KLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNLMAKLNSSAAI 616
            KL +I TD  PAMLG     + LC+ DD FP F ++HCIIHQ+   +K +N+  IM    +I N +   +L  R FK  ++E D D  ++L  H  VRWLSR   L RF   +  +K+FL  + +EY +L D +W+ DL FL D    LN LN+ LQGK K +  +V SV AF  KL L    L+K ++ +FP L+      A +
Sbjct:  250 KLTAIVTDGAPAMLGSERGLVGLCKADDRFPAFWTFHCIIHQEHWVSKKLNLDHIMKPVLEIVNFVRTHALNHRQFKNLIDELDEDLPSDLLFHCAVRWLSRGHVLSRFFELLNPVKLFLAEKHKEYPELHDPQWISDLAFLVDVLHYLNGLNVDLQGKLKMLPDLVQSVFAFVNKLKLFKTHLQKRDYTHFPTLLKASGQKAEV 454          

HSP 2 Score: 118.627 bits (296), Expect = 1.039e-68
Identity = 80/220 (36.36%), Postives = 120/220 (54.55%), Query Frame = -3
Query:  648 EWENDYFFIMVKNKCCCLICNTSLSLPKKEMLK-------DTLEIEYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKT 1286
            EWE+ YFF+    K  CLIC TSLS  K   L+         +  E+ + SELRK K+  LK     Q  +F K +  S+  T+AS +++  IA+AKKP+ +G   K    +A   L  +  N   +  ++ DLQLS ++V +R+++I   ++  L  DL+ C  F + +DES DV D  Q  IF+R +  D   +EELL I+PLK +T G D+  +  T
Sbjct:   23 EWEDLYFFVERNGKPFCLICQTSLSHFKASNLERHFTSLHSAVAREFPKGSELRKHKVKTLKGQAEKQTQLFRKFSKHSETVTLASYQLAWNIARAKKPYLEGEFVKKCLSDAVAILCPENEN---LKRSVKDLQLSRHTVEQRISDIDNSVETHLLSDLQKCQYFSIALDESCDVQDKPQFAIFVRFVSEDCTIREELLDIVPLKDRTRGIDLKETLMT 239          
BLAST of SMED30031700 vs. Ensembl Zebrafish
Match: CR392001.3 (pep chromosome:GRCz11:8:38963323:38965260:-1 gene:ENSDARG00000117159.1 transcript:ENSDART00000181495.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR392001.3)

HSP 1 Score: 132.88 bits (333), Expect = 2.475e-51
Identity = 72/198 (36.36%), Postives = 118/198 (59.60%), Query Frame = -1
Query:   32 LVSITTD*TPAMLGRYNCFINLCR--VDDNFPDFLSYHCIIHQQTLCAKVI--NMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL 613
            L+S+ TD  P+M G    F+ L +  +D N    L++HCI+HQ+ LCA+        +M    ++ N I A++L  R F+  ++E D + Y++L +H  VRWLS+ + L+RF   ++ +K FL S+   Y QLED +WL  L F+ D TS LN LN  LQ +  T  QM+ +V +F++KL++    +++   ++FP+L
Sbjct:  244 LISVATDGAPSMRGSKRGFVTLLQKALDRNL---LAFHCILHQEALCAQTFPSECMVVMNLVIEMVNKIIAKALNHRQFRALLDEVDSE-YSDLLLHNKVRWLSKDEVLRRFVACLEHVKTFLKSKDLIYPQLEDTEWLEKLHFMVDMTSHLNKLNESLQVRGNTALQMLEAVLSFERKLTVFARDVQRGTLSHFPSL 437          

HSP 2 Score: 90.5077 bits (223), Expect = 2.475e-51
Identity = 68/198 (34.34%), Postives = 101/198 (51.01%), Query Frame = -3
Query:  666 CLICNTSLSLPKKEMLKD-------TLEIEYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDI 1238
            CL+C+  LS  KK  ++        T   EY   SE RK  I  L   L  +++ F K      + T AS   +R I K  KPF+DG   K +F+  ++ LFSDF NK EI+  I D+ LS  +V  R  +++ ++ +   KD+    A+ +  DES D        +  R +  D   +EE++ +IPLKG+T GEDI
Sbjct:   37 CLLCSEKLSNNKKSNVERHFQGRHATFAAEYPVGSE-RKSAIALLVEKLEERKNKFKKWIASPNSTTAASFVATREIIKRGKPFTDGDYMKESFINISEHLFSDFKNKTEIIQKIKDMPLSAKTVKERAIKMAGNITEQQIKDINSAPAYSIACDESCDTA------LLCRYVNSD-GPQEEIIKLIPLKGQTRGEDI 226          
BLAST of SMED30031700 vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 122.865 bits (307), Expect = 2.603e-55
Identity = 81/201 (40.30%), Postives = 107/201 (53.23%), Query Frame = -1
Query:   35 FFKLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*A--RSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLIS-RGEEY--KQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPN 622
            F     I TD   AM+GR        R+     D   +HCI+HQ+ LC   + MADIM    K+ N I    RSL  R FK  +EE D   Y +L +H +VRWLS  K L RF    KEI ++L   + + Y  + L D  +L  L FLTD T  LN LNL LQG+D+ + Q+ S + AF+ KL LL   L KN+  +F +
Sbjct:  250 FSSCTCIVTDGARAMVGRNQGLAG--RLRKEGIDCHMFHCIVHQEVLCGTSLKMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELD-AAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFES 447          

HSP 2 Score: 114.39 bits (285), Expect = 2.603e-55
Identity = 83/241 (34.44%), Postives = 128/241 (53.11%), Query Frame = -3
Query:  651 KNILENCEIMNTKKVKTYQYHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLK---DTLE----IEYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFK 1352
            K+  +NC        +  ++ ++WE +YFF   K+K  CL+C  ++S  K+  +K    TL      +YT   E R   I +LK+ L  Q+++F+  T   KAA  AS  V+  IAK K PFS G + K   L+ A++    F N+  +   +  + LS  +V R +  I+  L   L+  L     F + +DESTD+ D  QL+IF+R +  +F   EELL I+PL G T GEDI+++ K
Sbjct:    8 KSFTKNCAKKRKIDSENREFQEKWEEEYFFGKNKDKPQCLVCAQTISSCKEYNVKRHYTTLHGAKYAKYT--GEARLTIIKDLKSKLCKQKNIFSAVTTTQKAAVKASFLVAEEIAKRKYPFSSGTLVKTCALKMAEA----FGNET-MAKTVESISLSHQTVARHICTINQHLTDKLQNILRSAPYFSIALDESTDITDTCQLVIFVRSVDQEFHISEELLEIVPLHGSTKGEDIYNAVK 241          
BLAST of SMED30031700 vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 122.865 bits (307), Expect = 2.781e-55
Identity = 81/201 (40.30%), Postives = 107/201 (53.23%), Query Frame = -1
Query:   35 FFKLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*A--RSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLIS-RGEEY--KQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPN 622
            F     I TD   AM+GR        R+     D   +HCI+HQ+ LC   + MADIM    K+ N I    RSL  R FK  +EE D   Y +L +H +VRWLS  K L RF    KEI ++L   + + Y  + L D  +L  L FLTD T  LN LNL LQG+D+ + Q+ S + AF+ KL LL   L KN+  +F +
Sbjct:  250 FSSCTCIVTDGARAMVGRNQGLAG--RLRKEGIDCHMFHCIVHQEVLCGTSLKMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELD-AAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFES 447          

HSP 2 Score: 114.775 bits (286), Expect = 2.781e-55
Identity = 83/241 (34.44%), Postives = 128/241 (53.11%), Query Frame = -3
Query:  651 KNILENCEIMNTKKVKTYQYHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLK---DTLE----IEYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFK 1352
            K+  +NC        +  ++ ++WE +YFF   K+K  CL+C  ++S  K+  +K    TL      +YT   E R   I +LK+ L  Q+++F+  T   KAA  AS  V+  IAK K PFS G + K   L+ A++    F N+  +   +  + LS  +V R +  I+  L   L+  L     F + +DESTD+ D  QL+IF+R +  +F   EELL I+PL G T GEDI+++ K
Sbjct:    8 KSFTKNCAKKRKIDSENREFQEKWEEEYFFGKNKDKPQCLVCAQTISSCKEYNVKRHYTTLHGAKYAKYT--GEARLTIIKDLKSKLCKQKNIFSAVTTTQKAAVKASFLVAEEIAKRKYPFSSGTLVKTCALKMAEA----FGNET-MAKTVESISLSHQTVARHICTINQHLTDKLQNILRSAPYFSIALDESTDITDTCQLVIFVRSVDQEFHISEELLEIVPLHGSTKGEDIYNAVK 241          
BLAST of SMED30031700 vs. Ensembl Xenopus
Match: ENSXETT00000028445.1 (general transcription factor II-I repeat domain-containing protein 2-like [Source:NCBI gene;Acc:101734469])

HSP 1 Score: 74.7146 bits (182), Expect = 6.479e-26
Identity = 66/223 (29.60%), Postives = 110/223 (49.33%), Query Frame = -3
Query:  642 YHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLKDTL----EIEYTQNSELRKVKIM-ELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFL 1295
            + + WE DYFF+    K  CL+C+  L++ K+  +K       E  Y+Q +   ++ I+ EL++ L  Q++V + +T    AA  AS  +   I K K+ F    + K    E A  +   F N+ E+ +  + + L   +V RRV+ +   + Q L   L++C  F L +DE+TD      L+IFIR I   F   E++L  + L      ED+ +  K+ L
Sbjct:   16 FKERWELDYFFVKCNGKPLCLLCSQILAVCKEYNVKRHYISLHEKTYSQYTGDHRMAILNELRSKLNKQETVTSIETATDTAALKASFIICEEIVKRKQAFDSVDVVK----ECAVKMARVFGNE-EMAAKFDSISLQPQTVARRVSAMHQQITQKLHAILKNCCYFSLALDETTDSCGTDLLVIFIRAIDDGFNISEDILKCVSLPKTAKEEDLLNEAKSSL 233          

HSP 2 Score: 64.3142 bits (155), Expect = 6.479e-26
Identity = 60/204 (29.41%), Postives = 98/204 (48.04%), Query Frame = -1
Query:   35 FFKLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*AR-----SLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEE---YKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPN 622
            F K  S+ T+ + +M  +      L R +    D +  HCI+H++ L   ++ M+D+M    KI+N I  +     ++ ++ FK  ++E     Y +   H +  W S  + L RF    KEI +FL     +    + L +E +L  L FLTD T  L+ L   ++ KD+ I Q+ + V  F  KL LL   L  N+  YF +
Sbjct:  239 FDKCTSVMTNGSKSMTAKSLGLSALLRKEG--ADCVVLHCIMHEEMLIGTLLKMSDVMEVVVKISNFILEKRGFITAVTKKKFKTFLDELSA-AYGDFDSHKNAYWSSAGQCLFRFFSLRKEIYLFLKDTNYDPILTESLCNEDFLSSLAFLTDLTHYLHSLKKNIEAKDQLITQLYTHVSVFSNKLMLLKLNLISNDLTYFES 439          
BLAST of SMED30031700 vs. Ensembl Xenopus
Match: ENSXETT00000010836.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:63865670:63866962:-1 gene:ENSXETG00000001503.1 transcript:ENSXETT00000010836.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 1.310e-17
Identity = 52/137 (37.96%), Postives = 78/137 (56.93%), Query Frame = -3
Query:  903 YFFIMVKNKCCCLICNTSLSLPKK-------EMLKDTLEIEYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNA-------FLEAADSLFSDFSNKAEILSAINDLQ 1271
            YFF   + KC C+I +  +++ KK         +    ++E+   + L KVK+ ELK+ L+AQQ++F K   KSKAATIAS +V+ ++AK KKP+ DG I K+A       +L    S FS+   K E+ S + D Q
Sbjct:   13 YFFTNFREKCICIIYHAPVAIGKKCNVESHFTTMHRKYDVEFPVGTNLWKVKVKELKSVLSAQQAIFKKPANKSKAATIASFKVAHVLAKKKKPYEDGEIVKDAMVAVRFHYLLPEISQFSE--EKDELYSELYDYQ 147          

HSP 2 Score: 63.5438 bits (153), Expect = 7.849e-11
Identity = 36/68 (52.94%), Postives = 45/68 (66.18%), Query Frame = -1
Query:   98 RFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKT--IFQMVSSVKAF 295
            RF Y + EI  F   + E Y +L D +WL DL FLTD TSKLN+LNL+LQG+DKT  IF+     K+F
Sbjct:  121 RFHYLLPEISQFSEEKDELYSELYDYQWLADLAFLTDKTSKLNNLNLELQGQDKTTCIFKHKLGQKSF 188          
BLAST of SMED30031700 vs. Ensembl Mouse
Match: Gtf2ird2 (GTF2I repeat domain containing 2 [Source:MGI Symbol;Acc:MGI:2149780])

HSP 1 Score: 122.094 bits (305), Expect = 2.007e-41
Identity = 73/205 (35.61%), Postives = 101/205 (49.27%), Query Frame = -1
Query:   32 FKSHFFKLVSITTD*TPAMLGRYNCFINLCRVDD----NFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL 634
            F   + KLVS+ +  TPAM+   +  +   R          D  S  CIIH + LCA+ + M  +M       N I +R L    F   + E D   Y  L  H  ++WL R   L+RF  S++EI  F+ SRG+   QL    W+LDL FL D T+ LN L+  LQG  + + QM   ++AF  KL L    L +NN  +FP L
Sbjct:  600 FSIDWSKLVSVASTGTPAMMDANSGLVTKLRARAASCCKGADLKSVRCIIHPEWLCAQKLRMGHVMDVVVDSVNWICSRGLNHGDFTTLLYELDSQ-YGSLLYHTALKWLGRGLVLRRFFESLEEIDSFMSSRGKPVPQLSSRDWILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRAFLAKLCLWETHLARNNLAHFPTL 803          

HSP 2 Score: 68.1662 bits (165), Expect = 2.007e-41
Identity = 60/238 (25.21%), Postives = 102/238 (42.86%), Query Frame = -3
Query:  663 LENCEIMNTKKVKTYQ----YHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLKDTLEIEYTQN-----SELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNK--AEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 1343
            L   E+ N  K K  Q    + ++WE  YFF+ V+N   CLIC  S+S+ K+  L+   +  ++++      + R+ K+ ELK GL        ++ L         +  S I+   ++PF +     N+ ++ A+ +      K   +I S +                                 A+ + +DE TD+ D +QL IFIR +  +F   EELL  +P+ G   G +IF
Sbjct:  404 LPGLELSNVGKRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSVSVSKEYNLRRHYQTNHSRHYDQYSGQAREEKLRELKRGL--------RKYL---------LGASEIVC-PEQPFPNASPPTNSAVQPAEEVAGSLWEKLRQKIRSFV---------------------------------AYSIAIDEITDINDTTQLAIFIRGVDDNFDVSEELLDTVPMTGAKSGNEIF 590          
BLAST of SMED30031700 vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 96.6709 bits (239), Expect = 1.384e-27
Identity = 71/214 (33.18%), Postives = 106/214 (49.53%), Query Frame = -1
Query:   26 LRHS*ISFKSHFFKLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVI--NMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRG-EEYKQL-EDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNLMA 655
            LR   IS+KS    +  + TD  PA LG  + F  L  V +  P  +  HC++H QTL  K +  +  ++M +     N + A SL  RLF     + D    T L +H + RWLSR K L+R      E+K+F   +   +++ L  D   L  + +L D  + LN+LNL LQG + T   +   + +F+ KL L   KL++N F   P L A
Sbjct:  389 LRQHEISWKS----ICGVCTDGAPATLGCQSGFQRL--VLNESPKAIGAHCMLHLQTLAMKTLPQDFQEVMKSVLSSVNFVKASSLNSRLFLQLCSDLDEPSKT-LLLHTEGRWLSRGKVLKRIFELRDELKMFFNQKAIRQFEALFSDNSALQKVAYLVDIFTILNELNLSLQGPNSTCLDLSEKIHSFQMKLQLWQKKLDENKFYMLPTLSA 595          

HSP 2 Score: 46.9802 bits (110), Expect = 1.384e-27
Identity = 71/272 (26.10%), Postives = 121/272 (44.49%), Query Frame = -3
Query:  627 CIILKNILENCEIMNT----------KKVKTYQYHKEWENDYFFIMVK---NKCCCLICNTSLSLP--KKEMLKDTLEIEYT----QNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKP--FSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISX-----XXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQI 1364
            C     +L  C I N           + VK  +Y++ +    F   +     +  C+IC   LS    K   LK   E +++    +++   + K   LK       S   KQ +   AA   S  V+  IA+  KP  F++ ++F  A       +  +F  K   LSA++   LS ++V RR++++S       ++++    L  CS   +Q+DESTDV +  QL++++R I  D   K+E L   PL+      D+F +  +FL   +I
Sbjct:  136 CEGFNEVLRQCRIANVDHPRPVDHGERNVKRRKYNEGFLQYGFTSTITVGIERPQCVICGVVLSAESMKPNKLKRHFESKHSSFAGKDTNYFRSKADGLKKARPDTGSKSNKQNV---AAVETSYLVALRIARDMKPHTFAEHLLFPVAKDRVRVMIGDEFVTK---LSAVS---LSNDTVRRRIHDMSADILDQVVQEIKSAPLPICS---IQLDESTDVANCLQLMVYVRYIN-DGDFKDEFLCCKPLERTATALDVFEAVDSFLRQHEI 394          
BLAST of SMED30031700 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 79.337 bits (194), Expect = 1.278e-14
Identity = 49/169 (28.99%), Postives = 92/169 (54.44%), Query Frame = -1
Query:   11 HCIIHQQTLCAKVIN--MADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQ-LEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNLMAKLNSS 508
            HC IH++ L AK ++  + +I+  + +I + +   +   ++  +  EE   + +  L ++A+VRWLSR + L R      EI++FL  +  +  +   DE+W+  L +L D  S +N LN  LQG   T F + + V  F+++L + + + ++N++  FP     L+SS
Sbjct:  841 HCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSE-HVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHDEEWIAKLAYLADIFSLINKLNSSLQGTMTTFFNLYNKVDVFQKRLKMWLKRAQENDYGMFPLFSEFLDSS 1008          
BLAST of SMED30031700 vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 79.337 bits (194), Expect = 1.326e-14
Identity = 49/169 (28.99%), Postives = 92/169 (54.44%), Query Frame = -1
Query:   11 HCIIHQQTLCAKVIN--MADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQ-LEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNLMAKLNSS 508
            HC IH++ L AK ++  + +I+  + +I + +   +   ++  +  EE   + +  L ++A+VRWLSR + L R      EI++FL  +  +  +   DE+W+  L +L D  S +N LN  LQG   T F + + V  F+++L + + + ++N++  FP     L+SS
Sbjct:  933 HCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSE-HVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHDEEWIAKLAYLADIFSLINKLNSSLQGTMTTFFNLYNKVDVFQKRLKMWLKRAQENDYGMFPLFSEFLDSS 1100          
BLAST of SMED30031700 vs. Ensembl Mouse
Match: Epm2aip1 (EPM2A (laforin) interacting protein 1 [Source:MGI Symbol;Acc:MGI:1925031])

HSP 1 Score: 63.1586 bits (152), Expect = 1.023e-9
Identity = 51/196 (26.02%), Postives = 88/196 (44.90%), Query Frame = -1
Query:   38 KLVSITTD*TPAMLGRYNCFINLCR---VDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFP 616
            ++V +TT  T  M+G  +  ++  R   V  N  + + Y   +H + L +  +++  I+ T  +    I  R ++R  F+  + ES+ +    +       WL R K L+      KEI+ FL+S G       D++WL D  FL D    L +++ +LQ            +  F+ KLS L   +E+ N   FP
Sbjct:  241 RMVGLTTTHTLRMIGENSGLVSYMREKAVSPNCWNVIHYSGFLHLELLSSYDVDINQIINTISEWVVMIKTRGVRRPEFQPLLTESESEHGERVNGRCLNNWLRRGKTLKLIFSLRKEIEAFLVSVGATTVHFSDKQWLCDFGFLVDIMDYLREISEELQISKVFAAAAFERICTFEGKLSSLQRHMEEVNLTDFP 436          
BLAST of SMED30031700 vs. UniProt/SwissProt
Match: sp|A4IFA3|GT2D2_BOVIN (General transcription factor II-I repeat domain-containing protein 2 OS=Bos taurus OX=9913 GN=GTF2IRD2 PE=2 SV=1)

HSP 1 Score: 122.865 bits (307), Expect = 1.161e-40
Identity = 74/209 (35.41%), Postives = 107/209 (51.20%), Query Frame = -1
Query:   32 FKSHFFKLVSITTD*TPAMLGRYNCFIN--------LCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL 634
            F   + KLVS+ +  TPAM+   +  +         +C+  D      S  CIIH ++LCA+ + M  IM+      N I +R L    F   + E D   Y  L  + +++WLSR   L+RF  S++EI  F+ SRG+   QL  + W+ DL FL D T  LN LN+ LQG  + + QM   ++AF  KL L    L +NN  +FP L
Sbjct:  607 FNIDWSKLVSVASTGTPAMVDANDGLVTKLKSKVAMVCKGSD----LKSVCCIIHPESLCAQKLKMDHIMSVVVNAVNWICSRGLNHSEFTTLLYELDCQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSQDWIKDLAFLVDMTMHLNTLNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLARNNLAHFPTL 810          

HSP 2 Score: 67.781 bits (164), Expect = 1.161e-40
Identity = 56/236 (23.73%), Postives = 107/236 (45.34%), Query Frame = -3
Query:  663 LENCEIMNTKKVKTYQ----YHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLKDTLEIEYTQN-----SELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 1343
            L   E+ N  K K  Q    + ++WE  YFF+ V+N   CLIC  S+S+ K+  L+   +  ++++      ++R  K+ ELK GL                                         +   L ++D++  +   + ++ + +N  +   N+  + V +++ +L + L++ +    A+ + +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IF
Sbjct:  409 LPGLELSNVGKRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSMSVSKEYNLRRHYQTNHSKHYDQYTEKMRDEKLQELKEGL-----------------------------------------RKYLLGSSDTVCPE---QKQVFAKVNPRE---NAAVQPVEDVAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIF 597          
BLAST of SMED30031700 vs. UniProt/SwissProt
Match: sp|Q99NI3|GT2D2_MOUSE (General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.220e-40
Identity = 73/205 (35.61%), Postives = 101/205 (49.27%), Query Frame = -1
Query:   32 FKSHFFKLVSITTD*TPAMLGRYNCFINLCRVDD----NFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL 634
            F   + KLVS+ +  TPAM+   +  +   R          D  S  CIIH + LCA+ + M  +M       N I +R L    F   + E D   Y  L  H  ++WL R   L+RF  S++EI  F+ SRG+   QL    W+LDL FL D T+ LN L+  LQG  + + QM   ++AF  KL L    L +NN  +FP L
Sbjct:  600 FSIDWSKLVSVASTGTPAMMDANSGLVTKLRARAASCCKGADLKSVRCIIHPEWLCAQKLRMGHVMDVVVDSVNWICSRGLNHGDFTTLLYELDSQ-YGSLLYHTALKWLGRGLVLRRFFESLEEIDSFMSSRGKPVPQLSSRDWILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRAFLAKLCLWETHLARNNLAHFPTL 803          

HSP 2 Score: 68.1662 bits (165), Expect = 1.220e-40
Identity = 60/238 (25.21%), Postives = 102/238 (42.86%), Query Frame = -3
Query:  663 LENCEIMNTKKVKTYQ----YHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLKDTLEIEYTQN-----SELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNK--AEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 1343
            L   E+ N  K K  Q    + ++WE  YFF+ V+N   CLIC  S+S+ K+  L+   +  ++++      + R+ K+ ELK GL        ++ L         +  S I+   ++PF +     N+ ++ A+ +      K   +I S +                                 A+ + +DE TD+ D +QL IFIR +  +F   EELL  +P+ G   G +IF
Sbjct:  404 LPGLELSNVGKRKIDQEGRVFQEKWERAYFFVEVQNIPTCLICKQSVSVSKEYNLRRHYQTNHSRHYDQYSGQAREEKLRELKRGL--------RKYL---------LGASEIVC-PEQPFPNASPPTNSAVQPAEEVAGSLWEKLRQKIRSFV---------------------------------AYSIAIDEITDINDTTQLAIFIRGVDDNFDVSEELLDTVPMTGAKSGNEIF 590          
BLAST of SMED30031700 vs. UniProt/SwissProt
Match: sp|Q86UP8|GTD2A_HUMAN (General transcription factor II-I repeat domain-containing protein 2A OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=3)

HSP 1 Score: 120.939 bits (302), Expect = 3.750e-34
Identity = 76/214 (35.51%), Postives = 108/214 (50.47%), Query Frame = -1
Query:    2 KLVSITTD*TPAMLGRYNCFIN--------LCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL-MAKLNSSAAI 616
            KLVS+ +  TPAM+   N  +          C+      +  S  CIIH ++LCA+ + M  +M    K  N I +R L    F   + E D   Y  L  + +++WLSR   L+RF  S++EI  F+ SRG+   QL    W+ DL FL D T  LN LN+ LQG  + + QM   ++AF  KL L    L +NN  +FP L +A  N S  +
Sbjct:  612 KLVSVASTGTPAMVDANNGLVTKLKSRVATFCK----GAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLASRNESDGL 820          

HSP 2 Score: 47.7506 bits (112), Expect = 3.750e-34
Identity = 25/61 (40.98%), Postives = 36/61 (59.02%), Query Frame = -3
Query:  645 AFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFS----SFKTF 815
            A+ + +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IFS    S K F
Sbjct:  546 AYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFSRVEKSLKNF 606          
BLAST of SMED30031700 vs. UniProt/SwissProt
Match: sp|Q6EKJ0|GTD2B_HUMAN (General transcription factor II-I repeat domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1)

HSP 1 Score: 119.013 bits (297), Expect = 4.767e-33
Identity = 72/206 (34.95%), Postives = 105/206 (50.97%), Query Frame = -1
Query:   32 HFFKLVSITTD*TPAMLGRYNCFIN--------LCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL 625
            ++ +LVS+ +  TPAM+   N  +          C+      +  S  CIIH ++LCA+ + M  +M    K  N I +R L    F   + E D   Y  L  + +++WLSR   L+RF  S++EI  F+ SRG+   QL    W+ DL FL D T  LN LN+ LQG  + + QM   ++AF  KL L    L +NN  +FP L
Sbjct:  609 NWSRLVSVASTGTPAMVDANNGLVTKLKSRVATFCK----GAELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQ-YGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL 809          

HSP 2 Score: 45.8246 bits (107), Expect = 4.767e-33
Identity = 21/51 (41.18%), Postives = 32/51 (62.75%), Query Frame = -3
Query:  663 AFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 815
            A+ + +DE TD+ + +QL IFIR +  +F   EELL  +P+ G   G +IF
Sbjct:  546 AYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIF 596          
BLAST of SMED30031700 vs. UniProt/SwissProt
Match: sp|A4Z944|ZBED5_CANLF (Zinc finger BED domain-containing protein 5 OS=Canis lupus familiaris OX=9615 GN=ZBED5 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 9.027e-31
Identity = 66/207 (31.88%), Postives = 112/207 (54.11%), Query Frame = -1
Query:   11 KLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVI--NMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL---MAKLNSS 616
            K V + +D + AM G+    + L +     P+  S HC++++  L  K++  ++ +++    +I N I AR  Q RL K+  EE     +T L ++ +VRWLSR K L R     +E+ VF+ S       L +  WLL L +L D  +KLN++NL +QGK+ T+F +   + +  +KL      +E+ NF+ FP L   + ++NS+
Sbjct:  338 KCVDVCSDASRAMDGKIAEAVTLIKYVA--PESTSSHCLLYRHALAVKIMPTSLKNVLDQAVQIINYIKARPHQSRLLKILCEEMGAQ-HTALLLNTEVRWLSRGKVLVRLFELRRELLVFMDSAFRLSDCLTNSSWLLRLAYLADIFTKLNEVNLSMQGKNVTVFTVFDKMSSLLRKLEFWASSVEEENFDCFPTLSDFLTEINST 541          

HSP 2 Score: 54.6842 bits (130), Expect = 9.027e-31
Identity = 45/152 (29.61%), Postives = 86/152 (56.58%), Query Frame = -3
Query:  621 SKAATIASVRVSRIIAKAKKPFSDG-VIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIPF 1073
            +++AT AS  VS  IA + +  + G ++ K    +    +F +  +K      I+ +QLS ++V RR+ +++ D+++ L   L+ C  F LQ+DES DV  ++ L++F+R  F + + +E+LL    L+    GE+IF+   +F+   +I +
Sbjct:  191 NESATEASYNVSYHIALSGEAHTIGELLIKPCAKDVVMRMFDEQYSKK-----IDAVQLSNSTVARRIKDLAADIEEELVCRLKICDGFSLQLDESADVSGLAVLLVFVRYRF-NKSIEEDLLLCESLQSNATGEEIFNCINSFMQKHEIEW 336          
BLAST of SMED30031700 vs. TrEMBL
Match: A0A3P9AU05 (DUF4371 domain-containing protein OS=Maylandia zebra OX=106582 PE=4 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 5.274e-115
Identity = 129/241 (53.53%), Postives = 164/241 (68.05%), Query Frame = -3
Query:  618 TKKVKTYQYHKEWENDYFFIMVKNKCCCLICNTSLSLPKK-------EMLKDTLEIEYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIPFF 1319
            +KK KTY +H EWE D+FF M  +KC CLIC  ++++PKK         +    +  +   SELRK K+ ELK+ L+ QQS FT+QT K+KAAT AS RVS II K KK F DG + K AF+EAADSLF DF NKAEI S+I  LQLS ++VTRR   ++ DL Q L KD+ DC  F LQ+DESTDV D +Q+ IFIRM+F D   KEELL ++P+K +T GEDIF SFK F+   Q+P +
Sbjct:    8 SKKTKTYHFHTEWEEDFFFTMSFSKCVCLICQAAIAMPKKGNVERHFRTVHGKYDTTFPPKSELRKKKVKELKSQLSGQQSFFTQQTSKAKAATEASFRVSHIIVKNKKSFQDGEMVKEAFVEAADSLFRDFKNKAEITSSIKALQLSRSTVTRRCEAMAEDLTQQLWKDIGDCQCFSLQLDESTDVSDTAQVCIFIRMVFTDITAKEELLTVLPMKEQTRGEDIFQSFKNFIEKTQLPVY 248          

HSP 2 Score: 209.149 bits (531), Expect = 5.274e-115
Identity = 105/161 (65.22%), Postives = 122/161 (75.78%), Query Frame = -1
Query:  140 FKLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGE-EYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGK 619
            +KLVSITTD  PAM+GR N FI  CR DD FPDFL+YHCIIHQQ LCAK++NM +IM    KIA SI ARSLQRRLF+  +E++D D ++EL +H DVRWLSR KFLQRFR    EIK F    G+ EY QL D +WLLDL FLTD T+ LNDLNL+LQGK
Sbjct:  248 YKLVSITTDGAPAMVGRLNGFIAKCRQDDAFPDFLNYHCIIHQQALCAKMLNMKEIMNVATKIACSIRARSLQRRLFRAHLEKADCD-HSELLLHTDVRWLSRGKFLQRFRELCPEIKEFFRVAGQAEYMQLNDGQWLLDLAFLTDLTNMLNDLNLQLQGK 407          
BLAST of SMED30031700 vs. TrEMBL
Match: A0A437AWI7 (DUF4371 domain-containing protein OS=Chilo suppressalis OX=168631 GN=evm_012821 PE=4 SV=1)

HSP 1 Score: 227.254 bits (578), Expect = 1.704e-112
Identity = 126/242 (52.07%), Postives = 164/242 (67.77%), Query Frame = -3
Query:  642 ILENCEIMNTKKVKTYQYHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLKDTL-------EIEYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFL 1346
            IL+ C     KK K Y +H+EWE DYFF MVK  CCCLICNTSL++PKK  L+          + ++  NSE+RK K+  LK+ L  Q+++F+    +SKAAT AS +VS  IA+  KPFSDG   K  F E +DSLF +F NK EI  A++ LQLS N+V RR+  IS +L + L+KD+  C AF LQ DESTDV D +QL++FIRM+F DF+TKEELL +I LKGKT G DIF+ FK ++
Sbjct:   27 ILDKCA---PKKSKAYHFHQEWELDYFFTMVKENCCCLICNTSLAMPKKGNLERHFNTMHSKYQTDFPPNSEIRKSKLQALKSQLKVQENMFSGPIEQSKAATEASFQVSYRIAQKCKPFSDGEYIKEIFEEVSDSLFVNFKNKIEIKKAVHGLQLSRNTVMRRIEIISKNLNEQLQKDITRCVAFSLQFDESTDVTDTAQLLVFIRMVFKDFSTKEELLGMISLKGKTRGLDIFTEFKAYI 265          

HSP 2 Score: 211.075 bits (536), Expect = 1.704e-112
Identity = 111/197 (56.35%), Postives = 140/197 (71.07%), Query Frame = -1
Query:   32 FKLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFK-QKLSLLVDKLEKNNFNYFPNL 619
            +KLVS+TTD  PAM G +N FI LCR D++FPDF+SYHCIIHQQ L +K +N   +M  +FKI NSI  +SLQRRLFK Q++E +     EL MH DVRWLSR KFLQRFR  + EI  FL  RG++ +QL D  W  DL FL DFT KL+ LNL LQGK+KT+ +M+SS+ AF+ Q  S++VD +EK  F  F N+
Sbjct:  273 YKLVSMTTDGAPAMTGIHNGFIALCRKDEDFPDFISYHCIIHQQVLASKRLNTKHVMDISFKIVNSIKGKSLQRRLFKQQLDEKE----PELAMHTDVRWLSRGKFLQRFRDLLDEIIKFLDERGDDCQQLCDLDWQCDLAFLADFTGKLSTLNLNLQGKNKTLTEMMSSIAAFQCQTASMIVD-IEKIKFEQFANI 464          
BLAST of SMED30031700 vs. TrEMBL
Match: A0A1B6LJ79 (Uncharacterized protein OS=Graphocephala atropunctata OX=36148 GN=g.48535 PE=4 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 4.045e-108
Identity = 124/240 (51.67%), Postives = 166/240 (69.17%), Query Frame = -3
Query:  624 NTKKVKTYQYHKEWENDYFFIMVKNKCCCLICNTSLSLPKK-------EMLKDTLEIEYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIP 1322
            ++KK KTY ++ EWE DYFF  VK+KC CLICN S+S+ KK       + +   +E +Y  NS LR+ K+++LK+ L AQQS F K   K+KAAT AS RVS++IA+ +KP+ DG + K AFLEAAD+LF +F NKAEI+SAI  +QLS N+V RRV  +S D+   LK D + CS F LQ DESTD+VD +QL +F+RM+F DF TKEEL+ ++PL G   G D+F +FK  +    IP
Sbjct:    4 SSKKPKTYHFYAEWETDYFFTQVKDKCVCLICNVSVSVGKKGNVERHFKTVHSGIEKDYPLNSTLRREKVLQLKSQLNAQQSTFFKTLDKNKAATEASFRVSKVIAQHRKPYEDGELIKVAFLEAADTLFDNFKNKAEIMSAIKSVQLSANTVMRRVEAMSSDVVSQLKTDFDRCSYFSLQFDESTDIVDTAQLAVFVRMVFEDFETKEELVKVVPLTGHNTGNDVFLAFKKLIESENIP 243          

HSP 2 Score: 186.037 bits (471), Expect = 4.045e-108
Identity = 96/195 (49.23%), Postives = 123/195 (63.08%), Query Frame = -1
Query:   32 KLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL 616
            KLV I TD  PAM+G    FI LCR D + P FLSYHCIIHQQ+L  K ++M ++M T  K+ N I A +LQR LF+   EE D   Y EL +H +VRWLSR + LQRF+  +  +  F   RGE   +LED  WL D  FLTD T KLN LNL+LQGKDK I  ++S V +F +KL L    + +  + +FP+L
Sbjct:  246 KLVGIATDGAPAMVGVEKGFIALCRKDSDIPKFLSYHCIIHQQSLYGKFLSMNNVMKTVVKVVNKIRAHALQRLLFRELTEELDCQ-YGELLLHTEVRWLSRGRVLQRFKDLLPALVKFFKERGEHLTELEDPIWLQDFAFLTDLTEKLNGLNLQLQGKDKNIGGLISDVTSFSKKLELWEKNVIQFEYKHFPSL 439          
BLAST of SMED30031700 vs. TrEMBL
Match: A0A1B6KSV1 (Uncharacterized protein OS=Graphocephala atropunctata OX=36148 GN=g.48534 PE=4 SV=1)

HSP 1 Score: 238.81 bits (608), Expect = 8.909e-108
Identity = 125/240 (52.08%), Postives = 167/240 (69.58%), Query Frame = -3
Query:  624 NTKKVKTYQYHKEWENDYFFIMVKNKCCCLICNTSLSLPKK-------EMLKDTLEIEYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIP 1322
            ++KK KTY ++ EWE DYFF  VK+KC CLICN S+S+ KK       + +   +E +Y  NS LR+ K+++LK+ L AQQS F K   K+KAAT AS RVS++IA+ +KP+ DG + K AFLEAAD+LF +F NKAEI+SAI  +QLS N+V RRV  +S D+   LK D + CS F LQ DESTD+VD +QL +F+RM+F DF TKEEL+ ++PL G T G D+F +FK  +    IP
Sbjct:    4 SSKKPKTYHFYAEWETDYFFTQVKDKCVCLICNVSVSVGKKGNVERHFKTVHSGIEKDYPLNSTLRREKVLQLKSQLNAQQSTFFKTLDKNKAATEASFRVSKVIAQHRKPYEDGELIKVAFLEAADTLFDNFKNKAEIMSAIKSVQLSANTVMRRVEAMSSDVVSQLKTDFDRCSYFSLQFDESTDIVDTAQLAVFVRMVFEDFETKEELVKVVPLTGHTTGNDVFLAFKKVIESENIP 243          

HSP 2 Score: 183.726 bits (465), Expect = 8.909e-108
Identity = 95/195 (48.72%), Postives = 122/195 (62.56%), Query Frame = -1
Query:   32 KLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL 616
            KLV I  D  PAM+G    FI LCR D + P FLSYHCIIHQQ+L  K ++M ++M T  K+ N I A +LQR LF+   EE D   Y EL +H +VRWLSR + LQRF+  +  +  F   RGE   +LED  WL D  FLTD T KLN LNL+LQGKDK I  ++S V +F +KL L    + +  + +FP+L
Sbjct:  246 KLVGIAMDGPPAMVGVEKGFIALCRKDSDIPKFLSYHCIIHQQSLYGKFLSMNNVMKTVVKVVNKIRAHALQRLLFRELTEELDCQ-YGELLLHTEVRWLSRGRVLQRFKDLLPALVKFFKERGEHLTELEDPIWLQDFAFLTDLTEKLNGLNLQLQGKDKNIGGLISDVTSFSKKLELWEKNVIQFEYKHFPSL 439          
BLAST of SMED30031700 vs. TrEMBL
Match: A0A498MQH6 (General transcription factor II-I repeat domain-containing 2A-like protein OS=Labeo rohita OX=84645 GN=ROHU_023746 PE=4 SV=1)

HSP 1 Score: 223.787 bits (569), Expect = 2.608e-107
Identity = 122/200 (61.00%), Postives = 149/200 (74.50%), Query Frame = -1
Query:   20 KLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFL-ISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNLMAKL 616
            KLVSITTD  PAM+GR N FI  CR DD FPDFL+YHCIIHQQ LCAK++NM +IM    KIA SI ARSLQRRLF+  +E +D D ++EL +H DVRWLSR KFLQRFR    EIK FL +++  EY QL D  WLLDL FLTD T+ LNDLNL+LQGKDKT+  M+SSV AFK+K+     KL++++   F NL+++L
Sbjct:  222 KLVSITTDGAPAMVGRSNGFIAKCREDDAFPDFLNYHCIIHQQALCAKMLNMKEIMDVATKIACSIRARSLQRRLFRAHLENADCD-HSELLLHTDVRWLSRGKFLQRFRELCPEIKEFLRVAKHAEYSQLNDNLWLLDLAFLTDLTNMLNDLNLELQGKDKTVTNMISSVNAFKRKMQHFSSKLQRHDLANFQNLVSEL 420          

HSP 2 Score: 197.208 bits (500), Expect = 2.608e-107
Identity = 111/216 (51.39%), Postives = 146/216 (67.59%), Query Frame = -3
Query:  624 NKCCCLICNTSLSLPKK-------EMLKDTLEIEYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIP 1250
            +KC CLIC + +++PKK         +    + ++   SELRK ++ ELK+ L+ QQS F++ T K++AAT AS RVS +I K KK F DG + K AF+EAADSLF DF NK EILS+I  LQLS ++VTRR   ++ DL Q L KD+ DC  F LQ+DESTDV D +QL IFIRM+F D   KEELL ++P+K  T GEDIF SFK F+   ++P
Sbjct:    4 SKCICLICQSVIAIPKKGNVERHFRTVHKNYDTDFPPKSELRKRRVKELKSQLSGQQSFFSQLTSKARAATEASFRVSHLIVKNKKSFQDGEMVKEAFVEAADSLFRDFKNKPEILSSIKALQLSRSTVTRRSEAMAEDLTQQLWKDVTDCECFSLQLDESTDVSDTAQLCIFIRMVFNDMTAKEELLTVLPMKEHTRGEDIFQSFKNFMEKTRLP 219          
BLAST of SMED30031700 vs. Ensembl Cavefish
Match: ENSAMXT00000039226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000099.1:564912:568121:1 gene:ENSAMXG00000042173.1 transcript:ENSAMXT00000039226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.075 bits (536), Expect = 5.807e-96
Identity = 111/203 (54.68%), Postives = 140/203 (68.97%), Query Frame = -1
Query:   14 FFKLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNLMAKLNS 622
            F KLVSIT D  PAM G +  FI LCR D  FP F+SYHC+IHQQ L +KV++ + +MT   KI NSI A++LQ RLFK  ++E D + Y +L +HADVRWLSR K LQRF   + EI  FL SR EEY++L D+ WLLDL FLTD TSKLN+LN +LQGKD  +  MVS+V AFK KL+L   +L+     +F N+   LN+
Sbjct:  240 FQKLVSITRDGAPAMCGIHAGFIALCRKDPIFPAFVSYHCVIHQQALASKVVDFSHVMTVVVKIVNSIRAKALQHRLFKSLLDELDAE-YGDLILHADVRWLSRGKVLQRFINLLPEIISFLKSRKEEYRELADDTWLLDLAFLTDLTSKLNELNCELQGKDCDVPHMVSAVNAFKVKLALWTSQLKCKKLTHFQNVDKMLNN 441          

HSP 2 Score: 161.77 bits (408), Expect = 5.807e-96
Identity = 93/234 (39.74%), Postives = 138/234 (58.97%), Query Frame = -3
Query:  621 KKVKTYQYHKEWENDYFFIMVKNKCCCLICNT-SLSLPKKEMLKDTLEIEYTQNSE-LRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIPF 1316
            KK KTY +H+EWEN++ F  VK+K  CLIC             + +   E  +    + K+++ E    ++  Q     +  K+ A T AS RVS ++AK KK F+DG +FK A L A+DSLF DF NK EI +AI+++ L   +V RRV  +S D+ + +  DL  C  F LQ DES D+ D +QL++F+RM F D + KE+ L ++PL  +T GEDI+ +F+T+     +PF
Sbjct:    9 KKAKTYNFHQEWENEFLFTTVKDKTVCLICQQCDGQCCTTGHQQGSWATEGKKKWHWVPKLQVPESPAVISGNQRHLPLE--KANANTEASFRVSHLLAKHKKTFTDGELFKEAMLFASDSLFRDFKNKDEIRTAISNMSLGPATVVRRVELLSEDISKQVLSDLSRCEYFSLQFDESVDITDTAQLVVFVRMTFSDASVKEDFLTLLPLNERTRGEDIYRAFRTYATENDLPF 240          
BLAST of SMED30031700 vs. Ensembl Cavefish
Match: ENSAMXT00000052542.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000549.1:35642:40620:1 gene:ENSAMXG00000033785.1 transcript:ENSAMXT00000052542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 7.764e-65
Identity = 81/196 (41.33%), Postives = 112/196 (57.14%), Query Frame = -1
Query:   38 KLVSITTD*TPAMLGRYNCFINLCR---VDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFP 616
            KL ++TTD  P+M+G  N FI   +     D   +   YHCIIHQ+ LC K +    IM       N I ARSL  R F+  +E+     Y ++  H +VRWLSR   L+ F     EIK+FL  +G++   +E+  W+ DL FLTD T  LN+LNLKLQGKD+ I  +  +V AF+ KL+L   +L+K N  +FP
Sbjct:  241 KLSAVTTDGAPSMVGETNGFIGHLKRHLGPDQAAELKHYHCIIHQEALCGKHLQFKQIMDFVVSAVNFIRARSLNHREFQSFLEDIS-AAYGDVIYHTEVRWLSRGNVLKIFFALRNEIKLFLEQKGKDTLVMENTDWIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHFP 435          

HSP 2 Score: 123.25 bits (308), Expect = 7.764e-65
Identity = 78/231 (33.77%), Postives = 131/231 (56.71%), Query Frame = -3
Query:  621 QYHKEWENDYFFIMVKNKC-CCLICNTSLSLPKKEMLKDTLEIEYTQNSEL----RKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIPF 1298
            +++ EW + YFF    +    CL+C   +++ K+  L+   E ++ + ++L    RK KI  LK  L +QQ VF K+  +S+A TIAS R++ ++AK+ +PF DG   K+  LEA D +        E   A  ++ LS  ++ RR+ ++S +    L+  + D + F   +DESTD  D +QL IFIR +       +EL A++PL G+T G +IF++FKT +  + +P+
Sbjct:   15 KFNPEWTSKYFFYETSSAVFSCLVCLECVAVAKEYNLRRHYETKHPKLADLQGEDRKQKIEALKKQLVSQQGVFEKRRKESEACTIASYRIANLVAKSARPFIDGEFVKDCMLEACDVICP------EAKDAFKNISLSRTTIQRRIVDLSSNSYCQLQSRINDVTYFSAALDESTDNTDTAQLSIFIRGVTGTCQVYQELAALVPLYGRTTGFEIFNAFKTAVENLNLPW 239          
BLAST of SMED30031700 vs. Ensembl Cavefish
Match: ENSAMXT00000035253.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111191579])

HSP 1 Score: 144.05 bits (362), Expect = 3.335e-61
Identity = 77/198 (38.89%), Postives = 117/198 (59.09%), Query Frame = -1
Query:   38 LVSITTD*TPAMLGRYNCFINLCR-----VDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKE-IKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFP 613
            LV +TTD  PAM G  N  + L +     ++ + P  ++YHCIIHQ+ LC KV+ M +I+TT  K  N I AR L  R F++ ++E D + + ++  H +VRWLSR +F     + ++E I +F+ S+G    +L D KWL D   L D T  L  LN KLQG+ + I QM   + AF++KL L + + +++N  +FP
Sbjct:  240 LVGLTTDGAPAMCGEKNGLVGLMKGKMQKMNCHMP-LITYHCIIHQEALCGKVLGMDNIVTTVMKTVNFIRARGLNHRQFQMFLQEIDSE-HGDVLYHTEVRWLSRSRF-----FELREDIALFMQSKGNPLSELSDPKWLCDFAVLCDITEHLAQLNQKLQGRKQVITQMSDMITAFQRKLDLWMCQAKQDNLAHFP 430          

HSP 2 Score: 112.464 bits (280), Expect = 3.335e-61
Identity = 74/218 (33.94%), Postives = 118/218 (54.13%), Query Frame = -3
Query:  657 YHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLKDTLEIE----YTQNSELRKVKI-MELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSS 1295
            + + WE +Y F++   +  CL+C  ++S+ K+  L+   + +    Y + S   K +I  ELK  L +QQ++FTK T K+ AA  AS  V+  IA+A K FS G   K   L+  + +  D       +    ++ LS N++  RV E++ +L   L ++    +AF L VDESTD  D +QL IFIR +  D +  E+LL +  + G T G+DIF +
Sbjct:   14 FQQRWEGEYMFVLQGERPVCLLCCEAVSVIKEYNLRRHFDTKHGAKYGKASLQEKQQIAQELKDKLKSQQNLFTKATAKNSAAVKASFIVAEEIARASKYFSGGAFLKQCMLKVCEQVCPD------QIQTFKNVSLSRNTIADRVKELAENLATQLAEETRSYTAFSLAVDESTDNTDTAQLAIFIRGVKSDLSVTEDLLDVAAMHGTTTGQDIFDA 225          
BLAST of SMED30031700 vs. Ensembl Cavefish
Match: ENSAMXT00000037725.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29162452:29166863:1 gene:ENSAMXG00000037303.1 transcript:ENSAMXT00000037725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.436 bits (363), Expect = 3.961e-61
Identity = 80/196 (40.82%), Postives = 114/196 (58.16%), Query Frame = -1
Query:   38 KLVSITTD*TPAMLGRYNCFINLCR---VDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFP 616
            KL ++TTD   +++G  N FI   +     D   +   YHCIIHQ+ LC K ++  +IM       N I ARSL+ R F   +E+     Y ++  H +VRWLSR   L+RF     EIK+FL  +G++   +E+  W+ DL FLTD T  LN+LNLKLQGKD+ I  +  +V AF+ KL+L   +L+K N  +FP
Sbjct:  429 KLSAVTTDGALSVVGETNGFIGHLKRHLGPDQAAELKHYHCIIHQEALCGKHLHFKEIMDFVVSAVNFIRARSLKHREFPSFLEDIS-AAYGDVIYHTEVRWLSRGNVLKRFFALRNEIKLFLEQKGKDTLVMENTDWIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHFP 623          

HSP 2 Score: 111.694 bits (278), Expect = 3.961e-61
Identity = 72/210 (34.29%), Postives = 120/210 (57.14%), Query Frame = -3
Query:  621 CLICNTSLSLPKKEMLKDTLEIEYTQNSEL----RKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIPF 1238
            CL+C   +++ K+  L+   E ++ + ++L    RK KI  LK  L +QQ VF K+  +S+A TIAS R++ ++AK+ +PF DG   K+  LEA D +        E   A  ++ LS  ++  R+ ++S +    L+  + D + F   +DESTD  D +QL IFIR +       +EL A++PL G+T G +IF++FKT +  + +P+
Sbjct:  224 CLVCLECVAVAKEYNLRRHYETKHPKLADLQGEDRKQKIEALKKQLVSQQGVFEKRRKESEACTIASYRIANLVAKSARPFIDGEFVKDCMLEACDVICP------EAKDAFKNISLSRTTIQLRIVDLSSNSYCQLQSRINDVTYFSAALDESTDNTDTAQLSIFIRGVTGTCQVYQELAALVPLYGRTTGFEIFNAFKTAVENLNLPW 427          
BLAST of SMED30031700 vs. Ensembl Cavefish
Match: ENSAMXT00000030525.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:12992682:12994541:1 gene:ENSAMXG00000035573.1 transcript:ENSAMXT00000030525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.043 bits (349), Expect = 3.425e-60
Identity = 76/202 (37.62%), Postives = 114/202 (56.44%), Query Frame = -1
Query:   11 KLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNLMAKLNSS 616
            + V ITTD  P+M GR N        +++  + ++ HCIIHQQ LC+K +   ++M+   K  N I +RSL+ R F+  +EE + + Y ++    +VRWLSR   L+RF     E+K F+   G     L D KWL+DL FL D T +LN LN KLQG+ + +     +V+AF  KL L   +L + NF +FP   A +++ 
Sbjct:  296 RFVGITTDGAPSMTGRKNGL-----EEESVEEAIALHCIIHQQALCSKCLKFDNVMSVVVKCINQIRSRSLKHRRFRALLEEMESE-YGDVLYFTEVRWLSRGNILKRFFELRAEVKAFMEKDGVAVTVLSDPKWLMDLAFLVDITHELNVLNKKLQGQGQLVSAAYDNVRAFSAKLMLWKAQLSQTNFCHFPACKALMDAG 491          

HSP 2 Score: 114.005 bits (284), Expect = 3.425e-60
Identity = 72/231 (31.17%), Postives = 122/231 (52.81%), Query Frame = -3
Query:  621 QYHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLKDTLEIEYTQ-----NSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIPF 1298
            Q+ ++WE  +FF+  +    CLIC   +++ K+  LK      + +       + R  ++  LKT L  QQ  F K T ++ AA  AS  VS +IAKA KPF++G   K   L+AA  +        E     +++ LS N+V  R++++S D+   L +  +  S + + +DESTD+ D +QL I++R +  +F   EELL +IP+ G+T  ++IF      +    +P+
Sbjct:   70 QFQEKWEVQFFFVEHRGIPTCLICTEKVAVHKEYNLKRHYTTRHAEEYAKYQGDERANRVANLKTCLLRQQDFFKKATKENDAAVEASYVVSEMIAKAGKPFTEGEFVKKCILQAASIVC------PEKKGQFSNISLSANTVAERISDLSSDIYDQLCEKAKRFSVYSVALDESTDITDTAQLAIYVRGVDDNFEVTEELLTVIPMHGQTTAQEIFHQLCDAIENAGLPW 294          
BLAST of SMED30031700 vs. Ensembl Medaka
Match: ENSORLT00000046355.1 (pep primary_assembly:ASM223467v1:21:4582475:4584322:1 gene:ENSORLG00000025904.1 transcript:ENSORLT00000046355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.519 bits (506), Expect = 3.996e-93
Identity = 96/204 (47.06%), Postives = 136/204 (66.67%), Query Frame = -1
Query:    5 KLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNLMAKLNSSAA 616
            KLV++TTD  PAM+GR   FI  C+ D +FP FL YHCIIHQQ LCAKVI    +MT   KI N+I +++ Q R+FK+ +EE   + Y +L +H ++RWLSR + L RF   ++EIK F+ S+GE+   LED +W LDL FL D T KLN LN +LQGK KT+  M+S++ AFK K++     L++    +FP++ + L  +A+
Sbjct:  244 KLVAVTTDGAPAMVGRQTGFIAHCKRDPDFPKFLHYHCIIHQQALCAKVIGFGHVMTPVVKIINNIRSKAKQHRIFKVLLEEMSAE-YGDLLLHTEIRWLSRGRVLHRFLSLLREIKEFMQSKGEDVSLLEDTEWTLDLAFLVDITGKLNLLNCQLQGKGKTVVDMISALNAFKAKMNAFSADLQRKKVLHFPSVQSVLKDNAS 446          

HSP 2 Score: 163.696 bits (413), Expect = 3.996e-93
Identity = 99/242 (40.91%), Postives = 148/242 (61.16%), Query Frame = -3
Query:  621 MNTKKVKTYQYHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLK-------DTLEIEYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIPF 1325
            M  K+ KTY +H EWE ++FF  VK  C CLIC T+++  K+  ++        +   +Y   S LR  K  ELKT L  QQS FT+ T  S+ A+ AS R +  + K KK F+DG + K A L  A+++F D  N ++++S ++D+QL  +++ RRV+ +S +L   L++DL  C  F LQ DES D    +QL++FIRM+F DF+TKEELL ++PLK  T G DI+++ K F    ++P 
Sbjct:    1 MAEKRKKTYLFHSEWEEEFFFTTVKETCVCLICGTTVATAKRHNVERHFNTCHKSYHDKYPPASALRAEKARELKTALGKQQSFFTRPTKNSQKASEASFRATHFLIKKKKAFTDGEVVKEAMLLIANTVFKDEKNGSDLISTLSDVQLGASTMARRVSAMSSNLVDQLEQDLAKCKWFSLQCDESVDSSSTAQLLVFIRMVFNDFSTKEELLTLLPLKTTTRGVDIYNTVKEFFVQKKVPL 242          
BLAST of SMED30031700 vs. Ensembl Medaka
Match: ENSORLT00000033470.1 (pep primary_assembly:ASM223467v1:22:24335229:24337076:1 gene:ENSORLG00000028972.1 transcript:ENSORLT00000033470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 207.223 bits (526), Expect = 1.736e-91
Identity = 103/209 (49.28%), Postives = 141/209 (67.46%), Query Frame = -1
Query:    2 KLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNLMAKLN----SSAAI 616
            KLVS+TTD  PAM GR+  FI  C+ D +FP FL YHCIIHQQ +CAKV     +MT   KI NSI +++ Q R+FK+ ++E   + Y +L +H ++RWLSR + LQRF   + EIK F+ S+GE+   LED +W+LDL FLTD T  LN LN +LQGKDKT+   +S+V AF+ KLS+   +L+K    +FP++ A LN    +SAA+
Sbjct:  244 KLVSVTTDGAPAMTGRHVGFIAQCKNDPDFPKFLHYHCIIHQQAICAKVTGFDHVMTPVVKIINSIRSKAKQHRMFKMLMDELSAE-YGDLLLHTEIRWLSRGRILQRFLSLLGEIKEFMKSKGEDTSLLEDPEWVLDLAFLTDLTGNLNHLNRELQGKDKTVAHTISAVNAFRAKLSIFSTQLQKKKMLHFPSVQAALNDNVSASAAL 451          

HSP 2 Score: 150.214 bits (378), Expect = 1.736e-91
Identity = 90/241 (37.34%), Postives = 140/241 (58.09%), Query Frame = -3
Query:  624 MNTKKVKTYQYHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLK-------DTLEIEYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIP 1325
            M  K+ + Y +  +WE ++F     +KC CLIC T++++P +  ++          +  Y   S LR  K   LK  L  Q++ FT+   KS  AT AS R +  + K KKPFSDG + K A +  A+++F D     +++S ++D+QL  +++ RRV  +S +L + L +DL  C  F +Q DES D    +QL+IFIRM+F DF+TKEELL ++PLK  T G DI+++ K F    ++P
Sbjct:    1 MTEKRKRVYHFQDDWEVEFFSTSFNDKCLCLICGTAIAVPMRHNVERHFKTCHKNFDANYPPGSALRTEKARGLKAALDMQRTFFTRPAKKSHNATEASFRAAHFLIKNKKPFSDGEVLKEAMMLVANTIFKDEKYAPDVISTLSDVQLGASTIARRVTSLSENLTEKLDRDLAACRWFSVQCDESVDSASTAQLMIFIRMVFEDFSTKEELLTLLPLKTTTRGVDIYTTVKNFFVEKKVP 241          
BLAST of SMED30031700 vs. Ensembl Medaka
Match: ENSORLT00000028655.1 (pep primary_assembly:ASM223467v1:8:18412528:18414615:1 gene:ENSORLG00000023148.1 transcript:ENSORLT00000028655.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 150.214 bits (378), Expect = 7.510e-66
Identity = 81/199 (40.70%), Postives = 122/199 (61.31%), Query Frame = -1
Query:   35 KLVSITTD*TPAMLGRYNCFI----NLCRVDDNFPDFLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKE-IKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPN 616
            KLV +TTD  PAM G  +  +       R ++   +  +YHCIIHQ++LC K + M  +M+T  +  N I AR L  R FK  + E D + Y EL  H +VRWLS+ K LQR  + ++E I +F++++G++  +L DE +L ++ FL D TS LN +NL+LQG+ + I  M S+V+ FK KLSL    + K N ++FP+
Sbjct:  248 KLVGLTTDGAPAMCGHRSGLVARMRERMREENVTGELTAYHCIIHQESLCGKALKMEHVMSTITRAVNLIRARGLNHRQFKAFLGELDTE-YGELPYHTEVRWLSQGKVLQRC-FELREGICLFIVNKGKDTTELRDETFLCEMAFLCDITSHLNVMNLQLQGRGRVISDMYSTVQVFKTKLSLWETHMRKENLSHFPS 444          

HSP 2 Score: 121.709 bits (304), Expect = 7.510e-66
Identity = 80/214 (37.38%), Postives = 122/214 (57.01%), Query Frame = -3
Query:  663 WENDYFFIMVKNKCCCLICNTSLSLPKKEMLKDTLEI-------EYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIF 1283
            WE +Y F  V  K  CL+C   LS+ K+  L+   E        +   ++E R  K+ ELK GL +QQ++FT    +S AA  AS  V+  + K+ +PF++G   KN  L+  D++  D   K ++ S ++   LS N+V  R++++S +LK+ L    +D  A+ L VDESTD  DI+QL IFIR +    +  EELLA+ PL G T G+D++
Sbjct:   24 WEAEYMFTEVHGKPVCLLCGERLSVMKEYNLRRHHETSKKHTDKDKNMDTEQRLQKVEELKRGLKSQQALFTIAKSQSGAAVKASFIVAEEVEKSARPFTEGEFIKNCMLKVCDAVCPD---KRQLFSNVS---LSRNTVAERIDQLSTNLKEQLVGKGKDFIAYSLAVDESTDTSDIAQLSIFIRGVDSSLSITEELLALRPLHGTTTGQDLY 231          
BLAST of SMED30031700 vs. Ensembl Medaka
Match: ENSORLT00000035623.1 (pep primary_assembly:ASM223467v1:9:5067000:5069708:1 gene:ENSORLG00000026230.1 transcript:ENSORLT00000035623.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.976 bits (367), Expect = 1.358e-60
Identity = 77/197 (39.09%), Postives = 115/197 (58.38%), Query Frame = -1
Query:   32 KLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVIN--MADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL 616
            KLVS+ TD  P M+G+   F+ L R  +     LS+HCI+HQ+ LCA++    + ++M+   ++ N I AR+L  R FK  +EE   + Y  L +H++VRWLSR K L RF   + EI+ FL  +  E+ +L D +WLL   +L D T  LN LN+K+QG   TIF +  +V AF+ +L L +  +E     +F  L
Sbjct:  270 KLVSVCTDGAPCMVGKNRGFVALLREHEK-RRILSFHCILHQEALCAQMCGEQLGEVMSLVVRVVNFIVARALNDRQFKALLEEVG-NSYPGLLLHSNVRWLSRGKVLSRFAACLSEIRTFLERKNVEHPELADTEWLLKFYYLVDMTGHLNHLNVKMQGVGNTIFSLQQAVFAFENRLELFIADIETGRLLHFEKL 464          

HSP 2 Score: 108.227 bits (269), Expect = 1.358e-60
Identity = 79/254 (31.10%), Postives = 132/254 (51.97%), Query Frame = -3
Query:  624 LKNILENCEIMNTKKVKTYQ-YHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLKDTLEIEYT------QNSELRKVKIMELKTGLAAQQS---VFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIP 1355
             +N+L   ++   KKV  Y+ + ++W +++ F+       CLIC+  ++  K+  +K   +  +          + RK    EL + + A Q    V+T+Q   + A+  A++     I K  KPF+DG   K+  L+ A+ L+++FS+K +I+  I D+ LS  +V  R   +S  ++    KDL     F L +DESTDV ++SQ  +  R +  D   +EE LA++PLKG T GED+F SF  F     +P
Sbjct:   20 FRNLLR-LKMAKRKKVDEYRTFQQDWTDEFAFVERAGSAMCLICSDKIASMKRSNIKRHFDTRHAAFASKYPAGDSRKKACQELLSRVEASQQQLRVWTQQGDGNSASFAAAL----AIVKNGKPFTDGEFAKSFMLDVANELYANFSDKDKIIKQIKDMPLSARTVHDRTIMMSNQIEATQVKDLNAAQFFSLALDESTDVSNLSQFSVIARYVAGD-TIREESLAVLPLKGTTRGEDLFKSFNEFAKEKNLP 267          
BLAST of SMED30031700 vs. Ensembl Medaka
Match: ENSORLT00000027991.1 (pep primary_assembly:ASM223467v1:15:8817619:8823815:1 gene:ENSORLG00000022420.1 transcript:ENSORLT00000027991.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 146.362 bits (368), Expect = 1.801e-60
Identity = 77/197 (39.09%), Postives = 115/197 (58.38%), Query Frame = -1
Query:   32 KLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVIN--MADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNL 616
            KLVS+ TD  P M+G+   F+ L R  +     LS+HCI+HQ+ LCA++    + ++M+   ++ N I AR+L  R FK  +EE   + Y  L +H++VRWLSR K L RF   + EI+ FL  +  E+ +L D +WLL   +L D T  LN LN+K+QG   TIF +  +V AF+ +L L +  +E     +F  L
Sbjct:  243 KLVSVCTDGAPCMVGKNRGFVALLREHEK-RRILSFHCILHQEALCAQMCGEQLGEVMSLVVRVVNFIVARALNDRQFKALLEEVG-NSYPGLLLHSNVRWLSRGKVLSRFAACLSEIRTFLERKNVEHPELADTEWLLKFYYLVDMTGHLNHLNVKMQGVGNTIFSLQQAVFAFENRLELFIADIETGRLLHFEKL 437          

HSP 2 Score: 107.842 bits (268), Expect = 1.801e-60
Identity = 77/241 (31.95%), Postives = 126/241 (52.28%), Query Frame = -3
Query:  624 KKVKTYQ-YHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLKDTLEIEYT------QNSELRKVKIMELKTGLAAQQS---VFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIP 1316
            KKV  Y+ + ++W +++ F+       CLIC+  ++  K+  +K   +  +          + RK    EL + + A Q    V+T+Q   + A+  A++     I K  KPF+DG   K+  L+ A+ L+++FS+K +I+  I D+ LS  +V  R   +S  ++    KDL     F L +DESTDV ++SQ  +  R +  D   +EE LA++PLKG T GED+F SF  F     +P
Sbjct:    5 KKVDEYRTFQQDWTDEFAFVERAGSAMCLICSDKIASMKRSNIKRHFDTRHAAFASKYPAGDSRKKACQELLSRVEASQQQLRVWTQQGDGNSASFAAAL----AIVKNGKPFTDGEFAKSFMLDVANELYANFSDKDKIIKQIKDMPLSARTVHDRTIMMSNQIEATQVKDLNAAQFFSLALDESTDVSNLSQFSVIARYVAGD-TIREESLAVLPLKGTTRGEDLFKSFNEFAKEKNLP 240          
BLAST of SMED30031700 vs. Planmine SMEST
Match: SMESG000037770.1 (SMESG000037770.1)

HSP 1 Score: 112.079 bits (279), Expect = 1.674e-45
Identity = 83/249 (33.33%), Postives = 129/249 (51.81%), Query Frame = -3
Query:  621 NILENCEIMNTKKVKTYQYHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLKDTLEIEYTQ------NSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIPF 1349
            NI E C   N          K+W + YFF+ +K    CLIC  S+++ K+  LK   + ++         +ELR+ K  +L   L  +Q++F K +   +AAT AS+ ++  I K  KPFS+G   K+  LE AD +  +   K E      ++ LS  +V RR+  I+ DL   L   ++    F + +DESTD+ D +QL+IFIR I   F   EELL++  LK  T G+D+F +    L+  ++P 
Sbjct:  528 NIEEECRTFN----------KDWTSKYFFVDIKTNAVCLICRESVAVFKEYNLKRHFQTKHGNFGINLNETELRR-KADDLVRSLKQEQTIFLKPSSIQEAATKASLVIAHKIVKHNKPFSEGEFVKDCVLEIADIICPENKKKFE------NISLSRRTVVRRIESIAEDLSDQLLNKIKTFQWFSIALDESTDIQDTAQLLIFIRGIDDKFIATEELLSMEHLKDTTTGQDLFDNLIKALDKFELPL 759          

HSP 2 Score: 91.2781 bits (225), Expect = 1.674e-45
Identity = 68/198 (34.34%), Postives = 102/198 (51.52%), Query Frame = -1
Query:   44 KLVSITTD*TPAMLGRYNCFINLCR--VDDNFPD--FLSYHCIIHQQTLCAKVINMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRG---EEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNY 616
            KL S+TTD  P++ G+    I   +  V +  PD   +  HCIIHQ++LC  V++   ++T             LQ + F L+  ESDH   +++  H +VRWLS  K L+R      EI +FL  +    E   Q++  +WL D  F  D   KLN+LN+KLQGK     ++ + VK+F+ KL L    L++    Y
Sbjct:  761 KLASVTTDGAPSLTGKNVGLITKIKDHVKNLHPDHTIIPLHCIIHQESLCKSVLDFNTLLTL------------LQFKSF-LEDLESDH---SDVLYHTNVRWLSLGKVLKRVWNLKDEIVLFLEMKDITVEFTTQMKTSEWLSDFSFAVDILDKLNELNVKLQGKGVFAHELFAEVKSFQVKLQLFSRHLKEQKDRY 942          
BLAST of SMED30031700 vs. Planmine SMEST
Match: SMESG000045419.1 (SMESG000045419.1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.586e-38
Identity = 73/230 (31.74%), Postives = 107/230 (46.52%), Query Frame = -3
Query:  621 YHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLKDTLEIEYTQN-----SELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATKEELLAIIPLKGKTCGEDIFSSFKTFLNIVQIPF 1295
            +++EW + YFF     K  CLI N S+++ K+  +K   E E+ +       E+RK K   LK  L AQQS+F K                       +PF+D    K   +  A+ L        E  +   D+ LS  +  RRV EI  +L + LK   +    + L +DES D+ D +QLIIFIR I  DF   EEL ++  LK    G D+F   K  LN +++ +
Sbjct:   15 FNEEWNSKYFFTENGGKPLCLIFNKSVAVMKEYNVKRHYEKEHERQYKDLTGEIRKNKFRTLKASLTAQQSIFMK-----------------------RPFTDLEFVKRCLVAVAEKLC------PETKTLFQDISLSARTCARRVEEIGTNLFEQLKCKAKSFDCYSLAMDESIDITDTAQLIIFIRGIDGDFNVHEELTSLCSLKDAITGNDLFIKVKETLNSLELRW 215          

HSP 2 Score: 87.8113 bits (216), Expect = 1.586e-38
Identity = 63/196 (32.14%), Postives = 96/196 (48.98%), Query Frame = -1
Query:   41 KLVSITTD*TPAMLGRYNCFIN-LCRVDDNFP--DFLSYHCIIHQQTLCAKVIN-MADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYF 616
            KL  +TTD    M G     +  +C    N    + + +HCIIHQ++LC  +++ M DIM T     N I    L+ R FK  ++E D + + ++  ++ VRWLSR   L+R        K +L + G              L F+ D T+ LN+LNL LQGK K +  +   + AF+ KL LL   + + N  +F
Sbjct:  217 KLKCVTTDGGRNMCGSKTGVVGRICAELQNIACDNPMVFHCIIHQESLCCTILSSMKDIMNTLISTVNYIRRHGLKHRQFKKFLKEIDSE-FNDVIYYSAVRWLSRGAVLRR--------KYYLTAIG-------------SLAFMVDITTYLNELNLNLQGKGKLLADLFCDINAFEAKLCLLKKHMIEENLTHF 390          
BLAST of SMED30031700 vs. Planmine SMEST
Match: SMESG000020950.1 (SMESG000020950.1)

HSP 1 Score: 139.813 bits (351), Expect = 1.868e-38
Identity = 71/83 (85.54%), Postives = 74/83 (89.16%), Query Frame = -1
Query:    2 RGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYFPNLMAKLNSSAAI 250
            R EE KQLEDEKWL+DL FLTDF SKLNDLNL+LQGKDKTIFQMVSSVKAFKQKLSLLV KLEKNN NYFPNLM +LNS  AI
Sbjct:   43 RWEENKQLEDEKWLVDLAFLTDFRSKLNDLNLELQGKDKTIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLMTQLNSLVAI 125          
BLAST of SMED30031700 vs. Planmine SMEST
Match: SMESG000060595.1 (SMESG000060595.1)

HSP 1 Score: 127.487 bits (319), Expect = 5.801e-34
Identity = 75/142 (52.82%), Postives = 95/142 (66.90%), Query Frame = -3
Query:  720 KVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIAKAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*NSVTRRVNEISXXXXXXXXXXXXDCSAFFLQVDESTDVVDISQLIIFIRMIFIDFATK 1145
            K KI +LK  L  +Q+VFT+    SK ATIAS ++S ++AK KKPF DG +FK  FL   D LF  FSNK EI+SAI DLQLS N+VT R++ IS D++  LK DLE C  F+LQ DESTD+ D  QL + + M+F  F  K
Sbjct:    7 KEKICKLKASLTVKQTVFTRHVEYSKKATIASFKISHMLAKKKKPFIDGELFKELFLTGVDCLFDRFSNKHEIVSAIQDLQLSNNTVTIRIHAISTDIQTQLKTDLEICDWFWLQFDESTDISDTEQLEVMMIMVFSQFTVK 148          
BLAST of SMED30031700 vs. Planmine SMEST
Match: SMESG000011571.1 (SMESG000011571.1)

HSP 1 Score: 118.242 bits (295), Expect = 2.114e-30
Identity = 68/167 (40.72%), Postives = 96/167 (57.49%), Query Frame = -1
Query:  122 KLVSITTD*TPAMLGRYNCFINLCRVDDNFPDFLSYHCIIHQQTLCAKVI--NMADIMTTTFKIANSI*ARSLQRRLFKLQVEESDHDGYTELFMHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFLTDFTSKLNDLNLKLQGKDKTIFQ 616
            K+VSI+TD   +M G    F+ + +   N   F +YHCIIHQ+ LC +     ++ +M     I NSI  + L  R FK  + E + + Y  L +H  VRWLSRR  L+ F   + EI+VFL+ +G  Y +L + +W+    F+ D TS LN LNLKLQGK  TIF+
Sbjct:   10 KIVSISTDVAKSMSGFRKWFVAILKERINHEIF-AYHCIIHQEALCEQTFPEEISKVMRLMITIINSIVVKGLNHRQFKEFLVEMESE-YANLLLHNKVRWLSRRNVLKLFSSLLPEIEVFLLEKGVHYPELTNNQWIQYCHFVVDVTSHLNQLNLKLQGKGNTIFR 174          
The following BLAST results are available for this feature:
BLAST of SMED30031700 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GTF2IRD28.515e-3535.51GTF2I repeat domain containing 2 [Source:HGNC Symb... [more]
GTF2IRD21.212e-3435.51GTF2I repeat domain containing 2 [Source:HGNC Symb... [more]
GTF2IRD2B1.082e-3334.95GTF2I repeat domain containing 2B [Source:HGNC Sym... [more]
GTF2IRD2B1.395e-3336.14GTF2I repeat domain containing 2B [Source:HGNC Sym... [more]
ZBED58.397e-3131.40zinc finger BED-type containing 5 [Source:HGNC Sym... [more]
back to top
BLAST of SMED30031700 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031700 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031700 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
AL928808.11.039e-6840.49pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
CR392001.32.475e-5136.36pep chromosome:GRCz11:8:38963323:38965260:-1 gene:... [more]
back to top
BLAST of SMED30031700 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
spag12.603e-5540.30sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000016563.12.781e-5540.30pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
ENSXETT00000028445.16.479e-2629.60general transcription factor II-I repeat domain-co... [more]
ENSXETT00000010836.11.310e-1737.96pep primary_assembly:Xenopus_tropicalis_v9.1:7:638... [more]
back to top
BLAST of SMED30031700 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gtf2ird22.007e-4135.61GTF2I repeat domain containing 2 [Source:MGI Symbo... [more]
Zbed51.384e-2733.18zinc finger, BED type containing 5 [Source:MGI Sym... [more]
Zmym61.278e-1428.99zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zmym61.326e-1428.99zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Epm2aip11.023e-926.02EPM2A (laforin) interacting protein 1 [Source:MGI ... [more]
back to top
BLAST of SMED30031700 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4IFA3|GT2D2_BOVIN1.161e-4035.41General transcription factor II-I repeat domain-co... [more]
sp|Q99NI3|GT2D2_MOUSE1.220e-4035.61General transcription factor II-I repeat domain-co... [more]
sp|Q86UP8|GTD2A_HUMAN3.750e-3435.51General transcription factor II-I repeat domain-co... [more]
sp|Q6EKJ0|GTD2B_HUMAN4.767e-3334.95General transcription factor II-I repeat domain-co... [more]
sp|A4Z944|ZBED5_CANLF9.027e-3131.88Zinc finger BED domain-containing protein 5 OS=Can... [more]
back to top
BLAST of SMED30031700 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P9AU055.274e-11553.53DUF4371 domain-containing protein OS=Maylandia zeb... [more]
A0A437AWI71.704e-11252.07DUF4371 domain-containing protein OS=Chilo suppres... [more]
A0A1B6LJ794.045e-10851.67Uncharacterized protein OS=Graphocephala atropunct... [more]
A0A1B6KSV18.909e-10852.08Uncharacterized protein OS=Graphocephala atropunct... [more]
A0A498MQH62.608e-10761.00General transcription factor II-I repeat domain-co... [more]
back to top
BLAST of SMED30031700 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039226.15.807e-9654.68pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000052542.17.764e-6541.33pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000035253.13.335e-6138.89general transcription factor II-I repeat domain-co... [more]
ENSAMXT00000037725.13.961e-6140.82pep primary_assembly:Astyanax_mexicanus-2.0:14:291... [more]
ENSAMXT00000030525.13.425e-6037.62pep primary_assembly:Astyanax_mexicanus-2.0:1:1299... [more]
back to top
BLAST of SMED30031700 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031700 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031700 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031700 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000046355.13.996e-9347.06pep primary_assembly:ASM223467v1:21:4582475:458432... [more]
ENSORLT00000033470.11.736e-9149.28pep primary_assembly:ASM223467v1:22:24335229:24337... [more]
ENSORLT00000028655.17.510e-6640.70pep primary_assembly:ASM223467v1:8:18412528:184146... [more]
ENSORLT00000035623.11.358e-6039.09pep primary_assembly:ASM223467v1:9:5067000:5069708... [more]
ENSORLT00000027991.11.801e-6039.09pep primary_assembly:ASM223467v1:15:8817619:882381... [more]
back to top
BLAST of SMED30031700 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037770.11.674e-4533.33SMESG000037770.1[more]
SMESG000045419.11.586e-3831.74SMESG000045419.1[more]
SMESG000020950.11.868e-3885.54SMESG000020950.1[more]
SMESG000060595.15.801e-3452.82SMESG000060595.1[more]
SMESG000011571.12.114e-3040.72SMESG000011571.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031700 ID=SMED30031700|Name=SMED30031700|organism=Schmidtea mediterranea sexual|type=transcript|length=2314bp
TTATAGCAGCAGAACTGTTTAGTTTTGCCATCAAATTGGGAAAATAATTA
AAGTTGTTTTTTTCAAGCTTATCCACTAAGAGGCTGAGCTTCTGTTTAAA
GGCTTTTACGGAACTCACCATTTGAAATATTGTTTTATCCTTGCCTTGCA
ATTTAAGGTTTAGATCGTTTAGTTTGGATGTGAAGTCTGTCAAAAATACT
AGATCTAATAGCCATTTTTCATCCTCCAATTGTTTGTATTCTTCCCCTCT
AGAAATTAAAAAAACCTTAATTTCTTTTATCGAGTATCTGAATCGTTGAA
GAAATTTTCTCCTGCTTAACCACCTGACATCTGCGTGCATAAATAGTTCG
GTATACCCATCATGATCACTTTCTTCGACTTGTAATTTAAAAAGTCTCCT
TTGTAAACTTCTTGCTCAAATTGAGTTTGCAATTTTAAAGGTTGTGGTCA
TAATATCAGCCATATTAATAACTTTAGCACACAAGGTTTGTTGATGAATG
ATGCAATGGTATGACAGAAAATCGGGAAAATTATCATCAACTCGACAAAG
ATTAATAAAACAGTTATACCGGCCTAACATTGCAGGTGTTCAATCTGTGG
TTATTGATACTAATTTAAAAAAATGGGATTTGAACGATATTCAAGAATGT
CTTAAAACTGGAAAATATATCCTCTCCGCAGGTTTTTCCTTTGAGAGGTA
TAATTGCTAATAATTCCTCTTTGGTTGCAAAATCTATGAAAATCATTCTA
ATGAATATGATTAGCTGTGATATGTCAACTACATCAGTAGATTCATCTAC
TTGTAAAAAAAAAGCTGAACAGTCTTCAAGATCTTTTTTTAACAGTTGTT
TTAAATCTAAGCTAATTTCATTTACTCTCCGTGTAACACTATTTCACGAT
AACTGTAAATCATTAATAGCAGAAAGAATTTCCGCTTTATTACTAAAATC
ACTAAACAAAGAATCAGCAGCCTCAAGAAATGCGTTTTTAAAAATTACAC
CATCACTAAAAGGTTTTTTGGCTTTGGCTATAATTCTACTTACTCGAACA
GATGCAATGGTAGCTGCTTTTGATTTTAATGTTTGTTTTGTAAAAACTGA
CTGCTGGGCTGCAAGACCTGTTTTTAATTCCATAATCTTTACTTTCCGCA
ACTCACTGTTTTGTGTGTATTCAATTTCTAAAGTGTCTTTCAACATTTCC
TTTTTTGGAAGAGATAGACTAGTGTTGCAAATTAAGCAACAACACTTGTT
TTTAACCATTATGAAGAAATAATCATTTTCCCACTCTTTATGATATTGAT
ACGTTTTAACTTTTTTTGTATTCATTATTTCACAGTTTTCTAAAATATTT
TTTAAAATGATGCAATTTAATTTTTAATAAAATATTCAAAAATTTGTTTA
ATCAACTTATTAATAACCTTAATAATTTTAAATCCATTGAAGATAACAAA
GTATAAATGAAAAAAAAAATTAAACTGCTGTTAATTTTTGCAGCCTTCAC
TCAAAAAACTAGCAAACTATAAATAATAAATAACTTTACCTTAACGGACG
ATGTATTTATTAATTAATAACAAAAATTCCAATTGCAGAACTTATTTAAA
ATGCAAAATAAAAATATTTCATATCCAAAAATAGTATTGTTCAGCTGATT
CAAACAGTATACTTGAATTTTTATATAGTTCTTAGCAAAACAAAAATATT
TTCGACACAGTGATTTTAAAATATAGTTTGAAAATACAAAATAAAAAAAA
TATCAATTTTAAAGGTGCATAGCTGTAAAATGAAATTCCCGTAAAATAGA
ATTCCCGTAAAATAGAATTCTTTTAAAATGGAATTCTTATAAAATTGATT
AGATAGTTGATTTTGTTATCTACTAATCAATTAAGTAACGATTTTATCTA
TAGTCAAAACTTAAAAACTCATAAGTTTTTAAAAAATTAATTTGACATAA
GTTTATAAAAAAAAAGAAAACACTTGTGACAATTGTCAATGATTATAGGT
TTTAAAAAATTTGACAAGGCAGCGATCAAAACGAATGTTAGATATGCATA
TTTTTAGCGTGGAACGTCACATGTATTTGGAGGAAGCAGATTGTTGAAAC
GAGTACATCATTGATAGAAAATCAACATTATGAAATAATTTAATACTATC
CTACAACATGAAATATCTCGGGATCTGTTTGTGTCAGCCACAGCGTCGCA
CAGATTTCCATGAAGATTTTTGTTAATATTTTTGTCATAAGACCTTAAAA
AATTGTTTTTCTATATACAATTCCATATTCGTTGGCGATCGACTTTAAAT
AATTAGGCGATCGA
back to top

protein sequence of SMED30031700-orf-1

>SMED30031700-orf-1 ID=SMED30031700-orf-1|Name=SMED30031700-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=113bp
MHADVRWLSRRKFLQRFRYSIKEIKVFLISRGEEYKQLEDEKWLLDLVFL
TDFTSKLNDLNLKLQGKDKTIFQMVSSVKAFKQKLSLLVDKLEKNNFNYF
PNLMAKLNSSAAI
back to top

protein sequence of SMED30031700-orf-2

>SMED30031700-orf-2 ID=SMED30031700-orf-2|Name=SMED30031700-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=144bp
MNTKKVKTYQYHKEWENDYFFIMVKNKCCCLICNTSLSLPKKEMLKDTLE
IEYTQNSELRKVKIMELKTGLAAQQSVFTKQTLKSKAATIASVRVSRIIA
KAKKPFSDGVIFKNAFLEAADSLFSDFSNKAEILSAINDLQLS*
back to top