TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30031687
Length (bp)1602
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30031687) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30031687) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30031687) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30031687) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031687

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30031687SMESG000014702.1 SMESG000014698.1 Contig7252uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30031687SMESG000014702.1 SMESG000014698.1 Contig7252newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30031687SMESG000014698.1 PL020001000H01ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30031687SMESG000014725.1 SMESG000014724.1 SMESG000014706.1 SMESG000014702.1 SMESG000014700.1 dd_Smed_v4_4420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031687SMESG000014725.1 SMESG000014724.1 SMESG000014706.1 SMESG000014702.1 SMESG000014700.1 dd_Smed_v4_4420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031687SMESG000014725.1 SMESG000014724.1 SMESG000014706.1 SMESG000014702.1 SMESG000014700.1 dd_Smed_v4_4420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031687SMESG000014725.1 SMESG000014724.1 SMESG000014706.1 SMESG000014702.1 SMESG000014700.1 dd_Smed_v4_4420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031687SMESG000014725.1 SMESG000014724.1 SMESG000014706.1 SMESG000014702.1 SMESG000014700.1 dd_Smed_v4_4420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30031687SMESG000014725.1 SMESG000014724.1 SMESG000014706.1 SMESG000014702.1 SMESG000014700.1 dd_Smed_v4_4420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30031687SMESG000014725.1 SMESG000014724.1 SMESG000014706.1 SMESG000014702.1 SMESG000014700.1 dd_Smed_v4_4420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30031687SMESG000014725.1 SMESG000014724.1 SMESG000014706.1 SMESG000014702.1 SMESG000014700.1 dd_Smed_v4_4420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30031687SMESG000014725.1 SMESG000014724.1 SMESG000014706.1 SMESG000014702.1 SMESG000014700.1 dd_Smed_v4_4420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031687SMESG000014725.1 SMESG000014724.1 SMESG000014706.1 SMESG000014702.1 SMESG000014700.1 dd_Smed_v4_4420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031687SMESG000014725.1 SMESG000014724.1 SMESG000014706.1 SMESG000014702.1 SMESG000014700.1 dd_Smed_v4_4420_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 113.235 bits (282), Expect = 4.541e-26
Identity = 116/470 (24.68%), Postives = 191/470 (40.64%), Query Frame = 2
Query:  206 PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKL----LVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLE--QSKFMKEIKAMKVHASSLDTEIVRLKQERTH------GQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYK--MSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            PL     C IC   +  A   PCG R+C  CI + +       CP  N+      I  +  +  D      I  L VKCP E C    EL  +E+H   C+   + CP      C+   ++  +N H+LKD  P  ++        +    KEI + N  +     E    I   E++  ++ L+   +           H       + R  QE T        Q +  L+++       E  V N  E       T+ QL   L     ++ +L  +M+  +  +SELK  +    +T E    +I+  Q       N  +IWK+ +F   L+  E     +I S  F+  + GYK  M L+       +   +  L+ + ++G YD  L WP Q  + L I++Q     + +   + +  P   A+++P   RN  G G+  F+ L+  L+Q   IK+D L ++C V
Sbjct:   63 PLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHK-CPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQ-----CQRPFQKFHINIHILKDC-PRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISE--VRNFQE-------TIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTI----RTLEDKVAEIEAQQ------CNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE-ALRQRTFIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 113.235 bits (282), Expect = 4.541e-26
Identity = 116/470 (24.68%), Postives = 191/470 (40.64%), Query Frame = 2
Query:  206 PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKL----LVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLE--QSKFMKEIKAMKVHASSLDTEIVRLKQERTH------GQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYK--MSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            PL     C IC   +  A   PCG R+C  CI + +       CP  N+      I  +  +  D      I  L VKCP E C    EL  +E+H   C+   + CP      C+   ++  +N H+LKD  P  ++        +    KEI + N  +     E    I   E++  ++ L+   +           H       + R  QE T        Q +  L+++       E  V N  E       T+ QL   L     ++ +L  +M+  +  +SELK  +    +T E    +I+  Q       N  +IWK+ +F   L+  E     +I S  F+  + GYK  M L+       +   +  L+ + ++G YD  L WP Q  + L I++Q     + +   + +  P   A+++P   RN  G G+  F+ L+  L+Q   IK+D L ++C V
Sbjct:   63 PLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHK-CPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQ-----CQRPFQKFHINIHILKDC-PRRQVSCDNCAASMAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISE--VRNFQE-------TIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTI----RTLEDKVAEIEAQQ------CNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE-ALRQRTFIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 110.538 bits (275), Expect = 4.825e-25
Identity = 98/371 (26.42%), Postives = 173/371 (46.63%), Query Frame = 2
Query:  482 MEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKE---IKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNS---LNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLL-KQSQIIKNDQLFIKCFV 1570
            ++EHL  C      CP+   GC   + R+N + +H       H +L++E    L ++I +L+  + + +++   L E+++K++K FK     F K    +  ++V AS +D      K      Q  + L ++  +Q K +  +  L EA  T+   +  L N+   L +L+EE +  D  ++     +S+ +E    +  T                   N + IWK+ D+        +  T  IFS SF+ S  GY++   A  NG G  +G    LYF ++RG +D +L WP +  VTL +++Q  K + +     ++  PN  ++++P  E N  +G P FV    L   ++  IK+D LF+K  V
Sbjct:  208 VDEHLAVCPEAEQDCPFKHYGCAVTDKRRN-LQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHID------KSAWLEAQVHQLLQMVNQQQNKFD--LRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTC-----------------YNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMET---FKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAV 549          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 110.538 bits (275), Expect = 4.825e-25
Identity = 98/371 (26.42%), Postives = 173/371 (46.63%), Query Frame = 2
Query:  482 MEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKE---IKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNS---LNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLL-KQSQIIKNDQLFIKCFV 1570
            ++EHL  C      CP+   GC   + R+N + +H       H +L++E    L ++I +L+  + + +++   L E+++K++K FK     F K    +  ++V AS +D      K      Q  + L ++  +Q K +  +  L EA  T+   +  L N+   L +L+EE +  D  ++     +S+ +E    +  T                   N + IWK+ D+        +  T  IFS SF+ S  GY++   A  NG G  +G    LYF ++RG +D +L WP +  VTL +++Q  K + +     ++  PN  ++++P  E N  +G P FV    L   ++  IK+D LF+K  V
Sbjct:  208 VDEHLAVCPEAEQDCPFKHYGCAVTDKRRN-LQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHID------KSAWLEAQVHQLLQMVNQQQNKFD--LRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTC-----------------YNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMET---FKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAV 549          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 110.538 bits (275), Expect = 4.825e-25
Identity = 98/371 (26.42%), Postives = 173/371 (46.63%), Query Frame = 2
Query:  482 MEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKE---IKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNS---LNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLL-KQSQIIKNDQLFIKCFV 1570
            ++EHL  C      CP+   GC   + R+N + +H       H +L++E    L ++I +L+  + + +++   L E+++K++K FK     F K    +  ++V AS +D      K      Q  + L ++  +Q K +  +  L EA  T+   +  L N+   L +L+EE +  D  ++     +S+ +E    +  T                   N + IWK+ D+        +  T  IFS SF+ S  GY++   A  NG G  +G    LYF ++RG +D +L WP +  VTL +++Q  K + +     ++  PN  ++++P  E N  +G P FV    L   ++  IK+D LF+K  V
Sbjct:  208 VDEHLAVCPEAEQDCPFKHYGCAVTDKRRN-LQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKKLEKEFKQFAQLFGKNGSFLPNIQVFASHID------KSAWLEAQVHQLLQMVNQQQNKFD--LRPLMEAVDTVKQKITLLENNDQRLAVLEEETNKHDTHINIHKAQLSKNEERFKLLEGTC-----------------YNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNIMET---FKPDPNSSSFKRPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAV 549          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 58.5362 bits (140), Expect = 4.325e-9
Identity = 45/143 (31.47%), Postives = 74/143 (51.75%), Query Frame = 2
Query: 1166 VLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKS-KGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYEN-LP--NDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFVCLYK 1582
            V++  +N + + I+S  F+    GYKM   A P G G + + +F ++  +++G +DDIL WP + DVT  I++   K  +L    +Y N +P   +F  R P   RN   GF  F+    L K ++   +  +FI+  V L K
Sbjct:  171 VVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKK--ELLTKTIYVNEMPEIQEFLER-PEGLRNGTFGFQNFLP---LAKVTEFAADGDIFIQIKVLLSK 307          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 53.5286 bits (127), Expect = 2.152e-7
Identity = 39/150 (26.00%), Postives = 69/150 (46.00%), Query Frame = 2
Query: 1127 NKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKW-SQLSGTRLYENL---PNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIK 1561
              + IWK++   +     ++ A   IFS  F     GYKM   AC  G G S G    LY  +++G +D  L WP    + + +++Q  +   +++ T + +      N+    +PR ERN   G   F  L  L      +K+D+++++
Sbjct:  262 GPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAIL---QNYVKDDKIYVQ 408          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 61.6178 bits (148), Expect = 8.068e-10
Identity = 42/169 (24.85%), Postives = 79/169 (46.75%), Query Frame = 2
Query: 1067 TNESNEVQIDKTQL-KLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKM--SLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIK 1561
            + +  ++Q+ K+ + KL        +WK+ D+S  +          + S  F+ S+ GYK+  S++   NG G++     +Y  ++ G YD +L WP    +T  +  Q  +  Q      +   P    +++P +E +  G GFP F+  + LL     IK D +F++
Sbjct:  300 SRQGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENT-HVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHE-LLHSRPFIKGDTVFLR 466          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 61.6178 bits (148), Expect = 9.959e-10
Identity = 42/169 (24.85%), Postives = 79/169 (46.75%), Query Frame = 2
Query: 1067 TNESNEVQIDKTQL-KLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKM--SLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIK 1561
            + +  ++Q+ K+ + KL        +WK+ D+S  +          + S  F+ S+ GYK+  S++   NG G++     +Y  ++ G YD +L WP    +T  +  Q  +  Q      +   P    +++P +E +  G GFP F+  + LL     IK D +F++
Sbjct:  309 SRQGQQIQMLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENT-HVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQSGQGGVAESFVPDPTWENFQRPSNEPDQLGFGFPRFISHE-LLHSRPFIKGDTVFLR 475          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074275)

HSP 1 Score: 58.9214 bits (141), Expect = 6.679e-9
Identity = 57/229 (24.89%), Postives = 94/229 (41.05%), Query Frame = 2
Query:  926 STLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNK------EFIWKLEDFSKVLENCENSAT---KMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLY-FNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGF----PYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            +TL+  V  + N +   +E  D LD  +    +NIS+L+                   TQ+ +  R+          IW+++D+SK LE  +   T     +FS+  F    GY + L    NG G  KG   +   N++ G YD +L WPC++   + I +Q T            N+ +   Y K    R   + F     YF     ++     ++ND +FI+  V
Sbjct:  279 ATLDYEVKNVKNIVCETEERCDKLDRALHQTMQNISDLE-------------------TQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQYDTILHSAMFSNKAF----GYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCT------------NVADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRV 472          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0308606)

HSP 1 Score: 58.5362 bits (140), Expect = 6.854e-9
Identity = 57/229 (24.89%), Postives = 94/229 (41.05%), Query Frame = 2
Query:  926 STLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNK------EFIWKLEDFSKVLENCENSAT---KMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLY-FNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGF----PYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            +TL+  V  + N +   +E  D LD  +    +NIS+L+                   TQ+ +  R+          IW+++D+SK LE  +   T     +FS+  F    GY + L    NG G  KG   +   N++ G YD +L WPC++   + I +Q T            N+ +   Y K    R   + F     YF     ++     ++ND +FI+  V
Sbjct:  200 ATLDYEVKNVKNIVCETEERCDKLDRALHQTMQNISDLE-------------------TQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQYDTILHSAMFSNKAF----GYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCT------------NVADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRV 393          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf-like (gene:FBgn0030748 transcript:FBtr0074274)

HSP 1 Score: 58.5362 bits (140), Expect = 6.854e-9
Identity = 57/229 (24.89%), Postives = 94/229 (41.05%), Query Frame = 2
Query:  926 STLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNK------EFIWKLEDFSKVLENCENSAT---KMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLY-FNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGF----PYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            +TL+  V  + N +   +E  D LD  +    +NIS+L+                   TQ+ +  R+          IW+++D+SK LE  +   T     +FS+  F    GY + L    NG G  KG   +   N++ G YD +L WPC++   + I +Q T            N+ +   Y K    R   + F     YF     ++     ++ND +FI+  V
Sbjct:  200 ATLDYEVKNVKNIVCETEERCDKLDRALHQTMQNISDLE-------------------TQMAMQQRIASVQNIRGHLIWRIKDYSKKLEESKQYDTILHSAMFSNKAF----GYALRLDIYLNGKGTWKGRNMIACLNVLSGEYDPLLAWPCRLQAEIIIRDQCT------------NVADAEDYVKTIFVRKKSDDFIQSNQYFHIPHKVITSRNYLRNDSMFIEVRV 393          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 107.457 bits (267), Expect = 2.774e-24
Identity = 125/536 (23.32%), Postives = 214/536 (39.93%), Query Frame = 2
Query:  227 CLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLID-FD----RDICIDRSINIRISQLTVKCPMET--CEFTDELSMMEEHLKDCDRKFVGCPYSEIGC----CKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQ------MVKTKTENVCLIESL----------------------------EKIKKNFKLEQSKFMKE-IKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLT--------------------NSLNLLKEEVDDLDNEMDNLTENISELKEN-VNGINKTN----------------ESNEVQIDKTQLKLD----NRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            C  C+ ++ N     CG R+C  CI + L+          N  C  +L+  F+    RD+C +R I      L V C  E   C+    L  + EHL       V CPY E+ C    CK ++ +  + EHL +    H ++  E+ + L+  + EL                N C   S+                            + + +  +  +S F  E ++ M V  ++L+ ++  +K E    +  + L  L  R  ++E   E + E N  L   +  +                       L  ++EEV+ L   ++++   +S L  + VN  + ++                  ++V++ +  LKL        N   IWK+ D+ +  +    S T  ++S  F+    GYKM      NG G  KG    L+F ++RG YD +L WP +  VTL +++Q      L     ++  P+  ++R+P  E N  +G P FV    +L+    IK+D +FIK  V
Sbjct:   56 CETCRLVLCNPRQTECGHRFCESCINELLSK--------PNPVCPADLLPLFEDKIFRDVCCNREIMA----LKVYCRSEKNGCKEQMCLQQVMEHL-------VICPYFEVPCPLGKCKEKMMRKDMPEHLSRKC-KHREVTCEFCS-LKMALTELQKHKETVCPAFPVACPNHCSFSSILRSELSSHQHDCPKAQVTCSFIRYGCSYKGLNQEMREHESSFASEHLRMMAVRNTTLEAKVEDVKSELM--ERYKVLPSLSSRLAEVERQYEEMREKNRQLEQKLVSMQMLMSSHSEKLLEVEMELRELRPLRAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLEQQLTRHDDLMSVHDVRLAEMDLKLQVLETASFNGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGPARKHLGDA--FKPDPSSSSFRRPTGEMNIASGCPLFVA-QTVLENGTYIKDDTIFIKVTV 565          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 100.523 bits (249), Expect = 5.319e-22
Identity = 118/501 (23.55%), Postives = 206/501 (41.12%), Query Frame = 2
Query:  227 CLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICI--------DRSINIRISQLTVKCPMETCEFTDELSMME-EHLKDCDRKFVGCPYSEIGCC--------KPEVRQNKVNEHLLKDSF------PHNKLLVEYVNNL---------RKEIEELNTQMVKTKTENVCLIESL--EKIKKNFKL---EQSKFMKEIKAMKVHASSLDTEIVRLKQERT-HGQDLEKLNLLEGRQEKIEESVENLHEANST-LNGTVGQLTNSLNLLKEEVDDLDNEMDNLT-------ENISELKENVNGINKTNESNEVQIDKTQLKLDN----RVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPN--DFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            C  CK I+     A CG R+C  C KQ  +       P   + C    I F+ +  +        D +    I  L  KCP E C ++  L   E +H   C  + V C   ++           + E     +N    K +F       H+++  ++             R++ +E      K+K+   C    +    +  N K    EQ+  M+ ++ M    SS+     RL+ E     Q+   L L  G ++       N+       +   V  L N + +L +EV+     M+ ++       E I  L   V  + +T  + ++Q+ +++  L        +  FIWK+ +FS+  ++        +FS +F+ S+ GYKM L    NG G  +G    L+F +++G YD +L WP    VTL +++Q  +   +   R     P+    ++++P SE N  +G P F  L  L  +S  +++D +FIK  V
Sbjct:   58 CQQCKDILRKPFQAQCGHRFCVFCFKQLTSSG-----PIPCEACRAEGI-FEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVTFNFKEIKAHDEICQKFPMQCKDCGKKKIPREKFQEHTKSCAKSKS--ACQFREIGCRAVVDNCKQQEHEQTSIMEHLRLMLALLSSM-----RLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFR-----PDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 540          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 100.138 bits (248), Expect = 6.903e-22
Identity = 118/501 (23.55%), Postives = 206/501 (41.12%), Query Frame = 2
Query:  227 CLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICI--------DRSINIRISQLTVKCPMETCEFTDELSMME-EHLKDCDRKFVGCPYSEIGCC--------KPEVRQNKVNEHLLKDSF------PHNKLLVEYVNNL---------RKEIEELNTQMVKTKTENVCLIESL--EKIKKNFKL---EQSKFMKEIKAMKVHASSLDTEIVRLKQERT-HGQDLEKLNLLEGRQEKIEESVENLHEANST-LNGTVGQLTNSLNLLKEEVDDLDNEMDNLT-------ENISELKENVNGINKTNESNEVQIDKTQLKLDN----RVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPN--DFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            C  CK I+     A CG R+C  C KQ  +       P   + C    I F+ +  +        D +    I  L  KCP E C ++  L   E +H   C  + V C   ++           + E     +N    K +F       H+++  ++             R++ +E      K+K+   C    +    +  N K    EQ+  M+ ++ M    SS+     RL+ E     Q+   L L  G ++       N+       +   V  L N + +L +EV+     M+ ++       E I  L   V  + +T  + ++Q+ +++  L        +  FIWK+ +FS+  ++        +FS +F+ S+ GYKM L    NG G  +G    L+F +++G YD +L WP    VTL +++Q  +   +   R     P+    ++++P SE N  +G P F  L  L  +S  +++D +FIK  V
Sbjct:   45 CQQCKDILRKPFQAQCGHRFCVFCFKQLTSSG-----PIPCEACRAEGI-FEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVTFNFKEIKAHDEICQKFPMQCKDCGKKKIPREKFQEHTKSCAKSKS--ACQFREIGCRAVVDNCKQQEHEQTSIMEHLRLMLALLSSM-----RLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFR-----PDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 527          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2b (Tnf receptor-associated factor 2b [Source:ZFIN;Acc:ZDB-GENE-030131-5345])

HSP 1 Score: 100.138 bits (248), Expect = 6.903e-22
Identity = 118/501 (23.55%), Postives = 206/501 (41.12%), Query Frame = 2
Query:  227 CLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICI--------DRSINIRISQLTVKCPMETCEFTDELSMME-EHLKDCDRKFVGCPYSEIGCC--------KPEVRQNKVNEHLLKDSF------PHNKLLVEYVNNL---------RKEIEELNTQMVKTKTENVCLIESL--EKIKKNFKL---EQSKFMKEIKAMKVHASSLDTEIVRLKQERT-HGQDLEKLNLLEGRQEKIEESVENLHEANST-LNGTVGQLTNSLNLLKEEVDDLDNEMDNLT-------ENISELKENVNGINKTNESNEVQIDKTQLKLDN----RVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPN--DFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            C  CK I+     A CG R+C  C KQ  +       P   + C    I F+ +  +        D +    I  L  KCP E C ++  L   E +H   C  + V C   ++           + E     +N    K +F       H+++  ++             R++ +E      K+K+   C    +    +  N K    EQ+  M+ ++ M    SS+     RL+ E     Q+   L L  G ++       N+       +   V  L N + +L +EV+     M+ ++       E I  L   V  + +T  + ++Q+ +++  L        +  FIWK+ +FS+  ++        +FS +F+ S+ GYKM L    NG G  +G    L+F +++G YD +L WP    VTL +++Q  +   +   R     P+    ++++P SE N  +G P F  L  L  +S  +++D +FIK  V
Sbjct:   45 CQQCKDILRKPFQAQCGHRFCVFCFKQLTSSG-----PIPCEACRAEGI-FEEETSVLNIAVAFPDNAARREIDSLPAKCPNEGCSWSGTLKDFENQHEGRCAFERVKCEACQVLILLSEKDRHNERECEARTLNCKYCKVTFNFKEIKAHDEICQKFPMQCKDCGKKKIPREKFQEHTKSCAKSKS--ACQFREIGCRAVVDNCKQQEHEQTSIMEHLRLMLALLSSM-----RLRAEGAGEWQEDVGLGLYRGPEDAPPAGAHNVGRGGGPGVQKKVTTLENIVCVLNKEVERSALTMEAISRQHRLDQEKIENLSNKVRQLERTLTTRDLQLAESEQSLRELQFCTYDGVFIWKIAEFSRRRQDAVAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMKGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFR-----PDVSSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 527          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 95.5153 bits (236), Expect = 2.134e-20
Identity = 108/481 (22.45%), Postives = 191/481 (39.71%), Query Frame = 2
Query:  206 PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVH-ASSLDTEIVRLKQERTH-GQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDD---LDNEMDNLTENISELK-------ENVNGINKTNESNEVQIDKTQLKL-----------DNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYK--MSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            PL     C IC   + +A   PCG R+C  CI++ +  T Q  CP  N+      +  +  +  D      I  LTVKC    C    EL  +E+HL  C      CP      C+  V  + ++EH  +          +   +    +++ + Q        VC    +E I+    L       +   +K   A +  T   R K  R    Q +++   +  R   + E + +    N T+      L++          D      E+ NL E + EL+       + +  +   N++ + Q+ + + KL             +    ++W++E+FS  L N E     ++ S  F+    GYK  + L+       +   F  L+ + ++G +D  L WP Q  + L +++QV     +    + E  P+  A+++P   RN  G G+  F+ L   L+Q   +K D L ++C V
Sbjct:   64 PLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQK-CPVDNE------VLLEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQ-----CQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPF-ANTVCEYCEMELIRDQLALH-----CDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMR--YMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQVEGQHHIE---VMETKPDLQAFQRPTVMRNPKGFGYVTFLHLQ-ALRQRGFVKEDVLLVRCEV 520          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 117.087 bits (292), Expect = 3.006e-27
Identity = 119/495 (24.04%), Postives = 199/495 (40.20%), Query Frame = 2
Query:  206 PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCD--------------------RKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNK------LLVEYV-NNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQ-EKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKE--------FIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSL---YACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            PL     C IC   +  A   PCG R+C  CI + +       CP  N+         +  +  D      I  L VKCP + C  T EL  +E HL  CD                     KF  CP  +I C      +N      L+D   H++      +  EY   NL +E    +  M  T     C+       +K  + + ++ ++E    + H   +   +       T    +  ++  +  Q E    SV  +H +++       Q T +   L+E ++ L+  +      I EL   +    +    NE++   T   LDNR+ +         FIW++ +F+ +L+N E     +I S  F+  + GYK+ L      P+   +   +  L+ + ++G YD +L WP Q  + L I++Q    +      + +  P   A+++P   RN  G G+  F+ L   LKQ Q +KND L ++C V
Sbjct:   65 PLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHK-CPVDNESL------MENQLFPDNFAKREILSLRVKCPSQGCTETMELRHLERHLVRCDFAGVECSQCQSSFPKYSLQKHKFEECPRRQIFC------ENCALAMALEDKLNHDQTCPLAYVTCEYCQTNLIREQMPAHYSMDCTMAPIPCMYYEFGCTEKMQRNDLARHLQEFT--QAHMRMMAQTLRSFSSSVTPTSHMPDISFCDPSQFEPAPPSVATVHSSHTPSQNDCTQETRN---LRETIEQLEGRLVRQDHQIRELIAKME--TQCTYVNELK--HTIRSLDNRLGEMESQQCSGIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSA-QRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELLAFQRPTVARNPKGFGYVTFMHLQ-ALKQRQYVKNDTLLVRCSV 535          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 105.531 bits (262), Expect = 1.253e-23
Identity = 105/386 (27.20%), Postives = 178/386 (46.11%), Query Frame = 2
Query:  434 VKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIE-SLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKI---EESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYL--LKQSQIIKNDQLFIKCFV 1570
            V CP   C  T   + +++HL +C    + C +S  GC    V++ KV EH  +D+F  + +L     N++ E + L  Q      +N+ L E  ++++    K  + +  +  +    + +SL +        +T    ++K   LE +  ++   E S  +L     TL  T  +L+ +L   K+ +D+LD +       +S  K  +        SNE   ++ +L      N + IWK+ D+ +            IFS  F+ S  GY++   A  NG G  KG F  LYF +++G +D IL WP +  VTL +++Q  K + +  T ++   PN  ++++P SE N  +G P F     L   K    IK+D LFIK  V
Sbjct:  125 VPCP-NACPVTCPRAELDKHLCECPEAELQCTFSNYGC-NVMVKRGKVKEH--EDTFLRDHMLYVLNRNMKLEEQVLGLQ------QNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSST-------KTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLS-TLEAYKDRIDNLDGQFKKHDVLLSNHKMQMT-------SNE---ERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHI--TDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVV 480          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: slc12a1 (solute carrier family 12 member 1 [Source:Xenbase;Acc:XB-GENE-479925])

HSP 1 Score: 100.908 bits (250), Expect = 4.707e-22
Identity = 102/370 (27.57%), Postives = 174/370 (47.03%), Query Frame = 2
Query:  482 MEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIE-SLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKI---EESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYL--LKQSQIIKNDQLFIKCFV 1570
            +++HL +C    + C +S  GC    V++ KV EH  +D+F  + +L  YV N   ++EE     V +  +N+ L E  ++++    K  + +  +  +    + +SL +        +T    ++K   LE +  ++   E S  +L     TL  T  +L+ +L   K+ +D+LD +       +S  K  +        SNE   ++ +L      N + IWK+ D+ +            IFS  F+ S  GY++   A  NG G  KG F  LYF +++G +D IL WP +  VTL +++Q  K + +  T ++   PN  ++++P SE N  +G P F     L   K    IK+D LFIK  V
Sbjct:  191 LDKHLCECPEAELQCTFSNYGC-NVMVKRGKVKEH--EDTFLRDHML--YVLNRNMKLEE----QVLSVLQNLDLKEHQIQQLSDTVKWCEKECHQFGQFTGSNGNSLSST-------KTLASYIDKSMWLEEQVIQLVSKEHSRLDLRPILDTLESTKQRLS-TLEAYKDRIDNLDGQFKKHDVLLSNHKMQMT-------SNE---ERFRLVEGTSYNGKLIWKITDYERKKREAMEGRAVSIFSQHFYTSWCGYRLCARAYLNGDGSGKGSFLSLYFVVMKGEFDSILLWPFKQKVTLMLLDQSGKKNHI--TDVFRADPNSSSFKRPDSEMNIASGCPRFASHAQLENPKNGCYIKDDTLFIKIVV 531          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 100.908 bits (250), Expect = 5.876e-22
Identity = 121/528 (22.92%), Postives = 219/528 (41.48%), Query Frame = 2
Query:  152 NLEITWKIIKENNFK--LINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMET--CEFTDELSMMEEHLK-DCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKD--------SFPHNKL-LVEYVNNLRKEIEELNTQMVKTKTENVCLIESL---EKIKKNFKL-EQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISE--------------------------------LKENVNGINKTNESNEVQIDKTQLKLD----NRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            +L  T  + ++  +K   + P+ E   C  C+ ++ N     CG R+C  C+   L+ T        +    I      +D C  R +      L + C  ET  C+    L  +  HLK DC  + + CP ++   CK +V +  +++H+ K          F  N++ LVE      ++ E+++   V     ++C ++SL   E   +  K  E S  ++ +  MK  ++ L+ ++  L+ E +     + + +L  +    E  +E   E        + QL   +    +++ DLD E+ NL +   E                                L+  +N  ++    +++++    L+         N   IWK+ D+ +  +      T  ++S  F+    GYKM      NG G  KG    L+F I+RG YD +L WP +  V+L +++Q      L     ++  PN  +++KP  E N  +G P FV    +L+    IK+D +FIK  V
Sbjct:   21 SLATTIYVPEQGGYKERFLKPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACED---NITKDKVFKDNCCRREV----LALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRAD---CKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEM-----QKHEDVDCPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKN--KSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDA--FKPDPNSSSFKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIKVIV 528          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 98.5969 bits (244), Expect = 3.363e-21
Identity = 117/543 (21.55%), Postives = 217/543 (39.96%), Query Frame = 2
Query:  152 NLEITWKIIKENNFK--LINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTD----------------------------QNYCPGSNKYC------GINLIDFDRDI-----------CIDRSINIRISQLTVKC------PMETCEFTDELSMMEEHLK-DCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLK-DSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIES----LEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQE--RTHGQDLEKLNLLEGRQEKIEE---SVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTE-NISELKENVNGINKTNESNEVQIDKTQLKLD----NRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            +L  T  + ++  +K   + P+ E   C  C+ ++ N     CG R+C  C+   L+ T                             Q +C    + C      G  LI    D            C ++ I   +S    K       P + C     L  M++H   DC    + CP+    C    + ++++N HLL+  + P       Y    +   +++      +  ++V L++     LE      + E S+  K I+ +     S + EI R K++      + ++   ++EG+ +K+++    + NL +     +G    + ++   L+  +  L+    N    N   L+  +N  ++    +++++    L+         N   IWK+ D+ +  +      T  ++S  F+    GYKM      NG G  KG    L+F I+RG YD +L WP +  V+L +++Q      L     ++  PN  +++KP  E N  +G P FV    +L+    IK+D +FIK  V
Sbjct:   21 SLATTIYVPEQGGYKERFLKPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHM---CSVKSLLRSELNAHLLECVNAPSTCSFKRYGCTFKGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGDEADG----MKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDA--FKPDPNSSSFKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIKVIV 553          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 112.464 bits (280), Expect = 6.623e-26
Identity = 110/469 (23.45%), Postives = 186/469 (39.66%), Query Frame = 2
Query:  206 PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNL---RKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLE--QSKFMKEIKAMKVHASSLDTEIVRLKQERTH------GQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYK--MSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            PL     C IC   +  A   PCG R+C  CI + +       CP  N+      I  +  +  D      I  LTVKCP + C    EL  +E+H   C+   V CP      C+   ++ +VN H+++D        V    ++    KEI + +  +     E    I   E++  ++ L+   +           H       + R  QE T        Q +  +NL   R              +     T+ QL + L     ++ +L  +M+  +  + ELK  +  +       E Q          + N  +IWK+ +F   L++ E     +I S  F+    GYK  M L+       +   +  L+ + ++G YD  L WP Q  + L I++Q     + +   + +  P   A+++P   RN  G G+  F+ L+  L+Q   IK+D L ++C V
Sbjct:   63 PLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHK-CPVDNE------ILLENQLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQ-----CQRPFQKCQVNTHIIEDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVNLAL-RPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAKMETQSMYVGELKRTIRTLEDKVAEMEAQ----------QCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE-ALRQGTFIKDDTLLVRCEV 507          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 107.457 bits (267), Expect = 3.345e-24
Identity = 99/386 (25.65%), Postives = 171/386 (44.30%), Query Frame = 2
Query:  428 LTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLD----NRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            + V CP +    T   S +  HL +C      C +   GC      Q ++  H    +  H  LL E+ N+L K++  L  + V+        I+SL     +F++E       I+  K    + +++I+ L  +R      EKL  L+   ++I    +N  EA+S +  +V  L N +     E++ +D        N   L+  ++  ++    +++++    L+         N   IWK+ D+ +  +      T  ++S  F+    GYKM      NG G  KG    L+F I+RG YD +L WP +  VTL +++Q +    L     ++  PN  +++KP  E N  +G P FV    +L+    IK+D +FIK  V
Sbjct:  199 VVVSCPHKCSVQTLLRSELSAHLSECVNAPSTCSFKRYGCVFQGTNQ-QIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKS----IQSLHNQICSFEIE-------IERQKEMLRNNESKILHL--QRVIDSQAEKLKELD---KEIRPFRQNWEEADS-MKSSVESLQNRVT----ELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDA--FKPDPNSSSFKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIKVIV 559          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 104.76 bits (260), Expect = 2.412e-23
Identity = 129/548 (23.54%), Postives = 215/548 (39.23%), Query Frame = 2
Query:  161 ITWKIIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSI-------------NIRI------------SQLTVKCPMETCEFTDELSMMEEHLKD-----------CDRKFV----------GCPYSEIGC---CKPEVRQNKVNEHLL------KD-SFPHNKLLVE--YVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQ--SKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVD--DLDNEMDNLTENISELKENVNGI-----NKTNESNEVQIDKTQLKLDNRVNKEF---------IWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLL-KQSQIIKNDQLFIKCFV 1570
            I+     +  ++ +  L E   C  C  ++ N     CG R+C QCI+          CP   +   I   +  +D C  R +             N RI            S   V CP E+C        ++EHL             C R  V           CP   + C   C   + + +VNEHL       +D  F H    V+    N L  E   L   M             L  ++KN++LEQ  +  +  ++  K  A++ D+ I       +  QD+   + L        +++ +  + ++ L   V QL   +N     +D   L + +D++ + I++L+ +   +       +     + I K QL  +    K+          IWK+ D+           T  +FS  F+ S  GY++   A  NG G  KG    LYF ++RG +D +L WP +  VTL +++Q  K + +  T  ++  PN  ++++P  E N  +G P FV    L   ++  IK+D LF+K  V
Sbjct:   23 ISLDFEPDTEYQFVEQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEV--IKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHM-------------LLVLEKNYQLEQRVNALLSSLERKKKMAAA-DSAIQHATNPMSRFQDI--FSFL------YRKALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVET--FKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 544          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 104.76 bits (260), Expect = 2.412e-23
Identity = 129/548 (23.54%), Postives = 215/548 (39.23%), Query Frame = 2
Query:  161 ITWKIIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSI-------------NIRI------------SQLTVKCPMETCEFTDELSMMEEHLKD-----------CDRKFV----------GCPYSEIGC---CKPEVRQNKVNEHLL------KD-SFPHNKLLVE--YVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQ--SKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVD--DLDNEMDNLTENISELKENVNGI-----NKTNESNEVQIDKTQLKLDNRVNKEF---------IWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLL-KQSQIIKNDQLFIKCFV 1570
            I+     +  ++ +  L E   C  C  ++ N     CG R+C QCI+          CP   +   I   +  +D C  R +             N RI            S   V CP E+C        ++EHL             C R  V           CP   + C   C   + + +VNEHL       +D  F H    V+    N L  E   L   M             L  ++KN++LEQ  +  +  ++  K  A++ D+ I       +  QD+   + L        +++ +  + ++ L   V QL   +N     +D   L + +D++ + I++L+ +   +       +     + I K QL  +    K+          IWK+ D+           T  +FS  F+ S  GY++   A  NG G  KG    LYF ++RG +D +L WP +  VTL +++Q  K + +  T  ++  PN  ++++P  E N  +G P FV    L   ++  IK+D LF+K  V
Sbjct:   23 ISLDFEPDTEYQFVEQLEERYKCAFCHSVLHNPHQTGCGHRFCQQCIRSLRELNSVPICPVDKEV--IKPQEVFKDNCCKREVLNLHVYCKNAPGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRCVQTIPRARVNEHLTVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHM-------------LLVLEKNYQLEQRVNALLSSLERKKKMAAA-DSAIQHATNPMSRFQDI--FSFL------YRKALTSHTDKSAWLEAQVRQLLQIVNQQPSRLDLRSLVDAVDSVKQRITQLEASDQRLVLLEGETSKHDAHINIHKAQLNKNEERFKQLEGACYSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSGKKNHIVET--FKADPNSSSFKRPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 544          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 102.834 bits (255), Expect = 1.095e-22
Identity = 125/515 (24.27%), Postives = 212/515 (41.17%), Query Frame = 2
Query:  194 KLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLID--FDRDICIDRSINIRISQLTVKCPMETCEFTDELSM--MEEHLK-------------DCDRKFV----------GCPYSEIGC--CKPEVRQNKVNEHLLKD------SFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIE----SLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQ------------ERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLD----NRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            K +  + +   C  C+ ++ N     CG R+C  C+   L+ +    C      C  ++I     +D C  R I      L V C  E     ++L++  +  HLK             DC  K +           C Y E  C  CK +V   K+ +H   D      S PH K  V+ +       +++      +  ++V L++    SLEK     + E  +  K I+++     S + EI R K+            +R      EKL  L+   ++I    +N  EA+S +  +V  L N +     E++ +D        N   L+  ++  ++    +++++    L+         N   IWK+ D+ +  +      T  ++S  F+    GYKM      NG G  KG    L+F I+RG YD +L WP +  VTL +++Q +    L     ++  PN  +++KP  E N  +G P FV    +L+    IK+D +FIK  V
Sbjct:   41 KFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPK-CTA----CQESIIKDKVFKDNCCKREI----LALQVYCRNEGRGCAEQLTLGHLLVHLKNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPH-KCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELD---KEIRPFRQNWEEADS-MKSSVESLQNRVT----ELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDA--FKPDPNSSSFKKPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIKVIV 534          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.802e-27
Identity = 119/470 (25.32%), Postives = 193/470 (41.06%), Query Frame = 2
Query:  206 PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNL----RKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLE--QSKFMKEIKAMKVHASSLDTEIVRLKQERTH------GQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYK--MSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            PL     C IC   +  A   PCG R+C  CI + +       CP  N+      I  +  +  D      I  L VKCP E C    EL  +E+H   C+   V CP      C+   ++  +N H+LKD  P  ++  +    L     KEI + N  +     E    I   E++  ++ L+   +           H       + R  QE T        Q +  L+L+       E  V N  E       T+ QL   L     ++ +L  +M+  +  +SELK  +    +T E    +I+  Q       N  +IWK+ +F   L+  E     +I S  F+  + GYK  M L+       +   +  L+ + ++G YD  L WP Q  + L I++Q     + +   + +  P+  A+++P   RN  G G+  F+ L+  L+Q   IK+D L ++C V
Sbjct:   63 PLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHK-CPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQ-----CQRPFQKFHINIHILKDC-PRRQVSCDNCAALVAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVSE--VRNFQE-------TIHQLEGRLVRQDHQIRELTAKMETQSTYVSELKRTI----RTLEDKVAEIEAQQ------CNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPDLLAFQRPTIPRNPKGFGYVTFMHLE-ALRQRTFIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 119.398 bits (298), Expect = 1.853e-27
Identity = 119/470 (25.32%), Postives = 193/470 (41.06%), Query Frame = 2
Query:  206 PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNL----RKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLE--QSKFMKEIKAMKVHASSLDTEIVRLKQERTH------GQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYK--MSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            PL     C IC   +  A   PCG R+C  CI + +       CP  N+      I  +  +  D      I  L VKCP E C    EL  +E+H   C+   V CP      C+   ++  +N H+LKD  P  ++  +    L     KEI + N  +     E    I   E++  ++ L+   +           H       + R  QE T        Q +  L+L+       E  V N  E       T+ QL   L     ++ +L  +M+  +  +SELK  +    +T E    +I+  Q       N  +IWK+ +F   L+  E     +I S  F+  + GYK  M L+       +   +  L+ + ++G YD  L WP Q  + L I++Q     + +   + +  P+  A+++P   RN  G G+  F+ L+  L+Q   IK+D L ++C V
Sbjct:   63 PLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHK-CPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQ-----CQRPFQKFHINIHILKDC-PRRQVSCDNCAALVAFEDKEIHDQNCPLANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVSE--VRNFQE-------TIHQLEGRLVRQDHQIRELTAKMETQSTYVSELKRTI----RTLEDKVAEIEAQQ------CNGIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPDLLAFQRPTIPRNPKGFGYVTFMHLE-ALRQRTFIKDDTLLVRCEV 499          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q28DL4|TRAF6_XENTR (TNF receptor-associated factor 6 OS=Xenopus tropicalis OX=8364 GN=traf6 PE=2 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.987e-26
Identity = 119/495 (24.04%), Postives = 198/495 (40.00%), Query Frame = 2
Query:  206 PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCD--------------------RKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNK------LLVEYV-NNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQ-EKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKE--------FIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSL---YACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            PL     C IC   +  A   PCG R+C  CI + +       CP  N+         +  +  D      I  L VKCP + C  T EL  +E HL  CD                     KF  CP  +I C      +N      L+D   H++      +  EY   NL +E    +  M  T     C+       +K  + + ++ ++E    + H   +   +       T    +  ++  +  Q E    SV  +H  ++       Q T +   L+E ++ L+  +      I EL   +    +    NE++   T   LDNR+ +         FIW++ +F+ +L+N E     +I S  F+  + GYK+ L      P+   +   +  L+ + ++G YD +L WP Q  + L I++Q    +      + +  P   A+++P   RN  G G+  F+ L   LKQ Q +KND L ++C V
Sbjct:   65 PLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHK-CPVDNESL------MENQLFPDNFAKREILSLRVKCPSQGCTETMELRHLERHLVRCDFAGVECSQCQSSFPKYSLQKHKFEECPRRQIFC------ENCAVAMALEDKLNHDQTCPLAYVTCEYCQTNLIREQMPAHYSMDCTMAPIPCMYYEFGCTEKMQRNDLARHLQEFT--QAHMRMMAQTLRSFSSSVTPTSHMPDISFCDPSQFEPAPPSVATVHSTHTPSQNDCTQETRN---LRETIEQLEGRLVRQDHQIRELIAKME--TQCTYVNELK--HTIRSLDNRLGEMESQQCSGIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSA-QRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELLAFQRPTVARNPKGFGYVTFMHLQ-ALKQRQYVKNDTLLVRCSV 535          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q3ZCC3|TRAF6_BOVIN (TNF receptor-associated factor 6 OS=Bos taurus OX=9913 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 1.230e-25
Identity = 120/482 (24.90%), Postives = 198/482 (41.08%), Query Frame = 2
Query:  206 PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVE----YVNNLRKEIEELNTQMVKTKTE--NVCLIESLEKIKKNFKLE--QSKFMKEIKAMKVHASSLDTEIVRLKQERTH------GQDLEKLNLLEGRQEK----IEESV------ENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYK--MSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            PL     C IC   +  A   PCG R+C  CI + +       CP  N+      I  +  +  D      I  L VKCP E C    EL  +EEH   C+   + CP      C+   ++  +N H+LK+  P  ++  E     +    KEI E N  +     E  N  LI   E++  ++ L+   +       A   H       + R  QE T        Q ++ L+L      +    + +SV         H        T+ QL   L     ++ +L  +M+  +  ++ELK  +    +T E    +I+  Q       N  +IWK+ +F   L++ E     +I S  F+  + GYK  M L+       +   +  L+ + ++G YD  L WP Q  + L I++Q     + +   + +  P   A+++P   RN  G G+  F+ L+  L+Q   IK+D L ++C V
Sbjct:   64 PLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHK-CPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEEHQAHCEFALMSCPQ-----CQRPFQKCHLNIHILKEC-PRRQVPCENCAVSMAFEDKEIHEQNCPLANVICEYCNTMLIR--EQMPNHYDLDCPTAPVPCTFSAFGCHEKMQRNHLARHLQENTQSHMRMMAQAVQTLSLAVAPVPQCTMPLYDSVPPTRPSSGRHSEVHNFQETIQQLEGRLVRQDHQIRELTAKMETQSMYVNELKRTI----RTLEDKVAEIEAQQ------CNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPSAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAAVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE-ALRQRTFIKDDTLLVRCEV 519          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B5DF45|TRAF6_RAT (TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1)

HSP 1 Score: 113.62 bits (283), Expect = 1.664e-25
Identity = 113/472 (23.94%), Postives = 189/472 (40.04%), Query Frame = 2
Query:  206 PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNL------RKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLE--QSKFMKEIKAMKVHASSLDTEIVRLKQERTH------GQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYK--MSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            PL     C IC   +  A   PCG R+C  CI + +       CP  N+      I  +  +  D      I  LTVKCP + C    EL  +E+H   C+   V CP      C+   ++ ++N+H+++D     +  V  VN         KEI + +  +     E    I   E++  ++ L+   +           H       + R  QE T        Q +  +N L  R              +     TV QL   L     ++ +L  +M+  + ++SELK  +  +       E Q          + N  +IWK+ +F   L++ E     +I S  F+    GYK  M L+       +   +  L+ + ++G YD  L WP Q  + L I++Q     + +   + +  P   A+++P   RN  G G+  F+ L+  L+Q   IK+D L ++C V
Sbjct:   63 PLESKYECPICLMALREAVQTPCGHRFCKACITKSIRDAGHK-CPVDNE------ILLENQLFPDNFAKREILSLTVKCPNKGCVQKMELRHLEDHQVHCEFALVICPQ-----CQRFFQKCQINKHIIEDC---PRRQVSCVNCAVPMPYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPVPCTFSVFGCHEKMQRNHLARHLQENTQLHMRLLAQAVHNVN-LSLRPCDASSPSRGCRPEDPNYEETVKQLEGRLVRQDHQIRELTAKMETQSMHVSELKRTIRSLEDKVAEMEAQ----------QCNGIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAVIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE-ALRQGTFIKDDTLLVRCEV 507          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.538e-40
Identity = 127/483 (26.29%), Postives = 240/483 (49.69%), Query Frame = 2
Query:  149 ANLEITWKIIKENNFKLIN-PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNF---KLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNE---SNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLP-NDFAYRKPRSERNDGN-GFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            + L+   +++ + N K ++  +N DL C++C  +M +A  + CGC YC  CI+ +L   + NYCPG    C  + ++ + D+  +  ++ RIS++ VKCP   C +T EL  ++EHL  C  + V CP   IGC +  + ++++ +HL      H +L++ + N L+ EI   N    +T  E++  ++ + +++K     K  Q +F+ E         + D  I+ L Q+    ++ E + LL  +    E  ++ L          +  + N L ++     D+ N++ +L + I  +K N++  N+  E   +N ++++    KL   V+ +F+W++E++SK     +      ++SDSF      + ++LY   + L       GL+  I++G  DD L WP +  VTL I+ Q +  +  +    Y+    N  A+ +P+ ERND   G    V+  Y+ +   I+ ND + + C V
Sbjct:    4 SKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYL-SQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEINHNN----ETTKEDISHLKEVLRVQKALNDEKTAQMEFLIE------ELRNKDNMILVLSQDIQEVKN-EMITLLTSK----ESELKKLKSDIQIFRQEIEFMKNDLEVVGST--DIKNQVKDLKKEIFGIKMNIDSNNEERERKMNNLIRLN----KLCPNVDMDFMWRIEEYSK-----KRRTVTDVYSDSFQSHNYKFCLNLYIYGDNL-------GLWCVIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYDTYQRNKKAFDRPKDERNDYCIGTDSLVRYSYIKETPMILVNDSIIVACVV 452          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 4.770e-31
Identity = 123/472 (26.06%), Postives = 221/472 (46.82%), Query Frame = 2
Query:  170 KIIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERT-HGQDLE-KLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDK-TQLKLDNRV---NKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSL--YACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIK 1561
            K+ K+N ++    +N++L C++C+ I+++A    CGCRYC +CI  +L   ++  C    + C   +  +      DR+ N  IS L VKC  E C F D L  ++ HL  C+ +   C    +     E   +  NE LL++      +L +Y   L    +E N   +  ++ ++C                     + +A+  +  + ++++  L   ++   + LE  L++ + +Q  I +     H   S+   T+  +T  L  L+++   ++  M+ L E    LK  +  +      N   I + T LK  N+    N +++WK++ FSK+ EN        I S++F+ S+ GYKM +  Y C +G+GK      ++F I++G YDDIL WP +  V + I +  +K + LS T  ++  P    Y++P  E N  +G P F+    L      +K D L+I+
Sbjct:   14 KLYKDNKWRFT--INDNLKCVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKE-CVAEYEDCRSVITSY----IYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYRNEMCSLCGMEYIIKEESNHLANECLLRE------VLCQYCRTLLT-FKEYNESHLCFESRDLC--------------------GKYEAICPYGCTGESKVNLLHHRKSCENKPLECPLHVFDCKQ-LIPKDQMTEHLNTSSYEHTLTIVT-ELRKLEKQNKHMEERMNILIEENQLLKATLEVMKLDLPKNSGSISRDTSLKRANKTIFRNGKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGT-HLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFSKSTNLSDT--FKPDPKSICYQRPEEEYNIASGSPKFISFSEL---KNFLKKDTLYIQ 443          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2C9K4L1 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106050982 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 4.808e-27
Identity = 130/534 (24.34%), Postives = 232/534 (43.45%), Query Frame = 2
Query:  161 ITWKIIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRD-ICIDRSINIRISQLTVKCPM--ETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLL-KDSFPH------NKLLVEYVNNLRKEIEELNTQMVKTKTENVC---LIE-----SLEKIKKN-----------------FKLEQSKFMKEIKAMKVHAS------------SLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEE-------VDDLDNEMDNLTENISELK---ENVNGINKTNESNEVQIDKTQLKLD----NRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKP-RSERNDGNGFPYFVKLDYLLKQS-QIIKNDQLFIKCFV 1570
            ++  ++ E++  L+NP +    C + +G++ +A    CG R C  C+  +L   ++  CP + + C     D  ++ I  D      I QL V CP   + C+ T +  ++  H +DC+ + V C YS  GC          N+ +L KD+  H        +  E  N      +E N    K   +++C   LI+      +E +K++                 FK     FM + + ++ H              +L +EI R++++  + Q    L  L    +++  +V++ H     L   + Q    L +L+++       +  L  EM NL ++I +LK     V+   +   S+E+++ +  L+         + + +WK+ DFS    +     T  ++S  F+    GYKM      NG G  +G    LYF +++G YD +L WP Q  V+L +++Q  +   L      +  PN  ++R+P  +E N  +G P FV    L   S   +K+D LFIK  V
Sbjct:   38 LSLSLLPEDDPILVNP-DPKYFCPVHRGLLRDAVQTECGHRLCQACVGLYLGSDNKKRCPANEEDCS----DITKENILPDPGFRREIKQLAVCCPFNGKGCKVTVKFGLLNNHTRDCEYRDVRCIYSVRGC----------NQSILFKDAETHITICPCRPVFCELCN------QEFNASEQKKHEDSICPAALIDCPFLCGIENLKRSQLADHEIVCPKRPSECKFKSLGCPFMGDSETIRAHEQNIESHFEVVCEFALKSEINRMREKEYYEQ---TLGTLFRNSDQLSNTVKSNHR---DLKLKMVQQVERLIILEQKNQQYETTIAGLRQEMQNLQQSIEQLKVLITQVSNAERQVASHEIRMAEMDLRFQMLETASYDGKLLWKIRDFSHRKRDAVQGRTVSLYSQPFYTGRFGYKMCARVYLNGDGIGRGTHMSLYFVVMKGEYDALLSWPFQHRVSLILMDQSPEKRHLKDEFFPD--PNSTSFRRPMAAEMNVASGCPLFVAHTVLDNPSNNYVKDDTLFIKIAV 542          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: W5NEW6 (TNF receptor-associated factor OS=Lepisosteus oculatus OX=7918 GN=TRAF5 PE=3 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 5.734e-27
Identity = 141/542 (26.01%), Postives = 224/542 (41.33%), Query Frame = 2
Query:  188 NFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLK------DSFPH---NKLLVEYVNNLRKEIEELNTQMVKTKTENVCL-------------------------------------IESLEKI----------KKNFKLE-QSKFMKEIKAMKVH--------ASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLN--LLKEEVDDLDNEMDNLTENIS---ELKENVNGINKT--NESNEVQIDKTQLKLDNR---------VNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYL--LKQSQIIKNDQLFIK 1561
            N + +  L E   C  C  +++N     CG  +C QCIK  L  T    CP  N     N + F  + C    +N+ I       P   C     L  ++EHLK C  + V C  + IGC     R + + EHL+       +S PH   + +L++      K+ E+ N    K +  N C                                      +E+ E +          + NFKLE Q   +++   +K H         ++L+ EI  L Q+ T        N+L   Q  +EE  + +    S++   + QLT + N   ++ EV  L   +DNL + +S    LK+ +N ++      S  + I   QL L++           N + IWK++DF K  E         +FS  F+ S +GYK+   A  NG G  +G    LY  ++RG +D +L WP +  VTL I++Q    S +     ++  P   ++R+P  E N  +GFP FV    L   K    +K++ LF+K
Sbjct:   33 NIQFVEKLEEQYVCPSCGHVVLNPHQTGCGHIFCYQCIKAFLESTTMPKCPIDNALIKANEV-FQDNCCKREILNLEI--YCANAP--DCTLKVTLGRLQEHLKHCPYESVQC--TNIGCTDVMFRMD-LREHLMSICAYRMESCPHCEKHYMLIQL-----KDHEDTNCPDFKIQCPNKCSQVIKRHKLKDHFQECPQVEIDCTYKKYGCFFREKRVNVEAHEDVALKDHLLLVLESNFKLEKQIDDLQKTLLLKHHEFQELTSVVNNLEKEIKPLIQQVTKTD-----NMLSCVQRSLEEQRDRV----SSVQIQLQQLTRAFNQDPIRTEVGHLKTSVDNLKQQVSVIESLKDRLNVLDDQYKRHSRLLNIHMEQLNLNDERFRQLEATSYNGKLIWKIQDFQKRKEAAAEGRAPSMFSMPFYTSRSGYKLCARAYLNGDGAGRGTHLSLYIVLMRGDFDSLLPWPFRQTVTLMILDQSGNKSDI--LDYFKPDPASNSFRRPTGEMNVASGFPCFVSHADLENPKNGVYVKDETLFVK 550          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A4W2CR26 (TNF receptor-associated factor OS=Bos indicus x Bos taurus OX=30522 PE=3 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 8.116e-26
Identity = 122/472 (25.85%), Postives = 197/472 (41.74%), Query Frame = 2
Query:  206 PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVE----YVNNLRKEIEELNTQMVKTKTE--NVCLIESLEKIKKNFKLE--QSKFMKEIKAMKVHASSLDTEIVRLKQERTH------GQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYK--MSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            PL     C IC   +  A   PCG R+C  CI + +       CP  N+      I  +  +  D      I  L VKCP E C    EL  +EEH   C+   + CP      C+   ++  +N H+LK+  P  ++  E     +    KEI E N  +     E  N  LI   E++  ++ L+   +       A   H       + R  QE T        Q ++ L+L  G     E  V N  E       T+ QL   L     ++ +L  +M+  +  ++ELK  +    +T E    +I+  Q       N  +IWK+ +F   L++ E     +I S  F+  + GYK  M L+       +   +  L+ + ++G YD  L WP Q  + L I++Q     + +   + +  P   A+++P   RN  G G+  F+ L+  L+Q   IK+D L ++C V
Sbjct:   64 PLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHK-CPVDNE------ILLENQLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEEHQAHCEFALMSCPQ-----CQRPFQKCHLNIHILKEC-PRRQVPCENCAVSMAFEDKEIHEQNCPLANVICEYCNTMLIR--EQMPNHYDLDCPTAPVPCTFSAFGCHEKMQRNHLARHLQENTQSHMRMMAQAVQTLSLAPGSGRHSE--VHNFQE-------TIQQLEGRLVRQDHQIRELTAKMETQSMYVNELKRTI----RTLEDKVAEIEAQQ------CNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPSAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAAVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLE-ALRQRTFIKDDTLLVRCEV 500          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 107.071 bits (266), Expect = 3.501e-24
Identity = 125/560 (22.32%), Postives = 230/560 (41.07%), Query Frame = 2
Query:  149 ANLEITWK---IIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLID----FDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDC-------------------------------------------------DRKFVGCPYSEIGC---CKPEVRQNKVNEHLLKDSFPHNKLLVEY------VNNLRKEIE-----ELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSL--NLLKEEVDDLDNEMDNLTENIS---ELKENVNGINKTNESNE--VQIDKTQLKLDNR---------VNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYL--LKQSQIIKNDQLFIK 1561
            + L  +W+   ++       +  L++   C  C G++ N     CG  +C  CI+  L   + + CP    + GI LI     F  + C    +N+ +       P   C  T  L  +++HLK C                                                 D +   CP +E+ C   C   V+++K+ +H   D  P  +    Y      V N R +++     E N  ++     N  LI+ +++++++F  +Q     E+K   +  S+L  E+ +                 +     ++ SVE   E  S++   +  L + L  +L KEE+  L   +D+L E ++    L+E++  + +T +S+   + I   QL+   +          + + IWK+ D+ +  E     A   + S  F+ S +GYK+S      G G ++G    LY  ++RG +D +L WP + +VTL +++Q    + +S +   +   N+F  R+P SE N   GFP F+    L   + +  +++D LFIK
Sbjct:   18 SGLVRSWELESVLAGRTLSFVVKLDDQFVCPACGGVVFNPHQTGCGHIFCSPCIRVILENNETSKCP----FDGI-LIKPEEVFQDNCCKRELLNLEV--FCTNSP--ACSQTIPLCNLQDHLKSCQYEALQCPNSSCTDILLRKNLPDHQRSHCSYRTELCRYCQKPYPVSQLTDHEKTSCPEAEVQCPNKCIHLVKRHKLKDH--ADECPEQETDCIYKKYGCTVRNKRGQVKVHEQTEFNHHVLLLLESNSKLIKQVDQLQQDFAAQQG----ELKERNLLVSNLKREVSKC----------------DTTVSAMQRSVEEQRELVSSVKRELKDLRDVLEADLTKEELVSLRASLDSLREQVAMTQSLREHLGALGQTCQSHTRLLDIHVQQLQCSEQRFQQLESTSYDGKLIWKVHDYHRKKE-----AGTALNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSGNRNHVSLSFTPDLASNNF--RRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIK 539          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 98.2117 bits (243), Expect = 3.105e-21
Identity = 93/381 (24.41%), Postives = 165/381 (43.31%), Query Frame = 2
Query:  488 EHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHAS------SLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNL-------TENISELKENVNGINKTNESNEVQIDKTQLKL----DNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPN--DFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            +H+K C +    C +  +GC    V + K+++H    S+ H  LL+ ++  ++  +E L  Q ++  +     I+ L +  +  +L+  +           A       +L T    L    T G  LE    L+   EK +  V  L      L   VG   N + +L  E++     M+          + I  L   V  + +T    ++ I + + K+        +  F+WK+ DFSK  ++        +FS +F+ S+ GYKM L    NG G  +G    L+F ++RG  D +L WP    VTL +++Q  +   +   R     P+    ++++P S+ N  +G P F  L  L  ++  I++D +FIK  V
Sbjct:  204 DHIKLCTKFRTPCRFHVVGC-DMSVEKEKIHDHERACSYEHLNLLLHFIMGIKVNLESLQPQSLELASHK---IQELHQSLRELELKMGQLSAGAPVQGACAPPPPPPPTLATSFTPLPT--TVGAALE----LQLHSEKTK--VAELSRRCQELELKVGTFENIVCVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFR-----PDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKAIV 567          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 94.7449 bits (234), Expect = 3.057e-20
Identity = 121/508 (23.82%), Postives = 203/508 (39.96%), Query Frame = 2
Query:  227 CLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYC------PGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNL--RKEIEEL--------NTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMK-EIKAMKVHASSLDTEIVRLKQ-------ERTHGQDLEKLNLLEGRQEK------IEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESN---------------------EVQIDKTQLKL----DNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYK--MSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPN--DFAYRKPRSERNDGNGFPYFVKLDYLLKQSQI-IKNDQLFIKCFV 1570
            C  C  ++  A    CG RYC  C+   L       C      PGS     + ++  D     D +IN  I +L V C  + C +   L   E+H   C+   + C    IGC    +R+       L+   P+NK   +   +     E++ +        +++    K +  C+     +I   FK    K  + E+ +   H   L  E+VR  Q       ERT       L L  G  E         +   +LH+  + L   VGQ    L+ L++ +  ++N +  L   + + +  V  + + N +N                     ++QI   Q  +    D   +  F+W++ D S+ L+          +S +F+ S  G+K  M LY   +G+GK      L+F I++G YD +L WP +  VT  +++Q  +   +   R     P+    ++++P SE N  +G P F  L  L       +K+D LFIKC V
Sbjct:   29 CSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSM-MLTLDHFFS-DNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGCGLMVLRKTLATH--LEKGCPNNKTTCQVCCSALTPAELQSVTYFSLFLKDSKQESPKRKETCV---FSEIGCTFKGNPDKVREHEVSSTSAHLHLL-VEVVRNVQMSVPPPPERTVQYPALDLTLNGGELETDSGDTGANDKALSLHDDQAELE--VGQ---QLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNMNLIQHLEAVVAEQQQRLIRKDLQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGT-HISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQREHVVDAFR-----PDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVV 514          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 91.2781 bits (225), Expect = 4.513e-19
Identity = 63/220 (28.64%), Postives = 107/220 (48.64%), Query Frame = 2
Query:  953 LTNSLNLLKEEVDDLDNEMDNLT-------ENISELKENVNGINKTNESNEVQIDKTQLKLDN----RVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPN--DFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            L N + +L  EV+     ++ LT       E I  L   V  + +T    ++Q+ +++  L        +  F+WK+ DFS+  ++        +FS +F+ S+ GYKM L    NG G  +G    L+F ++RG YD +L WP    VTL +++Q  +   +   R     P+    ++++P SE N  +G P F  L  L  +S  +++D +FIK  V
Sbjct:  312 LENIVCVLNREVERTVLRLEALTRQQQLDQEKIENLSNKVRQLERTLTMRDLQLAESEQALRELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTLMLLDQNNREHIIDAFR-----PDISSTSFQRPISEMNIASGCPLFCPLAKLAGKSSYLRDDTIFIKAIV 526          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 90.8929 bits (224), Expect = 6.099e-19
Identity = 123/528 (23.30%), Postives = 207/528 (39.20%), Query Frame = 2
Query:  227 CLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYC------PGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYV---------------NNLRKEIEELNTQMVKTKTENVCLIES--LEKIKKNFKLEQSKFMK-EIKAMKVHASSLDTEIVRLKQ-------ERT----------HGQDLEKLNLLEGRQEKIE---------ESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESN---------------------EVQIDKTQLKL----DNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYK--MSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPN--DFAYRKPRSERNDGNGFPYFVKLDYLLKQSQI-IKNDQLFIKCFV 1570
            C  C  ++  A    CG RYC  C+   L       C      PGS     + ++  D     D +IN  I +L V C  + C +   L   E+H   C+   + C    IGC    +R+       L+   P+NK   +                 N   K++ +   +   +K E+    E+    +I   FK    K  + E+ +   H   L  E+VR  Q       ERT            QD+  L  +     ++E         +   +LH+  + L   VGQ    L+ L++ +  ++N +  L   + + +  V  + + N +N                     ++QI   Q  +    D   +  F+W++ D S+ L+          +S +F+ S  G+K  M LY   +G+GK      L+F I++G YD +L WP +  VT  +++Q  +   +   R     P+    ++++P SE N  +G P F  L  L       +K+D LFIKC V
Sbjct:   29 CSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLICTKCKEDPGSESDSSM-MLTLDH-FFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPC---NIGCGLMVLRKTLATH--LEKGCPNNKTTCQVCCSALTPAELQKHSCSNGTEKDLSKAEKRKKDSKQESPKRKETCVFSEIGCTFKGNPDKVREHEVSSTSAHLHLL-VEVVRNVQMSVPPPPERTVQYPALDLHLQNQDMTPLPDITLNGGELETDSGDTGANDKALSLHDDQAELE--VGQ---QLHALQQRLQIMENIITALNREVEKTQLTVVVLERDNHNNMNLIQHLEAVVAEQQQRLIRKDLQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGT-HISLFFVIMKGDYDPLLSWPFKQKVTFFLIDQNQREHVVDAFR-----PDLRSASFQRPVSEMNVASGCPLFFPLSKLRSPKHAYVKDDTLFIKCVV 537          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 5.476e-23
Identity = 93/398 (23.37%), Postives = 172/398 (43.22%), Query Frame = 2
Query:  416 RISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENL-HEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQI---DKTQLKLDNRV--------NKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            R  +  + CP +  E +     +  HL  C  K   C +S+ GC K +     + EH    +  H  L+     NL  ++  L +Q+ +       L   + +++K               + V  ++   E V    +R      E+L  L   QE ++ +     H+A   L G +     +L+ L   V  ++    ++T   S     +  ++     ++ Q+   D    ++D R         N + +WK+ D+++  ++  +  T  ++S  F+ S  GY+M   A  NG G  +G    L+F ++RG YD +L WP +  VTL +++Q     QLS T  ++  P   ++R+P S+ N  +G P FV     L+ +  +++D +FIK  V
Sbjct:   97 RCPRYPIPCPNKCEEQSIAREELVSHLGICPYKQAECFFSQFGC-KYKGTLQGLKEHESGATQQHLSLVTARSANLELKVSMLQSQLAERANSADLLGTRVRELEKEL-------------ISVGQTASKNESVLCVVQRMLAVQTERLLRL---QESMQGTTRRADHDA---LRGDLDGTAATLHELGTRVAAIEESGGSVTH--SSTPTRLAALDSALSRHDTQLFAHDTRLAEMDLRFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSDT--FKPDPASSSFRRPTSDMNIASGCPLFVS-HVALESASYLQDDTIFIKVVV 469          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.8113 bits (216), Expect = 5.509e-19
Identity = 86/392 (21.94%), Postives = 157/392 (40.05%), Query Frame = 2
Query:  422 SQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANST--LNGTVGQLTNSLNLLKEEVDDLDNEMDNLT--ENISELKENV----NGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            +Q  + CP    E     + + +H+  C      C +  +GC   +     V EH       H  L++   + L  +   L            C IE    + +      ++  +++        S +T +         G  LE L        +  E +++LH A      +     L   +  L+E +  L+  + N    E    + E      +G+  T E   +Q+ +T        + + +WK+ D+++  +   +  T  ++S  F+ S  GYKM   A  NG G  +G    L+F ++RG YD +L WP +  VTL +++Q      LS T  +   P   ++R+P  + N  +G P FV     L+ S  + +D +F++  V
Sbjct:   57 AQYPLPCPNNCEEHGIPRAELSQHMSACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTLVISRNSELELQCARLQ-----------CSIEDHTNMSEMLTQRVAQLEQDLSHWSTLTGSNNTRL---------GSTLEMLT-------QHNEQLQSLHVAQRAPQRDADTAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLTMHDGLLDTAE-RRLQVLETA-----GYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSDT--FTPDPASGSFRRPDGDMNVASGCPLFVS-HVALEGSSYLVDDTVFVRVVV 412          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 85.8853 bits (211), Expect = 4.669e-18
Identity = 112/520 (21.54%), Postives = 207/520 (39.81%), Query Frame = 2
Query:  206 PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGI-NLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHL--------------LKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEI-VRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVD------DLDNEMDNLTENISELKENV----NGIN----KTNESNEVQIDKTQL--KLDNRVNKE--------FIWKLEDFSKVL----------ENCENSATKMIFSDSFFISENGYKMSL-------YACPNG-------LGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            PL     C IC   +      PCG R+C  CI   +   D      +   C + N +  +  +  D      I  LTV+CP + C    EL  ++EH   C+   V C   E+  C+ ++ +++  E +               KDS  H ++    V N +   +EL  + +    E  C    +         E ++ ++ + A  +H     T++ +RL     +G  + ++ + +G Q            + S L+ T G    +    + +        D   E+D L E    L+E V    + I     KT+    +  + T+L   L+ RV +         F W++E FS++L          +     A  ++ S  F+    GY++ L          P G       L   +    L+ ++++G YD  L WP +  + + +V+Q  + S +  T + +  P   A+++P   RN  G G+  F+ ++ L  +S  +++D L ++C V
Sbjct:   58 PLESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRD------AGPKCPVDNAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPCVRCEMPVCRRDLAKHEEQECMRRIVTCLHCCEKMAYKDSKNHEQMCPLVVVNCKHCQQELIREQLGPHLEVDCQQAQVPCTFSPLGCE-AQMVRSLLAAHMHE---HTQVHMRLL---ANGLKILRIQVGQGAQPSSAAGSSAPPNSLSWLSSTSGGDVQTAGASRSQGSRDRAACDCAQELDRLREITRTLEERVVLQLHQIRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQCERDS-VHVTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTLHHRS-YLRDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 8.389e-7
Identity = 34/136 (25.00%), Postives = 57/136 (41.91%), Query Frame = 2
Query:  956 TNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATK--MIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQI 1357
            T   N+ ++E   L N+M  +  +  E + ++ G+ +     E          +   N  F+WK++     L    N A +   I S +FF +  GY++ L  C     +S      Y  +  GPYD  L WP Q+
Sbjct:  277 TRQGNIDRDETARLQNKMARVEHSDQETERSILGLTRRLAELE----------NTAYNGMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLC-----RSGEHVSAYAMLGPGPYDATLAWPYQL 397          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 110.538 bits (275), Expect = 6.799e-26
Identity = 113/526 (21.48%), Postives = 214/526 (40.68%), Query Frame = 2
Query:  197 LINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMET--CEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSF-PHN------KLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLE---------KIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRL------KQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENI------SELKE--------------------------NVNGINKTNESNE-------VQIDKTQLKLD----NRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
             + PL+    C +C   + +    PCG R+C  C++  L G  +  CP   +   I+ +   +D+C  R I      L   CP     CE+  +L  +EEH  +C+ K V C       C+ +V +  +  HL +  F P +      ++    + +  +  E+          E +C  E L          ++  +F      F    +A++ H     +  V L       +E+   +   KL+ +E  + K +E +    EA +  N  +      LN+++  V +   E+  L E I      + ++E                              + +  + NE       +Q+ +  LKL        +  +IWK++++++  +   +  T  I+S  F++   GYK      PNG G  KG    L+F ++RG +D +L WP +  VT ++++Q  +   +  T  +   P   ++++P S  N  +G P F+    L  ++  +++D +FIK  V
Sbjct:   11 FVEPLDPKYRCPVCGNALKHPVQTPCGHRFCEGCLEPILRGPSK--CPVDGEELKIDGVF--KDVCCRREILC----LACYCPNRQLGCEWMKDLQYLEEHRANCEYKGVQCHNPG---CQEKVAKRDLEAHLERCEFKPSDCQYCLQRIPAASMEDHLQTCEKHPVVCPHCGAEGICRDELLHHQTNICEQAELPCSFAKHGCHFKGTREALETHFRDQASVHVNLLLTATQNEEKARSEMAAKLSQMEKERAKQQEQMYEQREALAVANQNLRTYQGKLNVIERSVAEQRRELAELKERIQLQEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALERRQDRNEHQLALHDIQLAEHDLKLQMLEATSYDGTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQ-DRVHDIGDT--FRPDPTSSSFKRPTSNMNIASGCPLFISHTNLQTRA-YVRDDTMFIKIAV 521          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 106.301 bits (264), Expect = 1.456e-24
Identity = 124/500 (24.80%), Postives = 207/500 (41.40%), Query Frame = 2
Query:  194 KLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSK---------------FMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKL----EDFSKVLENCENSATKMIFSDS---------------FFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFA------YRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            + I P N++L C IC  ++       CG  YC  CI++  NG +   CP  N+    + I  D+     ++  I +S L VKC    C +  EL   ++HLK C  K V C    +  C  +V +  + +H     +   +LL     NL    ++  T   K       L     +I   FK  +S                  + I+  K   S L  E+ +++QE    +  + +  +   +EK +E++ +       L+   G  +N+++  KE++D L  E+   +E I   ++N + I K + + + Q            +  F+W++    + + K +    N   K   SDS               F+ S  GYKM L A PNG G  KG    L   I++G YD IL WP +  +TL ++NQ  +W     +   E  P+D        + +P    N G G+  F+     L     IK+D +FI+  +
Sbjct:   19 QFIIPPNDELICAICHMVVNEPVLTSCGHSYCKYCIEKWCNGKEVVTCPVDNEQLKPSQIFPDK-----KTDRIVLS-LEVKCTNNPCRWKGELRQKQKHLKICSHKAVKCI---LEGCNVKVPRILMEKHTNTCGW---RLLHCKPCNLSYPKKDEETVQHKDDCPLAFLPCRFSEIGCTFKGRESARDEHCESAVQTHLHIACETIRDNKEQISDLHKELDKVRQE-LQTKSCDHMKEVNAIREKHDEAIRDNKGQIEALSKEHGIASNTIHENKEQLDTLKKELGIASETI---RKNRDQIAKLSTACKTQY----------TDGTFVWRICNYKDKYKKAVAFATNQEVKGGNSDSDDDISMAGDIMVSLPFYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQSEQWR----SETVEIYPDDATPDKKHKFERPIENENVGCGYSCFIS-HMELNSGDYIKDDVIFIEAVI 487          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 100.908 bits (250), Expect = 8.408e-23
Identity = 113/470 (24.04%), Postives = 201/470 (42.77%), Query Frame = 2
Query:  206 PLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPME---TCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQM-----VKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLK---QERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRV-NKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTR-LYENL---PNDFAYRKPRSERND-GNGFPYFVKLDYLLKQSQIIKNDQLFIK 1561
            PL     C IC   + +    PCG R+C  CI++ +       CP  N          +R++  D      +    V C ++    C +   L  +EEHLK C      CP      C   +++ +V++H   ++ P+  +  ++   ++  I ++   +     + T   N C             + Q K + +  A      S+  +  ++K   ++ +HG      +  E R+E + +S  N+      L     +    L  L+ +V+D+    D     I+EL   +           ++++  +++L+ RV N  FIWKL++F +  E      T  I S  F+ S  GYKM L    NG+    G    L+ ++++G +D IL WP    +TL I++Q     Q+   R + E L   PN  A+++P S RN  G G+  F  +D L  + Q IKN+ + ++
Sbjct:   51 PLESKYECPICLLGLRDPVQTPCGHRFCFNCIRRSIRDAGPK-CPVDNTPLS------ERELYRDNFAKREMMSFIVWCRLKKERGCTWKGALKELEEHLKGCPCMDTNCPNE----CGAVMQRKEVDKHC-AEACPNRSVPCDHCK-MKVTISKIEEHLKGCPCMDTNCPNEC-----------GAVMQRKEVDKHCAEACPNRSVPCDHCKMKSSKEQASHGPQEHTPHEAELRREALFQSA-NMQREVDMLGSRGDEYRQFLAYLERKVEDVKTSSDR---RIAELTHKL-----------MRLETREIELEGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQS---DQIDSRRPISETLVAKPNLLAFQRPTSPRNHKGYGYVEFCPIDQLT-EGQYIKNNSILVR 477          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 93.2041 bits (230), Expect = 3.093e-20
Identity = 114/487 (23.41%), Postives = 201/487 (41.27%), Query Frame = 2
Query:  227 CLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFD--RDICIDRSINIRISQLTVKC--PMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEE--------SVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGIN-KTNESN----------EVQIDKTQLK------LDNRVN--------KEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKM--SLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            C  C+ I+ +A    CG RYC  CI   L+       P     CG  +   +  RD   DR I     +L V C      C +  EL   + H   C+   + C + E   C  ++   K+ EHL  +               R+E      Q V        + E  EK   ++ +   K  KE+  ++VH++    E  RL++ R     LE L   E R +K+E+         ++++  + +  N  +G +   +  ++ +  D +  +      + EL+  V  +N K  ES+          E+    T L+      L+ R+N           +WK+ + +       +      +S  FF   +GYKM   +Y   +G+G++     L+F I+RG +D +L WP +  VTL +++Q      +     +   P+  ++++PR+E N  +G P F   +  L Q   I++D +F+K  V
Sbjct:   24 CAKCRLIVKDAVQTACGHRYCSPCISPLLSRG-----PIQCDVCGSTITKPETFRDKFADREI----LELHVHCVNQPHGCPWEGELRHRQNHHTKCEFNPISCVHPE---CGKKLSVAKLPEHLQNEC------------QYREETCSYCEQPVVVAR----MKEHHEKTCPSYPVNCPKCSKELIRVEVHSTPFTRE-PRLEKGRGCENTLEVLEDHESRIKKLEQRGGGIGVNGLQSMRISENIDNEAIGDVLRRVANVEAKGADHEVLVVEAHSAVDELRREVGRLNVKLQESDDIIRRLERQLELHDQGTGLRNLAIADLEERLNTLQGTTFDSVLLWKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNH-HVSLFFVIMRGEFDALLRWPFRQKVTLMLLDQDNVEHVIDA---FRPDPSSSSFQRPRAEMNIASGCPLFCSHEQ-LTQHAYIRDDTMFLKIIV 476          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 90.8929 bits (224), Expect = 1.319e-19
Identity = 111/477 (23.27%), Postives = 205/477 (42.98%), Query Frame = 2
Query:  197 LINPLNEDLTCLICKGIMINASN-APCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCP--METCEFTDELSMMEEHLKDCDRKFVGCPYSEIGC---CKPEVRQNKVNEHLLKDSFPHNKLLVEYVN--NLRKEIEEL--NTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEI------VRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFA-----YRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIK 1561
             + PL +   CL C+G++       PCG R C +C  + L+ + +  CPG       N+ D      ID++ +  I +L VKC      C++   ++    H++ CD       YS+I C   C  + ++  + +HL KD  P   +   Y +  +LRK+ +    N  ++     N C                       K + +H   LD+ +       +L  E        ++  LEG       S E + + N T      ++   L L  +E+      +   +E +SE    +       E +E +++     L+   + + IW++ED+++ ++  +   T  +FS +F  S++GY++    C NG GK KG    ++ ++++G +D +L WP    VT  +++Q    +Q    R +   PN  A       +PR E+N   G   F K + ++ ++  IK D +F+K
Sbjct:   35 FVYPLQKKYICLDCEGLLWYPVQIKPCGHRVCTKCYTKLLSSSAR--CPGCMDELNENIPD------IDKAFHEEIQELDVKCRNVEWNCKWEGCVNEFSSHVEKCD-------YSDILCENDCGAKFQRRFLTKHLDKDC-PEKLITCLYCDEKHLRKDKKGHLENCPLLPCPCPNKC----------------------DKKLTIHRCELDSHVENDCPRTKLMCEYEVLGCGHRITGLEGGG-----SREKMPKHNKTNIIAHVKMVADLALKNKEL------IMRFSEKLSEHGTLI-------EKHEKRLND----LEKIAHSQLIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPAQRKHIR-FSIKPNPCADNEPFLGRPRLEKNASFGGAKFAKHEEIVSRN-YIKEDTIFLK 449          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 103.99 bits (258), Expect = 3.258e-23
Identity = 88/373 (23.59%), Postives = 167/373 (44.77%), Query Frame = 2
Query:  488 EHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKA--MKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEAN---STLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKE----FIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPN--DFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            +H+K C +    C +  +GC    V + K+++H  + S+ H  LL+ ++  ++  +E L  Q ++  ++    +  L +  ++ +L  S+  +   A    V A++L T    L        +L+    L+  + K+ E      E     ST    V  L   L      ++  + +     + I  L   V  + +T    ++ I + + K+ +         FIWK+ DF+K  ++        +FS +F+ S+ GYKM L    NG G  +G    L+F ++RG  D +L WP    VTL +++Q  +   +   R     P+    ++++P S+ N  +G P F  L  L  ++  I+++ +FIK  V
Sbjct:  205 DHIKFCSKFKAPCRFHVVGC-DTSVEKEKIHDHERQCSYEHLNLLLHFIMGIKVSLESLQPQRLEVASQK---LHELHQSLRDLELRMSQLGRSGTAPLQGVCAATLATSFTPLHSAMGAALELQ----LQSEKTKVAELSRRCQELELKVSTFENIVCILNRELERSCATMEAYNRQHRLDQDKIEILSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNREHIIDAFR-----PDISSSSFQRPVSDMNIASGCPLFCPLSKLDSKNSYIRDETIFIKAIV 564          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000001369.2 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:101170323])

HSP 1 Score: 103.219 bits (256), Expect = 5.957e-23
Identity = 133/556 (23.92%), Postives = 218/556 (39.21%), Query Frame = 2
Query:  182 ENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGT--DQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKC---PMETCEFTDELSMMEEHLKDC-------------------------------------------------DRKFVGCPYSEIGC---CKPEVRQNKVNEHLLKDSFP--HN----KLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSK-FMKEIKAMKVHASSLDTEIVR---------LKQERTHGQDLEKLNLLEGRQEKIEESVE-NLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEM---DNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEF---------IWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENL-----PNDFAYRKPRSE--RNDGNGFPYFVKLDYLLKQSQI--IKNDQLFIK 1561
            +++ K +  L E+  C ICKG+++N     CG  YC  C++  L  +      CP       I   +  +D C  R     IS L V C   P+  C     L+ ++EHLK C                                                 D     CP  ++GC   C   V +N++ EH   +S P  H     K+    V   R++        VK   E       L  +K +  LEQ   F+++   ++      DT ++          L+Q R+    +        RQE    SV+ +L + +  +    G   + L   K  +D +  E+   + L E+I+ L+EN     +   S  +++   QL L+ +  +E          IWK++DF K  E         + S  F     GYKM++ A  NG G+ +G    LY  ++ G +D +L WP +  V+L +++Q       SG R +++      P +  + +P +E   N   GFP F+ LD L        +K+D LF+K
Sbjct:   53 QHSLKFVMKLKEEFICPICKGVVLNPQQNSCGHIYCFHCLQGLLESSLLSGPVCPVEKA--AITPSEVFQDNCCKR----EISSLEVYCTNSPL--CTSVLALNQLQEHLKSCQYEQLLCSNPGCTELLQRRLLQEHLNATCPHRRESCPHCLQPFQLSVIQDHVQSSCPEVKVGCPDGCSTLVPRNRLTEH--GESCPEVHTDCSFKMFGCSVKGKRRK--------VKLHEEAAVCHHVLLVLKSSAHLEQQVVFVQKEALLRQQEVQTDTLLLSDLQEQLGSVLQQSRSQEHIVATAQRTLSRQEDALSSVQLDLQQVSCGM----GSGLDELRRFKTSLDGVMQELLAAETLREHIATLEEN-----RKRHSGLLELHVAQLALNKQHLQELELTSYDGRLIWKIKDFQKRREAEATGQHPCLSSVPFHTGRCGYKMAMKAYLNGDGEGRGTHLSLYVVLMPGDFDALLPWPFKQTVSLSVLDQ-------SGARNHQSFNFRPDPTNTCFHQPAAESASNVAVGFPCFISLDALEAPGNAVYVKDDTLFVK 574          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 94.3597 bits (233), Expect = 3.417e-20
Identity = 93/375 (24.80%), Postives = 156/375 (41.60%), Query Frame = 2
Query:  488 EHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEI----------EELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKE-NVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPN--DFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            +H K C +    CP+SE+GC K  V   K++EH    +  H +LL+  V ++ +            E+    + +   +      S+  +  + K+   + +  +   +V  SSL  E        +H   L+        QEKIE            L+  + QL  SL      V DL  ++    + + EL+    +GI                         F+WK+ DFS   +   +     +FS +F+ S+ GYKM L    NG G  +G    L+F ++R  YD +L WP    VTL +++Q  +   +   R     P+    ++++P SE N  +G P F  L  L  +S  +++D +FIK  V
Sbjct:  200 DHAKSCAKSKSACPFSEVGC-KSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCVLNREVERSSLTLEAF------SHQHRLD--------QEKIE-----------NLSNKIRQLERSLT-----VKDL--QLSEAEQMVRELQYCTYDGI-------------------------FVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAFR-----PDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 511          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 94.3597 bits (233), Expect = 3.679e-20
Identity = 93/375 (24.80%), Postives = 156/375 (41.60%), Query Frame = 2
Query:  488 EHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEI----------EELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKE-NVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPN--DFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            +H K C +    CP+SE+GC K  V   K++EH    +  H +LL+  V ++ +            E+    + +   +      S+  +  + K+   + +  +   +V  SSL  E        +H   L+        QEKIE            L+  + QL  SL      V DL  ++    + + EL+    +GI                         F+WK+ DFS   +   +     +FS +F+ S+ GYKM L    NG G  +G    L+F ++R  YD +L WP    VTL +++Q  +   +   R     P+    ++++P SE N  +G P F  L  L  +S  +++D +FIK  V
Sbjct:  207 DHAKSCAKSKSACPFSEVGC-KSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCVLNREVERSSLTLEAF------SHQHRLD--------QEKIE-----------NLSNKIRQLERSLT-----VKDL--QLSEAEQMVRELQYCTYDGI-------------------------FVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNREHIIDAFR-----PDITSTSFQRPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKAIV 518          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 92.0485 bits (227), Expect = 2.793e-19
Identity = 94/405 (23.21%), Postives = 168/405 (41.48%), Query Frame = 2
Query:  488 EHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHAS------------------------------SLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLT-------ENISELKENVNGINKTNESNEVQIDKTQLKL----DNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKG-FFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPN--DFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFV 1570
            +H+K C +    C +  +GC    V + K+++H    ++ H  LL+ Y+  ++  +E L  Q ++T      L+E L+K  ++ +   S+         V  +                              S+ T    L    + G  LE    L+   EK +  V  L    + L    G   N + +L  EV+     M+          + I  L   V  + +T    ++ + + + +L        +  FIW++ DF+K  ++        +FS +F+ S+ GYKM L    NG G  +G    L+F ++RG  D +L WP    VTL +++Q  +   +   R     P+    ++++P SE N  +G P F  L  L  ++  I++D +FIK  V
Sbjct:  204 DHIKFCSKFRTPCRFHVVGC-DMSVEKEKIHDHERAFAYEHLNLLLHYIMGMKVSMEGLQPQGLETAGHK--LVE-LQKSLRDLEARVSQLSTTSSGPPVQGAAASSSSSSSGPPGPPASVPLPPPPTLPPTLSVSTSFTPLPS--SVGAALE----LQLHSEKTK--VAELGRRCTELEVKSGTFENVVCVLNREVERFTTTMEASNRQHKLDQDKIEALSNKVRQLERTVGLKDLTVAEMEGRLREMAATTFDGVFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSNREHIIDAFR-----PDVTSSSFQRPVSEMNIASGCPLFCPLSKLDAKNSYIRDDTIFIKAIV 591          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014698.1 (SMESG000014698.1)

HSP 1 Score: 1045.8 bits (2703), Expect = 0.000e+0
Identity = 511/520 (98.27%), Postives = 515/520 (99.04%), Query Frame = 2
Query:   23 MPFCMILTTNTVENFLLAVRQFSIVELTNQRIALNFLTKYFMANLEITWKIIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFVCLYK 1582
            MPFCMILTTNTVENFLLAVRQFSIVELTNQRIALNFLTKYFMANLEITWKIIKENNFKLIN L+EDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEF DELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQN+VNEHLLKDSFPHNKLLVEYVNNLR EIEELNTQM+KTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLD EIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLK+EVDDLDNEMDNLTE ISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFVCLYK
Sbjct:    1 MPFCMILTTNTVENFLLAVRQFSIVELTNQRIALNFLTKYFMANLEITWKIIKENNFKLINHLDEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFMDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNEVNEHLLKDSFPHNKLLVEYVNNLRNEIEELNTQMIKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDAEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKDEVDDLDNEMDNLTEKISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFVCLYK 520          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014698.1 (SMESG000014698.1)

HSP 1 Score: 961.444 bits (2484), Expect = 0.000e+0
Identity = 470/479 (98.12%), Postives = 474/479 (98.96%), Query Frame = 2
Query:  146 MANLEITWKIIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFVCLYK 1582
            MANLEITWKIIKENNFKLIN L+EDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEF DELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQN+VNEHLLKDSFPHNKLLVEYVNNLR EIEELNTQM+KTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLD EIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLK+EVDDLDNEMDNLTE ISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFVCLYK
Sbjct:    1 MANLEITWKIIKENNFKLINHLDEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFMDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNEVNEHLLKDSFPHNKLLVEYVNNLRNEIEELNTQMIKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDAEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKDEVDDLDNEMDNLTEKISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFVCLYK 479          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014702.1 (SMESG000014702.1)

HSP 1 Score: 928.702 bits (2399), Expect = 0.000e+0
Identity = 456/479 (95.20%), Postives = 465/479 (97.08%), Query Frame = 2
Query:  146 MANLEITWKIIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFVCLYK 1582
            MANLEITWKIIKENNFKLINPLNEDL CLICKGIMINASNAPCGCRYCCQCIKQHLNG DQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQN+VNEHLLKDSFPHNKLLVEYVNNLR EIEELNTQM+KTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTE+    QERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTN+SNEVQIDKT +KLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLYFN+VRGPYDDILFWPCQIDVTLEIVNQ+TK  QLS T+LY+NLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKND LFIKCFV L K
Sbjct:    1 MANLEITWKIIKENNFKLINPLNEDLICLICKGIMINASNAPCGCRYCCQCIKQHLNGADQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNEVNEHLLKDSFPHNKLLVEYVNNLRNEIEELNTQMIKTKTENVCLIESLEKIKKNFKLEQSKFMKEIKAMKVHASSLDTEVY---QERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNKSNEVQIDKTSVKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLYFNVVRGPYDDILFWPCQIDVTLEIVNQITKMGQLSDTKLYKNLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDLLFIKCFVRLNK 476          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000021123.1 (SMESG000021123.1)

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 320/486 (65.84%), Postives = 402/486 (82.72%), Query Frame = 2
Query:  146 MANLEITWKIIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEI-------KAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFVCLYK 1582
            MA LEITWKII E NF+LINPLN+DL CLICKGIM+NA+NAPCGCRYCC CIK++LN TD NYCPG +KYCGIN IDFDRDIC+DRSINIRISQL VKCPMETC+FTDELSMME+HLKDCDRKF+GCPYSEIGCCKP++R+++VN+HL  +SFPHNKLLV+YVNNLR E+E LN+++    TEN+CL ++L K  K F+ +Q  F +EI        +MK+  +SL+ ++  LKQ+       E+L LLEGRQEK EESV  L+EAN+T+NGTV +LTN +N LKE+V  L+NE+D+LTE++S+L+++V+ IN + ES E++IDK Q++LDN  NKEFIWKLEDF++V+ENC+  +TKMI SD FF+SENGYKM LYA P GLGKS GFFG+YFNI++GPYDD+L WPCQIDVT E++NQ TK S +S  +L+EN P+  AY+KP +E+N+G G+PYF+KLDYLLKQ+Q+IKNDQLFIKCFVCL K
Sbjct:    1 MAKLEITWKIISEKNFQLINPLNDDLICLICKGIMVNATNAPCGCRYCCLCIKKYLNETDDNYCPGLSKYCGINWIDFDRDICVDRSINIRISQLIVKCPMETCDFTDELSMMEKHLKDCDRKFIGCPYSEIGCCKPDIRKDEVNKHLFNESFPHNKLLVDYVNNLRNEMEALNSKISAITTENICLAKTLAKSNKKFEFQQRTFKREIDKLTKENNSMKIQINSLNIKMTVLKQDEKQVLVQERLGLLEGRQEKTEESVGKLNEANTTINGTVDRLTNDMNSLKEDVGSLNNEIDDLTEDVSKLEDSVDEINTSKESYEMKIDKIQVQLDNLSNKEFIWKLEDFTEVVENCKTKSTKMIISDFFFVSENGYKMGLYAYPKGLGKSAGFFGIYFNIIKGPYDDLLCWPCQIDVTFELINQETKCSFISKKKLFENNPDHTAYQKPTTEKNNGLGYPYFIKLDYLLKQNQLIKNDQLFIKCFVCLNK 486          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014706.1 (SMESG000014706.1)

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 308/523 (58.89%), Postives = 369/523 (70.55%), Query Frame = 2
Query:  146 MANLEITWKIIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLLVEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNF----------------------------------------------KLEQSKFMKEIKAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEANSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTNESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFFISENGYKMSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLEIVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLKQSQIIKNDQLFIKCFVCL 1576
            MANLEITWKIIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQL VKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQN+VN+HLL DSFPHNKLLVEYVNNLR EIEEL TQM KT TEN CLIE+L + +K F                                              K E S+ ++E KA+ +H +SL  EI  LK+E    +  + L  LEG+QE+IE  V+    AN  ++  V QL  ++N L+  +D +  ++D  TE +               S E ++   + + DN+ NK FIWK+E+FSKV+ + + +  K I+SDSFF+ ENGY+M LY CP GLGKS GF G+YFNI++GPYD+IL WPCQIDVTLE+++Q    +  S T+LY+   ++  Y KP S  N G+G+P+F+KLDYLLK +Q+ +N+QLFIKC VCL
Sbjct:    1 MANLEITWKIIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGTDQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLVVKCPMETCEFTDELSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNEVNKHLLNDSFPHNKLLVEYVNNLRNEIEELKTQMSKTNTENFCLIENLGESRKRFIYQQAVHKKEIDILAEENNAMKIQINSLNFKIGAFKQNEKQEQVQLKEEMSRLVEENKAIGIHINSLKAEIATLKKENKQEKLEKTLKGLEGKQEEIEGKVDFAERANKVISDKVEQLKETVNNLQGNIDSV--KLDIFTEKL---------------SFENRLSDLEERFDNQENKVFIWKIENFSKVIADAKQNRNKRIYSDSFFVFENGYQMCLYVCPIGLGKSSGFVGVYFNIMQGPYDNILAWPCQIDVTLELIDQDDGLAFKSSTKLYDFNSDNEVYEKPISGMNSGSGYPFFIKLDYLLKMNQLFRNNQLFIKCIVCL 506          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF64.541e-2624.68TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF64.541e-2624.68TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF54.825e-2526.42TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF54.825e-2526.42TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF54.825e-2526.42TNF receptor associated factor 5 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-24.325e-931.47TNF Receptor Associated Factor (TRAF) homolog [So... [more]
trf-12.152e-726.00TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf48.068e-1024.85gene:FBgn0026319 transcript:FBtr0334401[more]
Traf49.959e-1024.85gene:FBgn0026319 transcript:FBtr0077429[more]
Traf-like6.679e-924.89gene:FBgn0030748 transcript:FBtr0074275[more]
Traf-like6.854e-924.89gene:FBgn0030748 transcript:FBtr0308606[more]
Traf-like6.854e-924.89gene:FBgn0030748 transcript:FBtr0074274[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf32.774e-2423.32TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf2b5.319e-2223.55Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b6.903e-2223.55Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf2b6.903e-2223.55Tnf receptor-associated factor 2b [Source:ZFIN;Acc... [more]
traf62.134e-2022.45TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
egf3.006e-2724.04epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
slc12a11.253e-2327.20solute carrier family 12 member 1 [Source:Xenbase;... [more]
slc12a14.707e-2227.57solute carrier family 12 member 1 [Source:Xenbase;... [more]
ssh25.876e-2222.92slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh23.363e-2121.55slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf66.623e-2623.45TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf33.345e-2425.65TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf52.412e-2323.54TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf52.412e-2323.54TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf31.095e-2224.27TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B6CJY4|TRAF6_CERAT1.802e-2725.32TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
sp|B6CJY5|TRAF6_MACMU1.853e-2725.32TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
sp|Q28DL4|TRAF6_XENTR1.987e-2624.04TNF receptor-associated factor 6 OS=Xenopus tropic... [more]
sp|Q3ZCC3|TRAF6_BOVIN1.230e-2524.90TNF receptor-associated factor 6 OS=Bos taurus OX=... [more]
sp|B5DF45|TRAF6_RAT1.664e-2523.94TNF receptor-associated factor 6 OS=Rattus norvegi... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1E1012.538e-4026.29TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
T1DBK64.770e-3126.06TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A2C9K4L14.808e-2724.34Uncharacterized protein OS=Biomphalaria glabrata O... [more]
W5NEW65.734e-2726.01TNF receptor-associated factor OS=Lepisosteus ocul... [more]
A0A4W2CR268.116e-2625.85TNF receptor-associated factor OS=Bos indicus x Bo... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf53.501e-2422.32TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf2a3.105e-2124.41TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf13.057e-2023.82TNF receptor-associated factor 1-like [Source:NCBI... [more]
traf2b4.513e-1928.64TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf16.099e-1923.30TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.15.476e-2323.37pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.15.509e-1921.94pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf64.669e-1821.54TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000008091.18.389e-725.00pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO494646.799e-2621.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483941.456e-2424.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487738.408e-2324.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388733.093e-2023.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328511.319e-1923.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000020861.23.258e-2323.59TNF receptor-associated factor 2 [Source:NCBI gene... [more]
ENSORLT00000001369.25.957e-2323.92TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf2b3.417e-2024.80TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b3.679e-2024.80TNF receptor associated factor 2 [Source:NCBI gene... [more]
unm_sa8082.793e-1923.21TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000014698.10.000e+098.27SMESG000014698.1[more]
SMESG000014698.10.000e+098.12SMESG000014698.1[more]
SMESG000014702.10.000e+095.20SMESG000014702.1[more]
SMESG000021123.10.000e+065.84SMESG000021123.1[more]
SMESG000014706.10.000e+058.89SMESG000014706.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031687 ID=SMED30031687|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1602bp
TCCGATCTATATTTTGATCTGAATGCCATTTTGCATGATATTAACCACAA
ATACAGTAGAGAACTTCCTATTGGCTGTTAGGCAATTTTCTATAGTTGAA
CTGACCAATCAGAGAATTGCACTGAATTTTCTCACCAAATATTTCATGGC
AAACTTGGAAATAACTTGGAAAATTATCAAGGAAAATAATTTCAAATTAA
TTAATCCTTTGAATGAAGATCTGACCTGCTTGATATGCAAAGGGATAATG
ATAAACGCCTCGAATGCGCCTTGCGGATGCCGATATTGCTGCCAATGCAT
CAAGCAGCACCTGAATGGAACTGATCAGAATTATTGTCCAGGATCAAACA
AATATTGCGGCATCAATTTGATTGATTTTGATCGAGATATTTGCATTGAT
AGATCAATTAATATCCGCATATCCCAATTGACTGTCAAATGTCCAATGGA
AACGTGTGAATTTACGGATGAATTGAGCATGATGGAGGAACATTTGAAAG
ATTGCGATCGGAAATTTGTAGGTTGTCCATATTCTGAGATCGGATGCTGC
AAGCCGGAAGTCAGACAGAATAAAGTCAACGAACACCTTTTAAAGGATAG
TTTTCCACACAACAAATTATTGGTGGAATATGTCAATAACTTACGGAAAG
AGATTGAAGAATTAAATACCCAAATGGTAAAGACTAAAACGGAAAACGTT
TGTCTTATTGAAAGTCTGGAAAAAATCAAAAAGAATTTCAAACTTGAACA
ATCGAAGTTCATGAAAGAGATAAAGGCAATGAAGGTCCATGCTAGTTCTT
TGGATACTGAAATAGTAAGATTAAAGCAAGAACGAACTCATGGACAAGAC
CTAGAAAAATTGAACCTTTTAGAAGGAAGACAAGAAAAGATCGAAGAGAG
TGTGGAGAACCTTCATGAGGCAAACTCAACATTGAATGGAACAGTTGGTC
AATTAACAAATTCTCTGAATCTATTAAAAGAAGAAGTTGACGACTTGGAT
AACGAAATGGACAATTTGACTGAAAACATTTCGGAATTGAAGGAAAACGT
GAATGGAATAAATAAAACAAACGAATCCAATGAAGTACAGATTGATAAAA
CCCAACTGAAGTTAGACAATCGTGTCAACAAGGAATTCATATGGAAACTC
GAAGACTTTTCTAAAGTATTGGAAAACTGCGAAAATTCTGCAACCAAAAT
GATTTTCAGTGATTCATTCTTTATATCAGAAAATGGCTACAAAATGTCCC
TTTATGCGTGCCCAAATGGATTGGGGAAATCGAAGGGCTTTTTCGGGCTT
TATTTCAACATTGTGAGGGGTCCATATGATGACATCTTATTCTGGCCTTG
TCAAATTGATGTCACCCTTGAAATCGTAAATCAAGTAACAAAATGGTCGC
AACTGTCAGGTACGAGACTGTATGAAAATCTTCCCAACGACTTTGCATAT
AGAAAGCCGCGCAGTGAAAGAAATGACGGAAATGGATTTCCTTACTTTGT
CAAACTCGATTATTTATTAAAACAAAGTCAAATAATTAAAAATGACCAAT
TATTTATTAAATGTTTTGTTTGTTTATATAAATGACATCCACAACAATCC
AA
back to top

protein sequence of SMED30031687-orf-1

>SMED30031687-orf-1 ID=SMED30031687-orf-1|Name=SMED30031687-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=521bp
MPFCMILTTNTVENFLLAVRQFSIVELTNQRIALNFLTKYFMANLEITWK
IIKENNFKLINPLNEDLTCLICKGIMINASNAPCGCRYCCQCIKQHLNGT
DQNYCPGSNKYCGINLIDFDRDICIDRSINIRISQLTVKCPMETCEFTDE
LSMMEEHLKDCDRKFVGCPYSEIGCCKPEVRQNKVNEHLLKDSFPHNKLL
VEYVNNLRKEIEELNTQMVKTKTENVCLIESLEKIKKNFKLEQSKFMKEI
KAMKVHASSLDTEIVRLKQERTHGQDLEKLNLLEGRQEKIEESVENLHEA
NSTLNGTVGQLTNSLNLLKEEVDDLDNEMDNLTENISELKENVNGINKTN
ESNEVQIDKTQLKLDNRVNKEFIWKLEDFSKVLENCENSATKMIFSDSFF
ISENGYKMSLYACPNGLGKSKGFFGLYFNIVRGPYDDILFWPCQIDVTLE
IVNQVTKWSQLSGTRLYENLPNDFAYRKPRSERNDGNGFPYFVKLDYLLK
QSQIIKNDQLFIKCFVCLYK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0031625ubiquitin protein ligase binding
GO:0031996thioesterase binding
GO:0042802identical protein binding
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0008270zinc ion binding
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:0007165signal transduction
GO:0042981regulation of apoptotic process
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0051091positive regulation of sequence-specific DNA binding transcription factor activity
GO:0051092positive regulation of NF-kappaB transcription factor activity
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR027130TRAF5
IPR001841Znf_RING
IPR002083MATH/TRAF_dom
IPR013083Znf_RING/FYVE/PHD
IPR008974TRAF-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 239..259
NoneNo IPR availableCOILSCoilCoilcoord: 267..308
NoneNo IPR availableCOILSCoilCoilcoord: 209..229
NoneNo IPR availableCOILSCoilCoilcoord: 156..183
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 201..326
e-value: 1.6E-5
score: 26.8
NoneNo IPR availablePRODOMPD936484coord: 156..305
e-value: 0.002
score: 101.0
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 21..103
IPR002083MATH/TRAF domainSMARTSM00061math_3coord: 330..457
e-value: 2.9E-6
score: 36.8
IPR002083MATH/TRAF domainPROSITEPS50144MATHcoord: 328..475
score: 19.777
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 327..477
e-value: 1.3E-33
score: 118.0
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 328..478
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 95..150
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 11..131
e-value: 6.9E-13
score: 50.6
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 94..475
IPR027130TNF receptor-associated factor 5PANTHERPTHR10131:SF83TNF RECEPTOR-ASSOCIATED FACTOR 5coord: 94..475
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 28..65
score: 8.565