Gelsolin-like protein 2

Overview
NameGelsolin-like protein 2
Smed IDSMED30031686
Length (bp)1247
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gelsolin-like protein 2 (SMED30031686) t-SNE clustered cells

Violin plots show distribution of expression levels for Gelsolin-like protein 2 (SMED30031686) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gelsolin-like protein 2 (SMED30031686) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gelsolin-like protein 2 (SMED30031686) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031686

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30031686SMESG000015922.1 SmedASXL_006052SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30031686SMESG000015922.1 dd_Smed_v4_31589_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031686SMESG000015922.1 dd_31589dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031686SMESG000015922.1 dd_31589dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
headSMED30031686SMESG000015922.1 dd_Smed_v6_31589_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30031686SMESG000015922.1 SMED30031686smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30031686SMESG000015922.1 OX_Smed_1.0.17362ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gelsolin-like protein 2 vs. Ensembl Human
Match: VIL1 (villin 1 [Source:HGNC Symbol;Acc:HGNC:12690])

HSP 1 Score: 95.1301 bits (235), Expect = 1.373e-40
Identity = 44/94 (46.81%), Postives = 60/94 (63.83%), Query Frame = 2
Query:  152 LLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSK 433
            L IWRIE  +++  P+   G F++GD YIIL I +  + L YD+H+WIG+ S+ DE G A   T ++D  L  R VQHREVQ  ES+ F+ Y K
Sbjct:   19 LQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFK 112          

HSP 2 Score: 92.0485 bits (227), Expect = 1.373e-40
Identity = 68/245 (27.76%), Postives = 123/245 (50.20%), Query Frame = 1
Query:  412 SFQELFKE-LIYLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDI--------KPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLK---FDKSNLDENDVFIID-SGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            +F+  FK+ L+  KGG  SG + V   +Y+  RLLHVKG KR++   EV  + K+ N  DVF+LD G  I QW G  + + E+ +     +++ + +R  +  V V+D E  L + +    ++ +          V D     AL +  K ++ +SD  G+L   ++      +  L   D +I+D  G+++ V+ G+ ++  E+K ++ +A  ++K   +P  P T +  + DG     F  +F
Sbjct:  106 AFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLLHVKG-KRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALK-LYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYP--PSTQVEVQNDGAESAVFQQLF 346          
BLAST of Gelsolin-like protein 2 vs. Ensembl Human
Match: VIL1 (villin 1 [Source:HGNC Symbol;Acc:HGNC:12690])

HSP 1 Score: 94.3597 bits (233), Expect = 3.192e-40
Identity = 44/94 (46.81%), Postives = 60/94 (63.83%), Query Frame = 2
Query:  152 LLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSK 433
            L IWRIE  +++  P+   G F++GD YIIL I +  + L YD+H+WIG+ S+ DE G A   T ++D  L  R VQHREVQ  ES+ F+ Y K
Sbjct:   19 LQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGAAAIYTTQMDDFLKGRAVQHREVQGNESEAFRGYFK 112          

HSP 2 Score: 91.6633 bits (226), Expect = 3.192e-40
Identity = 68/245 (27.76%), Postives = 123/245 (50.20%), Query Frame = 1
Query:  412 SFQELFKE-LIYLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDI--------KPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIID-SGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            +F+  FK+ L+  KGG  SG + V   +Y+  RLLHVKG KR++   EV  + K+ N  DVF+LD G  I QW G  + + E+ +     +++ + +R  +  V V+D E  L + +    ++ +          V D     AL +  K ++ +SD  G+L   ++      +  L   D +I+D  G+++ V+ G+ ++  E+K ++ +A  ++K   +P  P T +  + DG     F  +F
Sbjct:  106 AFRGYFKQGLVIRKGGVASGMKHVETNSYDVQRLLHVKG-KRNVVAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESTRMERLRGMTLAKEIRDQERGGRTYVGVVDGENELASPKLMEVMNHVLGKRRELKAAVPDTVVEPALKAALK-LYHVSDSEGNLVVREVATRPLTQDLLSHEDCYILDQGGLKIYVWKGKKANEQEKKGAMSHALNFIKAKQYP--PSTQVEVQNDGAESAVFQQLF 346          

HSP 3 Score: 74.3294 bits (181), Expect = 5.521e-22
Identity = 67/225 (29.78%), Postives = 117/225 (52.00%), Query Frame = 1
Query:  424 LFK-ELIYLKGGCESGFRIVNVQT-YNPRLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEK------QIFRISDITGS-LKFEKLKFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK--ETGH-PQAPVTVLNK 1059
            +FK  ++  +GG     R  N++T  + RL  V+G   + T + EV A    LNS DVF+L T    + W GKG + DE+  A+     ++  R +K +V  ++ +E  +   F+  L    P  + K       QE+      ++F  S+ TG  L  E   F++ +L+E+DVF++D   +V  +IG++++ +E+K +   A EYLK   +G  P+ P+ V+ +
Sbjct:  491 IFKGRMVVYQGGTS---RTNNLETGPSTRLFQVQGTGANNTKAFEVPARANFLNSNDVFVLKTQSCCYLWCGKGCSGDEREMAKMVADTIS--RTEKQVV--VEGQEPAN---FWMALGGKAPYANTKRL-----QEENLVITPRLFECSNKTGRFLATEIPDFNQDDLEEDDVFLLDVWDQVFFWIGKHANEEEKKAAATTAQEYLKTHPSGRDPETPIIVVKQ 700          

HSP 4 Score: 50.0618 bits (118), Expect = 5.521e-22
Identity = 30/80 (37.50%), Postives = 45/80 (56.25%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILN---IKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHR 388
            +WRIE  +++   ++  G FY GD Y++L    I EK++ LLY    W G  ++QDE   + Y+ V LD   +  PVQ R
Sbjct:  402 VWRIENLELVPVDSKWLGHFYGGDCYLLLYTYLIGEKQHYLLY---VWQGSQASQDEITASAYQAVILDQKYNGEPVQIR 478          
BLAST of Gelsolin-like protein 2 vs. Ensembl Human
Match: GSN (gelsolin [Source:HGNC Symbol;Acc:HGNC:4620])

HSP 1 Score: 93.9745 bits (232), Expect = 1.515e-38
Identity = 46/103 (44.66%), Postives = 63/103 (61.17%), Query Frame = 2
Query:  131 KLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            K   +  L IWR+EKF ++  P    G F+ GD+Y+IL  ++ +   L YDLH+W+G   +QDE G A   TV+LD  L+ R VQHREVQ +ES  F  Y K+
Sbjct:   61 KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKS 163          

HSP 2 Score: 86.2705 bits (212), Expect = 1.515e-38
Identity = 70/229 (30.57%), Postives = 118/229 (51.53%), Query Frame = 1
Query:  412 SFQELFKE-LIYLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPV-----DDEKNFTALSSQEKQIFRISDITG----SLKFEKLKFDKSNLDENDVFIIDSGME--VIVYIGENSSPDERKKSLIYAHEYLKETGHP-QAPVTVL 1053
            +F   FK  L Y KGG  SGF+ +V  +    RL  VKGR R +  +EV  + ++ N+ D FILD G  I QW G  +N+ E+ KA Q  + + +++R+ +  V V   EE  +       L   KP      +D     A + +  +++++S+  G    SL  ++  F +  L   D FI+D G +  + V+ G+ ++ +ERK +L  A +++ +  +P Q  V+VL
Sbjct:  156 TFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGR-RVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHV--SEEGTEPEAMLQVLGP-KPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVL 380          

HSP 3 Score: 60.077 bits (144), Expect = 1.335e-18
Identity = 52/206 (25.24%), Postives = 95/206 (46.12%), Query Frame = 1
Query:  430 KELIYLKGGC-ESGFRIVNVQTYNPRLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEE------ETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLKFD--KSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK 1017
            K +I  KGG    G +     T   RL  V+      T + EV      LNS D F+L T    + W+G GA++ EK  A++ ++ L +       V+V +        E L     Y     +K   D+K    + +   ++F  S+  G    E++  +  + +L  +DV ++D+  +V V++G++S  +E+ ++L  A  Y++
Sbjct:  542 KPMIIYKGGTSREGGQTAPAST---RLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQP-----VQVAEGSEPDGFWEALGGKAAYRTSPRLK---DKK----MDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIE 732          

HSP 4 Score: 52.7582 bits (125), Expect = 1.335e-18
Identity = 35/87 (40.23%), Postives = 44/87 (50.57%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKE--KENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYES 409
            IWRIE    +       G FY GDSYIIL N +   ++  ++Y+   W G  STQDE   +   T +LD  L   PVQ R VQ  E 
Sbjct:  449 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEP 532          
BLAST of Gelsolin-like protein 2 vs. Ensembl Human
Match: GSN (gelsolin [Source:HGNC Symbol;Acc:HGNC:4620])

HSP 1 Score: 93.5893 bits (231), Expect = 1.864e-38
Identity = 46/103 (44.66%), Postives = 63/103 (61.17%), Query Frame = 2
Query:  131 KLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            K   +  L IWR+EKF ++  P    G F+ GD+Y+IL  ++ +   L YDLH+W+G   +QDE G A   TV+LD  L+ R VQHREVQ +ES  F  Y K+
Sbjct:   18 KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKS 120          

HSP 2 Score: 86.2705 bits (212), Expect = 1.864e-38
Identity = 70/229 (30.57%), Postives = 118/229 (51.53%), Query Frame = 1
Query:  412 SFQELFKE-LIYLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPV-----DDEKNFTALSSQEKQIFRISDITG----SLKFEKLKFDKSNLDENDVFIIDSGME--VIVYIGENSSPDERKKSLIYAHEYLKETGHP-QAPVTVL 1053
            +F   FK  L Y KGG  SGF+ +V  +    RL  VKGR R +  +EV  + ++ N+ D FILD G  I QW G  +N+ E+ KA Q  + + +++R+ +  V V   EE  +       L   KP      +D     A + +  +++++S+  G    SL  ++  F +  L   D FI+D G +  + V+ G+ ++ +ERK +L  A +++ +  +P Q  V+VL
Sbjct:  113 TFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGR-RVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHV--SEEGTEPEAMLQVLGP-KPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVL 337          

HSP 3 Score: 59.6918 bits (143), Expect = 2.167e-18
Identity = 52/206 (25.24%), Postives = 95/206 (46.12%), Query Frame = 1
Query:  430 KELIYLKGGC-ESGFRIVNVQTYNPRLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEE------ETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLKFD--KSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK 1017
            K +I  KGG    G +     T   RL  V+      T + EV      LNS D F+L T    + W+G GA++ EK  A++ ++ L +       V+V +        E L     Y     +K   D+K    + +   ++F  S+  G    E++  +  + +L  +DV ++D+  +V V++G++S  +E+ ++L  A  Y++
Sbjct:  499 KPMIIYKGGTSREGGQTAPAST---RLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQP-----VQVAEGSEPDGFWEALGGKAAYRTSPRLK---DKK----MDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIE 689          

HSP 4 Score: 52.7582 bits (125), Expect = 2.167e-18
Identity = 35/86 (40.70%), Postives = 44/86 (51.16%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKE--KENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
            IWRIE    +       G FY GDSYIIL N +   ++  ++Y+   W G  STQDE   +   T +LD  L   PVQ R VQ  E
Sbjct:  406 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKE 488          
BLAST of Gelsolin-like protein 2 vs. Ensembl Human
Match: GSN (gelsolin [Source:HGNC Symbol;Acc:HGNC:4620])

HSP 1 Score: 93.5893 bits (231), Expect = 2.008e-38
Identity = 46/103 (44.66%), Postives = 63/103 (61.17%), Query Frame = 2
Query:  131 KLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            K   +  L IWR+EKF ++  P    G F+ GD+Y+IL  ++ +   L YDLH+W+G   +QDE G A   TV+LD  L+ R VQHREVQ +ES  F  Y K+
Sbjct:   21 KAGKEPGLQIWRVEKFDLVPVPTNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKS 123          

HSP 2 Score: 86.2705 bits (212), Expect = 2.008e-38
Identity = 70/229 (30.57%), Postives = 118/229 (51.53%), Query Frame = 1
Query:  412 SFQELFKE-LIYLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPV-----DDEKNFTALSSQEKQIFRISDITG----SLKFEKLKFDKSNLDENDVFIIDSGME--VIVYIGENSSPDERKKSLIYAHEYLKETGHP-QAPVTVL 1053
            +F   FK  L Y KGG  SGF+ +V  +    RL  VKGR R +  +EV  + ++ N+ D FILD G  I QW G  +N+ E+ KA Q  + + +++R+ +  V V   EE  +       L   KP      +D     A + +  +++++S+  G    SL  ++  F +  L   D FI+D G +  + V+ G+ ++ +ERK +L  A +++ +  +P Q  V+VL
Sbjct:  116 TFLGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGR-RVVRATEVPVSWESFNNGDCFILDLGNNIHQWCGSNSNRYERLKATQVSKGIRDNERSGRARVHV--SEEGTEPEAMLQVLGP-KPALPAGTEDTAKEDAANRKLAKLYKVSNGAGTMSVSLVADENPFAQGALKSEDCFILDHGKDGKIFVWKGKQANTEERKAALKTASDFITKMDYPKQTQVSVL 340          

HSP 3 Score: 59.6918 bits (143), Expect = 2.391e-18
Identity = 50/203 (24.63%), Postives = 93/203 (45.81%), Query Frame = 1
Query:  436 LIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEE------ETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLKFD--KSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK 1017
            +IY  G    G +     T   RL  V+      T + EV      LNS D F+L T    + W+G GA++ EK  A++ ++ L +       V+V +        E L     Y     +K   D+K    + +   ++F  S+  G    E++  +  + +L  +DV ++D+  +V V++G++S  +E+ ++L  A  Y++
Sbjct:  505 IIYKGGTSREGGQTAPAST---RLFQVRANSAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELLRVLRAQP-----VQVAEGSEPDGFWEALGGKAAYRTSPRLK---DKK----MDAHPPRLFACSNKIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIE 692          

HSP 4 Score: 52.7582 bits (125), Expect = 2.391e-18
Identity = 35/86 (40.70%), Postives = 44/86 (51.16%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKE--KENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
            IWRIE    +       G FY GDSYIIL N +   ++  ++Y+   W G  STQDE   +   T +LD  L   PVQ R VQ  E
Sbjct:  409 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKE 491          
BLAST of Gelsolin-like protein 2 vs. Ensembl Celegans
Match: gsnl-1 (Gelsolin-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21253])

HSP 1 Score: 99.7525 bits (247), Expect = 3.168e-43
Identity = 62/213 (29.11%), Postives = 111/213 (52.11%), Query Frame = 1
Query:  442 YLKGGCESGFRIVNVQ--TYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPV-------DDEKNFTALSSQEKQIFRISDITGSLKFEKLK----FDKSNLDENDVFIIDS-GMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQ 1035
            Y+ GG ESG+R V+ Q   + P L H KG KR++  +EV     +LN  DVFILD G  ++ W+   + + E+ K     + + + +R     V ++D+ E  ++  F+++   +  V       DD+ N+    +++  ++++SD +G+ K   +       K  LD  D FI+D+    + V+IG   + +ER K+LI+   YLK+   P+
Sbjct:  114 YVSGGYESGYRHVDDQFKNWKPHLFHCKG-KRNVRCTEVECEVNSLNLGDVFILDLGKDLYVWMPPESGRLERIKGMARAKNIADHERMGIPKVHILDDVEWDNDSTFWSYFGGVSSVRKVSKGKDDDDNYWKRLTEQITLWKVSDASGAAKVSMVSQGENIRKEQLDPKDAFILDAINGGIFVWIGHECTLEERSKALIWGQNYLKQHHLPR 325          

HSP 2 Score: 94.7449 bits (234), Expect = 3.168e-43
Identity = 49/100 (49.00%), Postives = 64/100 (64.00%), Query Frame = 2
Query:  128 AKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSY 427
            A++  K+ LL+WRI KF +   P   +GVFY GD+YI L  K       +D+HFW+GK ++ DE G A  KTVE+D  L   P QHRE+Q+YES LF SY
Sbjct:   11 AEIGKKNGLLVWRINKFVLEPVPEVDHGVFYIGDAYIALYQKYDG---CWDVHFWLGKNASTDEIGVAAIKTVEIDDSLGGIPTQHREIQNYESPLFLSY 107          

HSP 3 Score: 68.1662 bits (165), Expect = 3.597e-12
Identity = 55/189 (29.10%), Postives = 95/189 (50.26%), Query Frame = 1
Query:  571 LNSEDVFILDT-GMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEK--NFTALSSQEKQIFRISDITGSLKFEKLK-FDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIFTTQ*KCLF 1125
            L+ +D FILD     IF WIG     +E+ KA  + Q      +     +V    E+ ++ +F  +  D   VD++K   FT L      +F++SD +G L  E++  F + +LD +DV I+D+   + V++G N++ +E+K++L  A  YL++   P+   T ++    GK    F   F +    LF
Sbjct:  279 LDPKDAFILDAINGGIFVWIGHECTLEERSKALIWGQNYLKQHHLPRWTQVTRVLESAESTQFTQWFRDW--VDEKKKNTFTPL------LFQVSDESGLLHVEEIANFTQEDLDGDDVMILDALNSIYVWVGANANANEKKEALNTAKLYLEKDKLPRHKKTAIDTIFQGKEPPTFKKFFPSWDDNLF 459          
BLAST of Gelsolin-like protein 2 vs. Ensembl Celegans
Match: fli-1 (pep chromosome:WBcel235:III:8675297:8683732:-1 gene:WBGene00001443.1 transcript:B0523.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:fli-1)

HSP 1 Score: 52.7582 bits (125), Expect = 1.341e-11
Identity = 48/197 (24.37%), Postives = 91/197 (46.19%), Query Frame = 1
Query:  415 FQELF-KELIYLKGG-CESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNS-DRNDKCLVEVIDEEETLDNHEFYNFLSDI--KPVDD--EKNFTALSSQEKQIFRISDITGSLKFEKLKFDKS-----NLDENDVFIIDSGMEVIVYIGENSS 969
            F  LF +E++Y++GG   SGF       +  RL        ++ +  V  + ++L+    F+LD G  I+ W G  +      KAR F ++LN  DR  K  +E   +       EF+  L+    KP     E       ++ K++++++   G L+  +++  K       L    VF++DS  ++ ++IG+ ++
Sbjct:  599 FLTLFGEEIVYIEGGRTISGFYTTEKPAHLTRLYRAGVNGTAVEMEPVPLSVESLDPRFCFLLDAGETIWIWSGYKSRITVSNKARLFAERLNKRDRKGKSEIETCRQARC--PPEFWQALTGNPDKPQGAIVEHVPEGFVAERKKLYKVNIGMGFLELPQVELPKGIAKQDMLGSKGVFVLDSNSDIFLWIGKKAN 793          

HSP 2 Score: 35.4242 bits (80), Expect = 1.341e-11
Identity = 22/88 (25.00%), Postives = 42/88 (47.73%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLF 418
            +W IE F         +G FY+ D+Y++L   +E    L + + +W+G+ ++ D+   +    V L   L+      RE  + E++ F
Sbjct:  512 VWEIENFYPSIMDEAFHGQFYDADAYLVLKTTREASGQLRHAIFYWLGEHASLDKGMCSAVHAVGLRNHLNATCRTQREEMNDETEEF 599          
BLAST of Gelsolin-like protein 2 vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078973)

HSP 1 Score: 101.679 bits (252), Expect = 1.252e-45
Identity = 56/126 (44.44%), Postives = 75/126 (59.52%), Query Frame = 2
Query:   83 EVKKSSAETEAAWKR------AKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKE--KENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            E++ S   ++ A +R      A       L IWRIE F+ + +P    G FY GDS+I+LN  E  K+  L +D+HFW+G  ++ DE G A   TV+LD LL+  PVQHREVQ +ES LF SY KN
Sbjct:   43 EIQPSGQNSKQAARRVMHPSFANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKN 168          

HSP 2 Score: 101.293 bits (251), Expect = 1.252e-45
Identity = 69/246 (28.05%), Postives = 124/246 (50.41%), Query Frame = 1
Query:  415 FQELFKELI-YLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEET-LDNHEFYNFLS--------DIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIFTT 1107
            F   FK  I Y +GG  +GF+ V        RL  VKG KR++ V +V+ +  ++N+ D FILD G  I+ ++G  A + EK KA     Q+ + D N +  V+++D+  T  D   F++ L         D    D++  F    +    ++++SD +G LK + +      ++ LD  + FI+D+G  + V++G+ ++  E+  ++  A E+L+   +P    T +++ V+G     F   F T
Sbjct:  162 FLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQYFDT 404          
BLAST of Gelsolin-like protein 2 vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0309256)

HSP 1 Score: 101.679 bits (252), Expect = 1.252e-45
Identity = 56/126 (44.44%), Postives = 75/126 (59.52%), Query Frame = 2
Query:   83 EVKKSSAETEAAWKR------AKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKE--KENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            E++ S   ++ A +R      A       L IWRIE F+ + +P    G FY GDS+I+LN  E  K+  L +D+HFW+G  ++ DE G A   TV+LD LL+  PVQHREVQ +ES LF SY KN
Sbjct:   43 EIQPSGQNSKQAARRVMHPSFANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKN 168          

HSP 2 Score: 101.293 bits (251), Expect = 1.252e-45
Identity = 69/246 (28.05%), Postives = 124/246 (50.41%), Query Frame = 1
Query:  415 FQELFKELI-YLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEET-LDNHEFYNFLS--------DIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIFTT 1107
            F   FK  I Y +GG  +GF+ V        RL  VKG KR++ V +V+ +  ++N+ D FILD G  I+ ++G  A + EK KA     Q+ + D N +  V+++D+  T  D   F++ L         D    D++  F    +    ++++SD +G LK + +      ++ LD  + FI+D+G  + V++G+ ++  E+  ++  A E+L+   +P    T +++ V+G     F   F T
Sbjct:  162 FLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQYFDT 404          
BLAST of Gelsolin-like protein 2 vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078969)

HSP 1 Score: 101.679 bits (252), Expect = 1.252e-45
Identity = 56/126 (44.44%), Postives = 75/126 (59.52%), Query Frame = 2
Query:   83 EVKKSSAETEAAWKR------AKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKE--KENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            E++ S   ++ A +R      A       L IWRIE F+ + +P    G FY GDS+I+LN  E  K+  L +D+HFW+G  ++ DE G A   TV+LD LL+  PVQHREVQ +ES LF SY KN
Sbjct:   43 EIQPSGQNSKQAARRVMHPSFANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKN 168          

HSP 2 Score: 101.293 bits (251), Expect = 1.252e-45
Identity = 69/246 (28.05%), Postives = 124/246 (50.41%), Query Frame = 1
Query:  415 FQELFKELI-YLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEET-LDNHEFYNFLS--------DIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIFTT 1107
            F   FK  I Y +GG  +GF+ V        RL  VKG KR++ V +V+ +  ++N+ D FILD G  I+ ++G  A + EK KA     Q+ + D N +  V+++D+  T  D   F++ L         D    D++  F    +    ++++SD +G LK + +      ++ LD  + FI+D+G  + V++G+ ++  E+  ++  A E+L+   +P    T +++ V+G     F   F T
Sbjct:  162 FLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQYFDT 404          
BLAST of Gelsolin-like protein 2 vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0078968)

HSP 1 Score: 101.679 bits (252), Expect = 1.252e-45
Identity = 56/126 (44.44%), Postives = 75/126 (59.52%), Query Frame = 2
Query:   83 EVKKSSAETEAAWKR------AKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKE--KENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            E++ S   ++ A +R      A       L IWRIE F+ + +P    G FY GDS+I+LN  E  K+  L +D+HFW+G  ++ DE G A   TV+LD LL+  PVQHREVQ +ES LF SY KN
Sbjct:   43 EIQPSGQNSKQAARRVMHPSFANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKN 168          

HSP 2 Score: 101.293 bits (251), Expect = 1.252e-45
Identity = 69/246 (28.05%), Postives = 124/246 (50.41%), Query Frame = 1
Query:  415 FQELFKELI-YLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEET-LDNHEFYNFLS--------DIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIFTT 1107
            F   FK  I Y +GG  +GF+ V        RL  VKG KR++ V +V+ +  ++N+ D FILD G  I+ ++G  A + EK KA     Q+ + D N +  V+++D+  T  D   F++ L         D    D++  F    +    ++++SD +G LK + +      ++ LD  + FI+D+G  + V++G+ ++  E+  ++  A E+L+   +P    T +++ V+G     F   F T
Sbjct:  162 FLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQYFDT 404          
BLAST of Gelsolin-like protein 2 vs. Ensembl Fly
Match: Gel (gene:FBgn0010225 transcript:FBtr0309257)

HSP 1 Score: 101.679 bits (252), Expect = 1.406e-45
Identity = 56/126 (44.44%), Postives = 75/126 (59.52%), Query Frame = 2
Query:   83 EVKKSSAETEAAWKR------AKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKE--KENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            E++ S   ++ A +R      A       L IWRIE F+ + +P    G FY GDS+I+LN  E  K+  L +D+HFW+G  ++ DE G A   TV+LD LL+  PVQHREVQ +ES LF SY KN
Sbjct:   31 EIQPSGQNSKQAARRVMHPSFANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKN 156          

HSP 2 Score: 101.293 bits (251), Expect = 1.406e-45
Identity = 69/246 (28.05%), Postives = 124/246 (50.41%), Query Frame = 1
Query:  415 FQELFKELI-YLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEET-LDNHEFYNFLS--------DIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIFTT 1107
            F   FK  I Y +GG  +GF+ V        RL  VKG KR++ V +V+ +  ++N+ D FILD G  I+ ++G  A + EK KA     Q+ + D N +  V+++D+  T  D   F++ L         D    D++  F    +    ++++SD +G LK + +      ++ LD  + FI+D+G  + V++G+ ++  E+  ++  A E+L+   +P    T +++ V+G     F   F T
Sbjct:  150 FLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQYFDT 392          
BLAST of Gelsolin-like protein 2 vs. Ensembl Zebrafish
Match: scin (scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6])

HSP 1 Score: 108.612 bits (270), Expect = 3.388e-45
Identity = 71/219 (32.42%), Postives = 120/219 (54.79%), Query Frame = 1
Query:  415 FQELFKELI-YLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDE-EETLDNHEFYNFLSDIKPVDDEKNFTALSSQEK--QIFRISDITGSLKFEKLK----FDKSNLDENDVFIIDSGMEVIVYI--GENSSPDERKKSLIYAHEYLKETGHPQ 1035
            F   FK  I Y  GG  SGF+ ++       RL H+KGR R++  +EV  +  + N+ D FI+D G  I+QW G   NK E+ KA Q    + +++R+ +  + VI+E +E  +  E      +I   DD ++  A  S  K   ++ +SD TG ++   +     FD+SNL  ++ FI+D G   ++++  G N++P ERK+++  A  ++K+ G+PQ
Sbjct:  105 FTSYFKGGIKYKSGGVASGFQHVITNDLTARRLFHIKGR-RTVRATEVPLSWASFNNGDCFIVDLGPVIYQWCGSKCNKFERIKAAQVGTGIRDNERSGRAKLVVIEEGQEPAEMTEVLGVKPEIPEGDDSEDAVADVSNRKMASLYMVSDATGKMQVSLVSKDNPFDQSNLLSDECFILDHGKNKMIFVWKGHNANPSERKEAMKTAESFIKQMGYPQ 322          

HSP 2 Score: 93.5893 bits (231), Expect = 3.388e-45
Identity = 42/97 (43.30%), Postives = 63/97 (64.95%), Query Frame = 2
Query:  146 STLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            S L IWRIEK +++  P    G FY GD+Y++L+  ++++   YDLHFW+GK  +QDE   A   + ++D  L  +PVQ+RE+Q +ES +F SY K 
Sbjct:   15 SGLQIWRIEKMEIVPVPESFYGSFYTGDAYLVLHTVKQKDSSFYDLHFWLGKECSQDESTAAAIFSTQMDDYLGGKPVQYREIQGFESTVFTSYFKG 111          

HSP 3 Score: 55.4546 bits (132), Expect = 1.631e-14
Identity = 54/206 (26.21%), Postives = 101/206 (49.03%), Query Frame = 1
Query:  424 LFKE---LIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSIT-VSEVSATTKNLNSEDVFILDTGMK-IFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALS-SQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK 1017
            LFK+   ++Y  G    G +     T   RL  V     +IT +SEV A   +LNS D ++L       + W GKGA+++E+  A+   ++LN      C  +++ E +  +   F+  L             + + +   ++F  S+ TG    E++  +F++ +L E+DV ++D    V V+IG++++  ER +S+  A  Y++
Sbjct:  488 LFKDKPLIVYKDGTSRKGGQAPAAPT---RLFQVHKNLGTITRISEVDAKASSLNSNDAYLLKLPQGDGYIWKGKGASEEEEKAAKYMTEKLN------CKTKMVVEGK--EPEAFWMALGGKTEYQTSGLLESRTIAHPPRLFACSNKTGKFIIEEVPGEFNQDDLAEDDVMLLDVWDSVFVWIGKDANEVERTESVKSAKIYIE 682          

HSP 4 Score: 43.1282 bits (100), Expect = 1.631e-14
Identity = 35/89 (39.33%), Postives = 41/89 (46.07%), Query Frame = 2
Query:  158 IWRIE------KFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
            IWR+E        KV   P E  G FY GD YIIL    K  ++    + W G  ST DE   + + TVELD  L    VQ R  Q  E
Sbjct:  398 IWRVECGATKGDTKVPVDP-ETYGQFYGGDCYIILYRYSKGEII----YTWQGSRSTIDELTASAFLTVELDRSLGGNAVQVRVTQGKE 481          
BLAST of Gelsolin-like protein 2 vs. Ensembl Zebrafish
Match: scin (scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6])

HSP 1 Score: 108.227 bits (269), Expect = 3.965e-45
Identity = 71/219 (32.42%), Postives = 120/219 (54.79%), Query Frame = 1
Query:  415 FQELFKELI-YLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDE-EETLDNHEFYNFLSDIKPVDDEKNFTALSSQEK--QIFRISDITGSLKFEKLK----FDKSNLDENDVFIIDSGMEVIVYI--GENSSPDERKKSLIYAHEYLKETGHPQ 1035
            F   FK  I Y  GG  SGF+ ++       RL H+KGR R++  +EV  +  + N+ D FI+D G  I+QW G   NK E+ KA Q    + +++R+ +  + VI+E +E  +  E      +I   DD ++  A  S  K   ++ +SD TG ++   +     FD+SNL  ++ FI+D G   ++++  G N++P ERK+++  A  ++K+ G+PQ
Sbjct:  105 FTSYFKGGIKYKSGGVASGFQHVITNDLTARRLFHIKGR-RTVRATEVPLSWASFNNGDCFIVDLGPVIYQWCGSKCNKFERIKAAQVGTGIRDNERSGRAKLVVIEEGQEPAEMTEVLGVKPEIPEGDDSEDAVADVSNRKMASLYMVSDATGKMQVSLVSKDNPFDQSNLLSDECFILDHGKNKMIFVWKGHNANPSERKEAMKTAESFIKQMGYPQ 322          

HSP 2 Score: 93.5893 bits (231), Expect = 3.965e-45
Identity = 42/97 (43.30%), Postives = 63/97 (64.95%), Query Frame = 2
Query:  146 STLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            S L IWRIEK +++  P    G FY GD+Y++L+  ++++   YDLHFW+GK  +QDE   A   + ++D  L  +PVQ+RE+Q +ES +F SY K 
Sbjct:   15 SGLQIWRIEKMEIVPVPESFYGSFYTGDAYLVLHTVKQKDSSFYDLHFWLGKECSQDESTAAAIFSTQMDDYLGGKPVQYREIQGFESTVFTSYFKG 111          

HSP 3 Score: 57.3806 bits (137), Expect = 4.633e-15
Identity = 56/206 (27.18%), Postives = 103/206 (50.00%), Query Frame = 1
Query:  424 LFKE---LIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSIT-VSEVSATTKNLNSEDVFILDTGMK-IFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALS-SQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK 1017
            LFK+   ++Y  G    G +     T   RL  V+    +IT +SEV A   +LNS DV++L       + W GKGA+++E+  A+   ++LN      C  +++ E +  D   F+  L             + + +   ++F  S+ TG    E++  +F++ +L E+DV ++D    V V+IG++++  ER +S+  A  Y++
Sbjct:  488 LFKDKPLIVYKDGTSRKGGQAPAAPT---RLFQVRKNLGTITRISEVDAKASSLNSNDVYLLKLPQGDGYIWKGKGASEEEEKAAKYMSEKLN------CKTKMVVEGKEPDV--FWMALGGKTEYQTSGLLESRTIAHPPRLFACSNKTGKFIIEEVPGEFNQDDLAEDDVMLLDVWDSVFVWIGKDANEVERTESVKSAKIYIE 682          

HSP 4 Score: 43.1282 bits (100), Expect = 4.633e-15
Identity = 35/89 (39.33%), Postives = 41/89 (46.07%), Query Frame = 2
Query:  158 IWRIE------KFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
            IWR+E        KV   P E  G FY GD YIIL    K  ++    + W G  ST DE   + + TVELD  L    VQ R  Q  E
Sbjct:  398 IWRVECGATKGDTKVPVDP-ETYGQFYGGDCYIILYRYSKGEII----YTWQGSRSTIDELTASAFLTVELDRSLGGNAVQVRVTQGKE 481          
BLAST of Gelsolin-like protein 2 vs. Ensembl Zebrafish
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 103.219 bits (256), Expect = 2.127e-44
Identity = 68/223 (30.49%), Postives = 126/223 (56.50%), Query Frame = 1
Query:  409 RSFQELFKE-LIYLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKP-----VDDEKNFTALSSQEKQIFRISDITGSLKFEKLK----FDKSNLDENDVFIIDSGME--VIVYIGENSSPDERKKSLIYAHEYLKETGHPQ 1035
            ++F   FK+ L Y++GG  SGF+ +V  +    R+L VKGR R +  +EV  +  + N  D FILD G +I+QW G  +N+ EK KA Q  + + +++R+ +  V V D  E ++  +    L + KP       D+    A + +  +++++SD +G +    +     F +S L+ +D FI+D G +  + V+ G++++ +ERK ++  A E++K+ G+P+
Sbjct:  103 KAFLGYFKKGLQYMQGGVASGFKHVVTNEVVMQRVLQVKGR-RVVRATEVPVSWDSFNQGDCFILDLGNEIYQWCGSKSNRFEKLKATQLAKGIRDNERSGRARVYVCD--EGVEREKMLEVLGE-KPDLPEGASDDVKADASNRKMAKLYKVSDASGDMAIALVAAENPFTQSALESSDCFILDHGSDGKIFVWKGKDANMEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 96.2857 bits (238), Expect = 2.127e-44
Identity = 45/95 (47.37%), Postives = 61/95 (64.21%), Query Frame = 2
Query:  152 LLIWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSK 433
            L +WRIEKF ++  P    G FY GD+Y++L   K+    L YDLHFW+G + TQDE G+A   TV++D  L  +P+Q+REVQ +ES  F  Y K
Sbjct:   16 LQVWRIEKFDLVAVPENLYGGFYTGDAYLVLKTTKQTSGNLQYDLHFWLGDYCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGHESKAFLGYFK 110          

HSP 3 Score: 65.855 bits (159), Expect = 1.654e-20
Identity = 56/229 (24.45%), Postives = 102/229 (44.54%), Query Frame = 1
Query:  430 KELIYLKGGCE-SGFRIVNVQTYNPRLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFT-ALSSQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            + ++  KGG    G +    +T   RL  V+      T + E+ A + NLNS D F+L T    F W+G+GA+  EK  A+Q    L         V   +  E  ++  F++ L               +++   ++F  S+ TG    E++  +  + +L  +DV I+D+  +V V+IG  +  +E+ +++  A +Y++     + P T + K   G     F   F
Sbjct:  490 QPMVVHKGGTSREGGQTAPAET---RLFQVRSNSAGCTRAVEIDAVSSNLNSNDAFVLVTPAASFIWVGQGASDIEKRGAQQLCGILG--------VSPSELSEGGEDGGFWDALGGKAAYRTSSRLKDKMNAHPPRLFACSNKTGRFIIEEVPGEMTQEDLATDDVMILDTWDQVFVWIGNEAHDEEKMEAMTSAAQYIQTDPANRDPRTAIVKIKQGFEPPTFTGWF 707          

HSP 4 Score: 53.1434 bits (126), Expect = 1.654e-20
Identity = 33/83 (39.76%), Postives = 39/83 (46.99%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
            IWRIE    +       G FY GDSYIIL          + ++ W G  STQDE G +     +LD  L   PVQ R VQ  E
Sbjct:  397 IWRIEGSDKVPVDPSTYGQFYGGDSYIILYSYRHGGRQGHIIYIWQGADSTQDEIGASAILGAQLDDELGGGPVQVRVVQGKE 479          
BLAST of Gelsolin-like protein 2 vs. Ensembl Zebrafish
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 103.219 bits (256), Expect = 2.127e-44
Identity = 68/223 (30.49%), Postives = 126/223 (56.50%), Query Frame = 1
Query:  409 RSFQELFKE-LIYLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKP-----VDDEKNFTALSSQEKQIFRISDITGSLKFEKLK----FDKSNLDENDVFIIDSGME--VIVYIGENSSPDERKKSLIYAHEYLKETGHPQ 1035
            ++F   FK+ L Y++GG  SGF+ +V  +    R+L VKGR R +  +EV  +  + N  D FILD G +I+QW G  +N+ EK KA Q  + + +++R+ +  V V D  E ++  +    L + KP       D+    A + +  +++++SD +G +    +     F +S L+ +D FI+D G +  + V+ G++++ +ERK ++  A E++K+ G+P+
Sbjct:  103 KAFLGYFKKGLQYMQGGVASGFKHVVTNEVVMQRVLQVKGR-RVVRATEVPVSWDSFNQGDCFILDLGNEIYQWCGSKSNRFEKLKATQLAKGIRDNERSGRARVYVCD--EGVEREKMLEVLGE-KPDLPEGASDDVKADASNRKMAKLYKVSDASGDMAIALVAAENPFTQSALESSDCFILDHGSDGKIFVWKGKDANMEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 96.2857 bits (238), Expect = 2.127e-44
Identity = 45/95 (47.37%), Postives = 61/95 (64.21%), Query Frame = 2
Query:  152 LLIWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSK 433
            L +WRIEKF ++  P    G FY GD+Y++L   K+    L YDLHFW+G + TQDE G+A   TV++D  L  +P+Q+REVQ +ES  F  Y K
Sbjct:   16 LQVWRIEKFDLVAVPENLYGGFYTGDAYLVLKTTKQTSGNLQYDLHFWLGDYCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGHESKAFLGYFK 110          

HSP 3 Score: 65.855 bits (159), Expect = 1.654e-20
Identity = 56/229 (24.45%), Postives = 102/229 (44.54%), Query Frame = 1
Query:  430 KELIYLKGGCE-SGFRIVNVQTYNPRLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFT-ALSSQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            + ++  KGG    G +    +T   RL  V+      T + E+ A + NLNS D F+L T    F W+G+GA+  EK  A+Q    L         V   +  E  ++  F++ L               +++   ++F  S+ TG    E++  +  + +L  +DV I+D+  +V V+IG  +  +E+ +++  A +Y++     + P T + K   G     F   F
Sbjct:  490 QPMVVHKGGTSREGGQTAPAET---RLFQVRSNSAGCTRAVEIDAVSSNLNSNDAFVLVTPAASFIWVGQGASDIEKRGAQQLCGILG--------VSPSELSEGGEDGGFWDALGGKAAYRTSSRLKDKMNAHPPRLFACSNKTGRFIIEEVPGEMTQEDLATDDVMILDTWDQVFVWIGNEAHDEEKMEAMTSAAQYIQTDPANRDPRTAIVKIKQGFEPPTFTGWF 707          

HSP 4 Score: 53.1434 bits (126), Expect = 1.654e-20
Identity = 33/83 (39.76%), Postives = 39/83 (46.99%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
            IWRIE    +       G FY GDSYIIL          + ++ W G  STQDE G +     +LD  L   PVQ R VQ  E
Sbjct:  397 IWRIEGSDKVPVDPSTYGQFYGGDSYIILYSYRHGGRQGHIIYIWQGADSTQDEIGASAILGAQLDDELGGGPVQVRVVQGKE 479          
BLAST of Gelsolin-like protein 2 vs. Ensembl Zebrafish
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 103.219 bits (256), Expect = 2.127e-44
Identity = 68/223 (30.49%), Postives = 126/223 (56.50%), Query Frame = 1
Query:  409 RSFQELFKE-LIYLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKP-----VDDEKNFTALSSQEKQIFRISDITGSLKFEKLK----FDKSNLDENDVFIIDSGME--VIVYIGENSSPDERKKSLIYAHEYLKETGHPQ 1035
            ++F   FK+ L Y++GG  SGF+ +V  +    R+L VKGR R +  +EV  +  + N  D FILD G +I+QW G  +N+ EK KA Q  + + +++R+ +  V V D  E ++  +    L + KP       D+    A + +  +++++SD +G +    +     F +S L+ +D FI+D G +  + V+ G++++ +ERK ++  A E++K+ G+P+
Sbjct:  103 KAFLGYFKKGLQYMQGGVASGFKHVVTNEVVMQRVLQVKGR-RVVRATEVPVSWDSFNQGDCFILDLGNEIYQWCGSKSNRFEKLKATQLAKGIRDNERSGRARVYVCD--EGVEREKMLEVLGE-KPDLPEGASDDVKADASNRKMAKLYKVSDASGDMAIALVAAENPFTQSALESSDCFILDHGSDGKIFVWKGKDANMEERKAAMKAADEFIKKMGYPK 321          

HSP 2 Score: 96.2857 bits (238), Expect = 2.127e-44
Identity = 45/95 (47.37%), Postives = 61/95 (64.21%), Query Frame = 2
Query:  152 LLIWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSK 433
            L +WRIEKF ++  P    G FY GD+Y++L   K+    L YDLHFW+G + TQDE G+A   TV++D  L  +P+Q+REVQ +ES  F  Y K
Sbjct:   16 LQVWRIEKFDLVAVPENLYGGFYTGDAYLVLKTTKQTSGNLQYDLHFWLGDYCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGHESKAFLGYFK 110          

HSP 3 Score: 65.855 bits (159), Expect = 1.654e-20
Identity = 56/229 (24.45%), Postives = 102/229 (44.54%), Query Frame = 1
Query:  430 KELIYLKGGCE-SGFRIVNVQTYNPRLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFT-ALSSQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            + ++  KGG    G +    +T   RL  V+      T + E+ A + NLNS D F+L T    F W+G+GA+  EK  A+Q    L         V   +  E  ++  F++ L               +++   ++F  S+ TG    E++  +  + +L  +DV I+D+  +V V+IG  +  +E+ +++  A +Y++     + P T + K   G     F   F
Sbjct:  490 QPMVVHKGGTSREGGQTAPAET---RLFQVRSNSAGCTRAVEIDAVSSNLNSNDAFVLVTPAASFIWVGQGASDIEKRGAQQLCGILG--------VSPSELSEGGEDGGFWDALGGKAAYRTSSRLKDKMNAHPPRLFACSNKTGRFIIEEVPGEMTQEDLATDDVMILDTWDQVFVWIGNEAHDEEKMEAMTSAAQYIQTDPANRDPRTAIVKIKQGFEPPTFTGWF 707          

HSP 4 Score: 53.1434 bits (126), Expect = 1.654e-20
Identity = 33/83 (39.76%), Postives = 39/83 (46.99%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
            IWRIE    +       G FY GDSYIIL          + ++ W G  STQDE G +     +LD  L   PVQ R VQ  E
Sbjct:  397 IWRIEGSDKVPVDPSTYGQFYGGDSYIILYSYRHGGRQGHIIYIWQGADSTQDEIGASAILGAQLDDELGGGPVQVRVVQGKE 479          
BLAST of Gelsolin-like protein 2 vs. Ensembl Xenopus
Match: ndc80 (NDC80 kinetochore complex component [Source:Xenbase;Acc:XB-GENE-997352])

HSP 1 Score: 93.2041 bits (230), Expect = 3.985e-40
Identity = 71/220 (32.27%), Postives = 120/220 (54.55%), Query Frame = 1
Query:  412 SFQELFKELI-YLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIK--PVDDEKNFTALSSQEK--QIFRISDITGSLKF----EKLKFDKSNLDENDVFIID-SG-MEVIVYIGENSSPDERKKSLIYAHEYLKETGHP 1032
            +F   FK  I Y  GG  SGF+ +V  +    RLLH+KGR R +  +EV  +  N NS D FI+D G  I+QW G   NK E+ KA Q    + ++++N +  + V+  EE  + +E    L      P  D+ +  A  +  K  +++ +SD +GS+K     E+  F K+ L   + FI+D SG  ++ V+ G+N++ +ERK ++  A +++++  +P
Sbjct:  150 AFVGYFKGGIKYKAGGVASGFQHVVTNELGAQRLLHIKGR-RVVRATEVPLSWSNFNSGDCFIVDLGAVIYQWCGSECNKYERLKAAQVAHGIRDNEKNGRAQIIVV--EEGSEPNELTKVLGAKPQLPAGDDADDVADDTNRKNVKLYMVSDASGSMKVSVVAEQSPFSKAMLLSEECFILDHSGDKKIFVWKGKNANTEERKAAMKTAEQFIQQMNYP 366          

HSP 2 Score: 92.4337 bits (228), Expect = 3.985e-40
Identity = 44/97 (45.36%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  146 STLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            + L IWRIE   ++  P    G FY GD+Y++LN   K N   YDLH+W+GK  +QDE   A   TV+LD  L  +PVQ+RE+Q +ES  F  Y K 
Sbjct:   61 TGLQIWRIENMDLVPVPKTLYGNFYVGDAYLVLNTIAKNNSKYYDLHYWLGKECSQDESTAAAIYTVQLDEFLGGKPVQYREIQGHESSAFVGYFKG 157          

HSP 3 Score: 64.3142 bits (155), Expect = 1.692e-17
Identity = 53/180 (29.44%), Postives = 99/180 (55.00%), Query Frame = 1
Query:  502 RLLHVKGRKRSIT-VSEVSATTKNLNSEDVFIL----DTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALS-SQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK 1017
            RL  ++    +IT + EV      LNS DVF+L    ++G   ++WIGKGA+ +E+ KA +++  +      +C V  I E +  D  EF++ L+  K         + S     ++F  S+ TG    E++  +F + +L E+DV ++D+  +V ++IG++++  E+K+SL  A +Y++
Sbjct:  555 RLFQIRKNLSTITRIIEVDTDASLLNSNDVFVLKLKNNSG---YKWIGKGASGEEE-KAAEYIANVL-----RCKVSKIAEGQEPD--EFWSALNGKKKYQTSALLESKSIVNPPRLFGCSNKTGRFLIEEVPGEFTQDDLAEDDVMLLDTHEQVFLWIGKDANEQEKKESLKSAKQYIE 723          

HSP 4 Score: 45.4394 bits (106), Expect = 1.692e-17
Identity = 33/92 (35.87%), Postives = 45/92 (48.91%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYES----DLFK 421
            I+R+E    +       G FY GD YIIL    K  +++Y    W G  +T+DE   + + TV+LD  L D+ VQ R  Q  E      LFK
Sbjct:  444 IFRVESCGRVPIEPNTFGQFYGGDCYIILYTYAK-GLIIYT---WQGAKATRDELTASAFLTVQLDRSLGDQAVQVRVTQGKEPPHLLSLFK 531          
BLAST of Gelsolin-like protein 2 vs. Ensembl Xenopus
Match: ndc80 (NDC80 kinetochore complex component [Source:Xenbase;Acc:XB-GENE-997352])

HSP 1 Score: 93.2041 bits (230), Expect = 4.292e-40
Identity = 71/220 (32.27%), Postives = 120/220 (54.55%), Query Frame = 1
Query:  412 SFQELFKELI-YLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIK--PVDDEKNFTALSSQEK--QIFRISDITGSLKF----EKLKFDKSNLDENDVFIID-SG-MEVIVYIGENSSPDERKKSLIYAHEYLKETGHP 1032
            +F   FK  I Y  GG  SGF+ +V  +    RLLH+KGR R +  +EV  +  N NS D FI+D G  I+QW G   NK E+ KA Q    + ++++N +  + V+  EE  + +E    L      P  D+ +  A  +  K  +++ +SD +GS+K     E+  F K+ L   + FI+D SG  ++ V+ G+N++ +ERK ++  A +++++  +P
Sbjct:  149 AFVGYFKGGIKYKAGGVASGFQHVVTNELGAQRLLHIKGR-RVVRATEVPLSWSNFNSGDCFIVDLGAVIYQWCGSECNKYERLKAAQVAHGIRDNEKNGRAQIIVV--EEGSEPNELTKVLGAKPQLPAGDDADDVADDTNRKNVKLYMVSDASGSMKVSVVAEQSPFSKAMLLSEECFILDHSGDKKIFVWKGKNANTEERKAAMKTAEQFIQQMNYP 365          

HSP 2 Score: 92.0485 bits (227), Expect = 4.292e-40
Identity = 44/97 (45.36%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  146 STLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            + L IWRIE   ++  P    G FY GD+Y++LN   K N   YDLH+W+GK  +QDE   A   TV+LD  L  +PVQ+RE+Q +ES  F  Y K 
Sbjct:   60 TGLQIWRIENMDLVPVPKTLYGNFYVGDAYLVLNTIAKNNSKYYDLHYWLGKECSQDESTAAAIYTVQLDEFLGGKPVQYREIQGHESSAFVGYFKG 156          

HSP 3 Score: 63.929 bits (154), Expect = 1.851e-17
Identity = 53/180 (29.44%), Postives = 99/180 (55.00%), Query Frame = 1
Query:  502 RLLHVKGRKRSIT-VSEVSATTKNLNSEDVFIL----DTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALS-SQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK 1017
            RL  ++    +IT + EV      LNS DVF+L    ++G   ++WIGKGA+ +E+ KA +++  +      +C V  I E +  D  EF++ L+  K         + S     ++F  S+ TG    E++  +F + +L E+DV ++D+  +V ++IG++++  E+K+SL  A +Y++
Sbjct:  554 RLFQIRKNLSTITRIIEVDTDASLLNSNDVFVLKLKNNSG---YKWIGKGASGEEE-KAAEYIANVL-----RCKVSKIAEGQEPD--EFWSALNGKKKYQTSALLESKSIVNPPRLFGCSNKTGRFLIEEVPGEFTQDDLAEDDVMLLDTHEQVFLWIGKDANEQEKKESLKSAKQYIE 722          

HSP 4 Score: 45.0542 bits (105), Expect = 1.851e-17
Identity = 33/92 (35.87%), Postives = 45/92 (48.91%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYES----DLFK 421
            I+R+E    +       G FY GD YIIL    K  +++Y    W G  +T+DE   + + TV+LD  L D+ VQ R  Q  E      LFK
Sbjct:  443 IFRVESCGRVPIEPNTFGQFYGGDCYIILYTYAK-GLIIYT---WQGAKATRDELTASAFLTVQLDRSLGDQAVQVRVTQGKEPPHLLSLFK 530          
BLAST of Gelsolin-like protein 2 vs. Ensembl Xenopus
Match: ndc80 (NDC80 kinetochore complex component [Source:Xenbase;Acc:XB-GENE-997352])

HSP 1 Score: 93.2041 bits (230), Expect = 4.329e-40
Identity = 71/220 (32.27%), Postives = 120/220 (54.55%), Query Frame = 1
Query:  412 SFQELFKELI-YLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIK--PVDDEKNFTALSSQEK--QIFRISDITGSLKF----EKLKFDKSNLDENDVFIID-SG-MEVIVYIGENSSPDERKKSLIYAHEYLKETGHP 1032
            +F   FK  I Y  GG  SGF+ +V  +    RLLH+KGR R +  +EV  +  N NS D FI+D G  I+QW G   NK E+ KA Q    + ++++N +  + V+  EE  + +E    L      P  D+ +  A  +  K  +++ +SD +GS+K     E+  F K+ L   + FI+D SG  ++ V+ G+N++ +ERK ++  A +++++  +P
Sbjct:  134 AFVGYFKGGIKYKAGGVASGFQHVVTNELGAQRLLHIKGR-RVVRATEVPLSWSNFNSGDCFIVDLGAVIYQWCGSECNKYERLKAAQVAHGIRDNEKNGRAQIIVV--EEGSEPNELTKVLGAKPQLPAGDDADDVADDTNRKNVKLYMVSDASGSMKVSVVAEQSPFSKAMLLSEECFILDHSGDKKIFVWKGKNANTEERKAAMKTAEQFIQQMNYP 350          

HSP 2 Score: 92.4337 bits (228), Expect = 4.329e-40
Identity = 44/97 (45.36%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  146 STLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            + L IWRIE   ++  P    G FY GD+Y++LN   K N   YDLH+W+GK  +QDE   A   TV+LD  L  +PVQ+RE+Q +ES  F  Y K 
Sbjct:   45 TGLQIWRIENMDLVPVPKTLYGNFYVGDAYLVLNTIAKNNSKYYDLHYWLGKECSQDESTAAAIYTVQLDEFLGGKPVQYREIQGHESSAFVGYFKG 141          

HSP 3 Score: 63.929 bits (154), Expect = 2.112e-17
Identity = 53/180 (29.44%), Postives = 99/180 (55.00%), Query Frame = 1
Query:  502 RLLHVKGRKRSIT-VSEVSATTKNLNSEDVFIL----DTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALS-SQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK 1017
            RL  ++    +IT + EV      LNS DVF+L    ++G   ++WIGKGA+ +E+ KA +++  +      +C V  I E +  D  EF++ L+  K         + S     ++F  S+ TG    E++  +F + +L E+DV ++D+  +V ++IG++++  E+K+SL  A +Y++
Sbjct:  539 RLFQIRKNLSTITRIIEVDTDASLLNSNDVFVLKLKNNSG---YKWIGKGASGEEE-KAAEYIANVL-----RCKVSKIAEGQEPD--EFWSALNGKKKYQTSALLESKSIVNPPRLFGCSNKTGRFLIEEVPGEFTQDDLAEDDVMLLDTHEQVFLWIGKDANEQEKKESLKSAKQYIE 707          

HSP 4 Score: 45.0542 bits (105), Expect = 2.112e-17
Identity = 36/94 (38.30%), Postives = 48/94 (51.06%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQN--GVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYES----DLFK 421
            I+R+E    +  P E N  G FY GD YIIL    K  +++Y    W G  +T+DE   + + TV+LD  L D+ VQ R  Q  E      LFK
Sbjct:  428 IFRVESCGRV--PIEPNTFGQFYGGDCYIILYTYAK-GLIIYT---WQGAKATRDELTASAFLTVQLDRSLGDQAVQVRVTQGKEPPHLLSLFK 515          
BLAST of Gelsolin-like protein 2 vs. Ensembl Xenopus
Match: ndc80 (NDC80 kinetochore complex component [Source:Xenbase;Acc:XB-GENE-997352])

HSP 1 Score: 93.2041 bits (230), Expect = 4.437e-40
Identity = 71/220 (32.27%), Postives = 120/220 (54.55%), Query Frame = 1
Query:  412 SFQELFKELI-YLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIK--PVDDEKNFTALSSQEK--QIFRISDITGSLKF----EKLKFDKSNLDENDVFIID-SG-MEVIVYIGENSSPDERKKSLIYAHEYLKETGHP 1032
            +F   FK  I Y  GG  SGF+ +V  +    RLLH+KGR R +  +EV  +  N NS D FI+D G  I+QW G   NK E+ KA Q    + ++++N +  + V+  EE  + +E    L      P  D+ +  A  +  K  +++ +SD +GS+K     E+  F K+ L   + FI+D SG  ++ V+ G+N++ +ERK ++  A +++++  +P
Sbjct:  142 AFVGYFKGGIKYKAGGVASGFQHVVTNELGAQRLLHIKGR-RVVRATEVPLSWSNFNSGDCFIVDLGAVIYQWCGSECNKYERLKAAQVAHGIRDNEKNGRAQIIVV--EEGSEPNELTKVLGAKPQLPAGDDADDVADDTNRKNVKLYMVSDASGSMKVSVVAEQSPFSKAMLLSEECFILDHSGDKKIFVWKGKNANTEERKAAMKTAEQFIQQMNYP 358          

HSP 2 Score: 92.4337 bits (228), Expect = 4.437e-40
Identity = 44/97 (45.36%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  146 STLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            + L IWRIE   ++  P    G FY GD+Y++LN   K N   YDLH+W+GK  +QDE   A   TV+LD  L  +PVQ+RE+Q +ES  F  Y K 
Sbjct:   53 TGLQIWRIENMDLVPVPKTLYGNFYVGDAYLVLNTIAKNNSKYYDLHYWLGKECSQDESTAAAIYTVQLDEFLGGKPVQYREIQGHESSAFVGYFKG 149          

HSP 3 Score: 63.929 bits (154), Expect = 1.929e-17
Identity = 53/180 (29.44%), Postives = 99/180 (55.00%), Query Frame = 1
Query:  502 RLLHVKGRKRSIT-VSEVSATTKNLNSEDVFIL----DTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALS-SQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK 1017
            RL  ++    +IT + EV      LNS DVF+L    ++G   ++WIGKGA+ +E+ KA +++  +      +C V  I E +  D  EF++ L+  K         + S     ++F  S+ TG    E++  +F + +L E+DV ++D+  +V ++IG++++  E+K+SL  A +Y++
Sbjct:  547 RLFQIRKNLSTITRIIEVDTDASLLNSNDVFVLKLKNNSG---YKWIGKGASGEEE-KAAEYIANVL-----RCKVSKIAEGQEPD--EFWSALNGKKKYQTSALLESKSIVNPPRLFGCSNKTGRFLIEEVPGEFTQDDLAEDDVMLLDTHEQVFLWIGKDANEQEKKESLKSAKQYIE 715          

HSP 4 Score: 45.0542 bits (105), Expect = 1.929e-17
Identity = 33/92 (35.87%), Postives = 45/92 (48.91%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYES----DLFK 421
            I+R+E    +       G FY GD YIIL    K  +++Y    W G  +T+DE   + + TV+LD  L D+ VQ R  Q  E      LFK
Sbjct:  436 IFRVESCGRVPIEPNTFGQFYGGDCYIILYTYAK-GLIIYT---WQGAKATRDELTASAFLTVQLDRSLGDQAVQVRVTQGKEPPHLLSLFK 523          
BLAST of Gelsolin-like protein 2 vs. Ensembl Xenopus
Match: ndc80 (NDC80 kinetochore complex component [Source:Xenbase;Acc:XB-GENE-997352])

HSP 1 Score: 93.2041 bits (230), Expect = 4.625e-40
Identity = 71/220 (32.27%), Postives = 120/220 (54.55%), Query Frame = 1
Query:  412 SFQELFKELI-YLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIK--PVDDEKNFTALSSQEK--QIFRISDITGSLKF----EKLKFDKSNLDENDVFIID-SG-MEVIVYIGENSSPDERKKSLIYAHEYLKETGHP 1032
            +F   FK  I Y  GG  SGF+ +V  +    RLLH+KGR R +  +EV  +  N NS D FI+D G  I+QW G   NK E+ KA Q    + ++++N +  + V+  EE  + +E    L      P  D+ +  A  +  K  +++ +SD +GS+K     E+  F K+ L   + FI+D SG  ++ V+ G+N++ +ERK ++  A +++++  +P
Sbjct:  128 AFVGYFKGGIKYKAGGVASGFQHVVTNELGAQRLLHIKGR-RVVRATEVPLSWSNFNSGDCFIVDLGAVIYQWCGSECNKYERLKAAQVAHGIRDNEKNGRAQIIVV--EEGSEPNELTKVLGAKPQLPAGDDADDVADDTNRKNVKLYMVSDASGSMKVSVVAEQSPFSKAMLLSEECFILDHSGDKKIFVWKGKNANTEERKAAMKTAEQFIQQMNYP 344          

HSP 2 Score: 92.4337 bits (228), Expect = 4.625e-40
Identity = 44/97 (45.36%), Postives = 58/97 (59.79%), Query Frame = 2
Query:  146 STLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            + L IWRIE   ++  P    G FY GD+Y++LN   K N   YDLH+W+GK  +QDE   A   TV+LD  L  +PVQ+RE+Q +ES  F  Y K 
Sbjct:   39 TGLQIWRIENMDLVPVPKTLYGNFYVGDAYLVLNTIAKNNSKYYDLHYWLGKECSQDESTAAAIYTVQLDEFLGGKPVQYREIQGHESSAFVGYFKG 135          

HSP 3 Score: 64.3142 bits (155), Expect = 2.011e-17
Identity = 53/180 (29.44%), Postives = 99/180 (55.00%), Query Frame = 1
Query:  502 RLLHVKGRKRSIT-VSEVSATTKNLNSEDVFIL----DTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALS-SQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK 1017
            RL  ++    +IT + EV      LNS DVF+L    ++G   ++WIGKGA+ +E+ KA +++  +      +C V  I E +  D  EF++ L+  K         + S     ++F  S+ TG    E++  +F + +L E+DV ++D+  +V ++IG++++  E+K+SL  A +Y++
Sbjct:  533 RLFQIRKNLSTITRIIEVDTDASLLNSNDVFVLKLKNNSG---YKWIGKGASGEEE-KAAEYIANVL-----RCKVSKIAEGQEPD--EFWSALNGKKKYQTSALLESKSIVNPPRLFGCSNKTGRFLIEEVPGEFTQDDLAEDDVMLLDTHEQVFLWIGKDANEQEKKESLKSAKQYIE 701          

HSP 4 Score: 45.0542 bits (105), Expect = 2.011e-17
Identity = 33/92 (35.87%), Postives = 45/92 (48.91%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYES----DLFK 421
            I+R+E    +       G FY GD YIIL    K  +++Y    W G  +T+DE   + + TV+LD  L D+ VQ R  Q  E      LFK
Sbjct:  422 IFRVESCGRVPIEPNTFGQFYGGDCYIILYTYAK-GLIIYT---WQGAKATRDELTASAFLTVQLDRSLGDQAVQVRVTQGKEPPHLLSLFK 509          
BLAST of Gelsolin-like protein 2 vs. Ensembl Mouse
Match: Vil1 (villin 1 [Source:MGI Symbol;Acc:MGI:98930])

HSP 1 Score: 96.2857 bits (238), Expect = 5.816e-41
Identity = 43/92 (46.74%), Postives = 61/92 (66.30%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSK 433
            IWRIE  +++  P+   G F++GD Y++L I +  + L YD+H+WIG+ S+QDE G A   T ++D  L  R VQHREVQ  ES+ F+SY K
Sbjct:   21 IWRIEAMQMVPVPSSTFGSFFDGDCYVVLAIHKTSSTLSYDIHYWIGQDSSQDEQGAAAIYTTQMDDYLKGRAVQHREVQGNESETFRSYFK 112          

HSP 2 Score: 91.2781 bits (225), Expect = 5.816e-41
Identity = 65/244 (26.64%), Postives = 121/244 (49.59%), Query Frame = 1
Query:  412 SFQELFKE-LIYLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLS-------DIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIID-SGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            +F+  FK+ L+  KGG  SG + V   + +  RLLHVKG KR++   EV  + K+ N  DVF+LD G  I QW G  +N+ E+ +     +++ + +R  +  V V+D E+  D+ +    ++       ++K    +      +    +++ +SD  G L   ++      +  L   D +I+D  G+++ V+ G+N++  ER  ++  A  ++K   +P  P T +  + DG     F  +F
Sbjct:  106 TFRSYFKQGLVIRKGGVASGMKHVETNSCDVQRLLHVKG-KRNVLAGEVEMSWKSFNRGDVFLLDLGKLIIQWNGPESNRMERLRGMALAKEIRDQERGGRTYVGVVDGEKEGDSPQLMAIMNHVLGPRKELKAAISDSVVEPAAKAALKLYHVSDSEGKLVVREVATRPLTQDLLKHEDCYILDQGGLKIFVWKGKNANAQERSGAMSQALNFIKAKQYP--PSTQVEVQNDGAESPIFQQLF 346          

HSP 3 Score: 74.7146 bits (182), Expect = 3.317e-23
Identity = 61/198 (30.81%), Postives = 99/198 (50.00%), Query Frame = 1
Query:  502 RLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQI-----FRISDITGS-LKFEKLKFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHP-----QAPVTVLNK 1059
            RL  V+G     T + EV+A   +LNS DVFIL T    + W GKG + DE+  A+     ++  R +K   +V+ E +   N  F+  L    P  + K       +E Q+     F  S+ TG  L  E   F++ +L+E DVF++D   +V  +IG++++ +E+K +     EYLK   HP     + P+ V+ +
Sbjct:  516 RLFQVRGTNADNTKAFEVTARATSLNSNDVFILKTPSCCYLWCGKGCSGDEREMAKMVADTIS--RTEK---QVVVEGQEPAN--FWMALGGKAPYANTKRL----QEENQVITPRLFECSNQTGRFLATEIFDFNQDDLEEEDVFLLDVWDQVFFWIGKHANEEEKKAAATTVQEYLKT--HPGNRDLETPIIVVKQ 700          

HSP 4 Score: 53.5286 bits (127), Expect = 3.317e-23
Identity = 31/80 (38.75%), Postives = 46/80 (57.50%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILN---IKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHR 388
            +WRIE  +++   ++  G FY GD Y++L    I EK++ LLY    W G  ++QDE   + Y+ V LD   +D PVQ R
Sbjct:  402 VWRIEDLELVPVESKWLGHFYGGDCYLLLYTYLIGEKQHYLLY---IWQGSQASQDEIAASAYQAVLLDQKYNDEPVQIR 478          
BLAST of Gelsolin-like protein 2 vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 94.7449 bits (234), Expect = 1.914e-40
Identity = 46/103 (44.66%), Postives = 63/103 (61.17%), Query Frame = 2
Query:  131 KLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            K   +  L IWR+EKF ++  P    G F+ GD+Y+IL  ++ +   L YDLH+W+G   +QDE G A   TV+LD  L+ R VQHREVQ +ES  F  Y K+
Sbjct:   59 KAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKS 161          

HSP 2 Score: 91.2781 bits (225), Expect = 1.914e-40
Identity = 71/229 (31.00%), Postives = 118/229 (51.53%), Query Frame = 1
Query:  412 SFQELFKE-LIYLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPV-----DDEKNFTALSSQEKQIFRISDITGSLKFEKL----KFDKSNLDENDVFIIDSGME--VIVYIGENSSPDERKKSLIYAHEYLKETGHP-QAPVTVL 1053
            +F   FK  L Y KGG  SGF+ +V  +    RL  VKGR R +  +EV  +  + N+ D FILD G  I+QW G G+NK E+ KA Q  + + +++R+ +  V V   EE  +       L   KP      +D     A + +  +++++S+  GS+    +     F +  L   D FI+D G +  + V+ G+ ++ +ERK +L  A +++ +  +P Q  V+VL
Sbjct:  154 TFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGR-RVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHV--SEEGGEPEAMLQVLGP-KPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVL 378          

HSP 3 Score: 60.8474 bits (146), Expect = 6.634e-19
Identity = 51/201 (25.37%), Postives = 93/201 (46.27%), Query Frame = 1
Query:  436 LIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEE----ETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLKFD--KSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK 1017
            +IY  G    G +         RL  V+      T + EV   +  LNS D F+L T    + W+G GA++ EK  A++ ++ L   R+    VE   E     E L     Y     +K   D+K    + +   ++F  S+  G    E++  +  + +L  +DV ++D+  +V V++G++S  +E+ ++L  A  Y++
Sbjct:  543 IIYKGGTSRDGGQTAPASI---RLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTGAQELLKVL---RSQHVQVEEGSEPDAFWEALGGKTAYRTSPRLK---DKK----MDAHPPRLFACSNRIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIE 730          

HSP 4 Score: 52.7582 bits (125), Expect = 6.634e-19
Identity = 35/86 (40.70%), Postives = 44/86 (51.16%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKE--KENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
            IWRIE    +       G FY GDSYIIL N +   ++  ++Y+   W G  STQDE   +   T +LD  L   PVQ R VQ  E
Sbjct:  447 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKE 529          
BLAST of Gelsolin-like protein 2 vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 94.7449 bits (234), Expect = 1.921e-40
Identity = 46/103 (44.66%), Postives = 63/103 (61.17%), Query Frame = 2
Query:  131 KLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            K   +  L IWR+EKF ++  P    G F+ GD+Y+IL  ++ +   L YDLH+W+G   +QDE G A   TV+LD  L+ R VQHREVQ +ES  F  Y K+
Sbjct:   21 KAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKS 123          

HSP 2 Score: 91.2781 bits (225), Expect = 1.921e-40
Identity = 71/229 (31.00%), Postives = 118/229 (51.53%), Query Frame = 1
Query:  412 SFQELFKE-LIYLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPV-----DDEKNFTALSSQEKQIFRISDITGSLKFEKL----KFDKSNLDENDVFIIDSGME--VIVYIGENSSPDERKKSLIYAHEYLKETGHP-QAPVTVL 1053
            +F   FK  L Y KGG  SGF+ +V  +    RL  VKGR R +  +EV  +  + N+ D FILD G  I+QW G G+NK E+ KA Q  + + +++R+ +  V V   EE  +       L   KP      +D     A + +  +++++S+  GS+    +     F +  L   D FI+D G +  + V+ G+ ++ +ERK +L  A +++ +  +P Q  V+VL
Sbjct:  116 TFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGR-RVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHV--SEEGGEPEAMLQVLGP-KPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVL 340          

HSP 3 Score: 52.7582 bits (125), Expect = 5.205e-10
Identity = 35/86 (40.70%), Postives = 44/86 (51.16%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKE--KENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
            IWRIE    +       G FY GDSYIIL N +   ++  ++Y+   W G  STQDE   +   T +LD  L   PVQ R VQ  E
Sbjct:  409 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKE 491          

HSP 4 Score: 30.4166 bits (67), Expect = 5.205e-10
Identity = 15/44 (34.09%), Postives = 21/44 (47.73%), Query Frame = 1
Query:  502 RLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIG 630
            RL  V+      T + EV   +  LNS D F+L T    + W+G
Sbjct:  524 RLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVG 567          
BLAST of Gelsolin-like protein 2 vs. Ensembl Mouse
Match: Gsn (gelsolin [Source:MGI Symbol;Acc:MGI:95851])

HSP 1 Score: 94.3597 bits (233), Expect = 2.374e-40
Identity = 46/103 (44.66%), Postives = 63/103 (61.17%), Query Frame = 2
Query:  131 KLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            K   +  L IWR+EKF ++  P    G F+ GD+Y+IL  ++ +   L YDLH+W+G   +QDE G A   TV+LD  L+ R VQHREVQ +ES  F  Y K+
Sbjct:   10 KAGKEPGLQIWRVEKFDLVPVPPNLYGDFFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESSTFSGYFKS 112          

HSP 2 Score: 91.2781 bits (225), Expect = 2.374e-40
Identity = 71/229 (31.00%), Postives = 118/229 (51.53%), Query Frame = 1
Query:  412 SFQELFKE-LIYLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPV-----DDEKNFTALSSQEKQIFRISDITGSLKFEKL----KFDKSNLDENDVFIIDSGME--VIVYIGENSSPDERKKSLIYAHEYLKETGHP-QAPVTVL 1053
            +F   FK  L Y KGG  SGF+ +V  +    RL  VKGR R +  +EV  +  + N+ D FILD G  I+QW G G+NK E+ KA Q  + + +++R+ +  V V   EE  +       L   KP      +D     A + +  +++++S+  GS+    +     F +  L   D FI+D G +  + V+ G+ ++ +ERK +L  A +++ +  +P Q  V+VL
Sbjct:  105 TFSGYFKSGLKYKKGGVASGFKHVVPNEVVVQRLFQVKGR-RVVRATEVPVSWDSFNNGDCFILDLGNNIYQWCGSGSNKFERLKATQVSKGIRDNERSGRAQVHV--SEEGGEPEAMLQVLGP-KPALPEGTEDTAKEDAANRRLAKLYKVSNGAGSMSVSLVADENPFAQGALRSEDCFILDHGRDGKIFVWKGKQANMEERKAALKTASDFISKMQYPRQTQVSVL 329          

HSP 3 Score: 60.4622 bits (145), Expect = 1.026e-18
Identity = 53/204 (25.98%), Postives = 95/204 (46.57%), Query Frame = 1
Query:  430 KELIYLKGGC-ESGFRIVNVQTYNPRLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEE----ETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLKFD--KSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK 1017
            K +I  KGG    G +         RL  V+      T + EV   +  LNS D F+L T    + W+G GA++ EK  A++ ++ L   R+    VE   E     E L     Y     +K   D+K    + +   ++F  S+  G    E++  +  + +L  +DV ++D+  +V V++G++S  +E+ ++L  A  Y++
Sbjct:  491 KPMIIYKGGTSRDGGQTAPASI---RLFQVRASSSGATRAVEVMPKSGALNSNDAFVLKTPSAAYLWVGAGASEAEKTGAQELLKVL---RSQHVQVEEGSEPDAFWEALGGKTAYRTSPRLK---DKK----MDAHPPRLFACSNRIGRFVIEEVPGELMQEDLATDDVMLLDTWDQVFVWVGKDSQEEEKTEALTSAKRYIE 681          

HSP 4 Score: 52.7582 bits (125), Expect = 1.026e-18
Identity = 35/86 (40.70%), Postives = 44/86 (51.16%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKE--KENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
            IWRIE    +       G FY GDSYIIL N +   ++  ++Y+   W G  STQDE   +   T +LD  L   PVQ R VQ  E
Sbjct:  398 IWRIEGSNKVPVDPATYGQFYGGDSYIILYNYRHGGRQGQIIYN---WQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKE 480          
BLAST of Gelsolin-like protein 2 vs. Ensembl Mouse
Match: Scin (scinderin [Source:MGI Symbol;Acc:MGI:1306794])

HSP 1 Score: 91.2781 bits (225), Expect = 3.798e-38
Identity = 66/207 (31.88%), Postives = 106/207 (51.21%), Query Frame = 1
Query:  436 LIYLKGGCESGF-RIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLS---DIKPVDDEKNFTALSSQEK--QIFRISDITGSLKF----EKLKFDKSNLDENDVFIIDSGM--EVIVYIGENSSPDERKKSLIYAHEYLKE 1020
            L Y  GG  SG   ++       RLLHVKGR R +  +EV  + ++ N  D FI+D G +I+QW G   NK E+ KA Q    +  D   K   ++I  EE  +  E    L    ++   D++ +  A  S  K  +++ +SD +GS+K     E+  F    L   + FI+D G   ++ V+ G+N++P ERK ++  A E+L++
Sbjct:  115 LKYKAGGVASGLNHVLTNDLTAKRLLHVKGR-RVVRATEVPLSWESFNKGDCFIIDLGTEIYQWCGSSCNKYERLKASQVAIGIR-DNERKGRSQLIVVEEGSEPSELMKVLGRKPELPDGDNDDDVVADISNRKMAKLYMVSDASGSMKVTLVAEENPFSMGMLLSEECFILDHGAAKQIFVWKGKNANPQERKTAMKTAEEFLQK 319          

HSP 2 Score: 87.0409 bits (214), Expect = 3.798e-38
Identity = 41/103 (39.81%), Postives = 60/103 (58.25%), Query Frame = 2
Query:  128 AKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            A+   ++ L +WR+EK +++  P    G FY GD+Y++L+  +      Y LHFW+GK  +QDE   A   TV++D  L  +PVQ RE+Q YES  F  Y K 
Sbjct:   11 ARAGQQAGLQVWRVEKLELVPVPQGAYGDFYVGDAYLVLHTTKSSRGFSYRLHFWLGKECSQDESTAAAIFTVQMDDYLGGKPVQSRELQGYESTDFVGYFKG 113          

HSP 3 Score: 59.3066 bits (142), Expect = 1.834e-16
Identity = 52/181 (28.73%), Postives = 90/181 (49.72%), Query Frame = 1
Query:  502 RLLHVKGRKRSIT-VSEVSATTKNLNSEDVFILDTGMK-IFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLS-----DIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLK 1017
            RL  V+    SIT + EV     +LNS D F+L       F WIGKGA+++E+  A      L      KC    I  +E  +  EF+N L         P+ +    T       +++  S+ TG    E++  +F + +L E+DV ++D+  ++ ++IG++++  E+K+S+  A  YL+
Sbjct:  511 RLFQVRRNLASITRIVEVDVDANSLNSNDTFVLKLPRNNGFIWIGKGASQEEEKGAEYVADVL------KCKASRI--QEGKEPEEFWNSLGGRGDYQTSPLLE----TRAEDHPPRLYGCSNKTGRFIIEEVPGEFTQDDLAEDDVMLLDAWEQIFIWIGKDANEVEKKESVKSAKMYLE 679          

HSP 4 Score: 45.8246 bits (107), Expect = 1.834e-16
Identity = 28/83 (33.73%), Postives = 41/83 (49.40%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
            IWR+E    ++      G FY GD YIIL    +  +    ++ W G  +T+DE   + + TV+LD  L  + VQ R  Q  E
Sbjct:  400 IWRVENSGRVQIDPSSYGEFYGGDCYIILYTYPRGQI----IYTWQGANATRDELTMSAFLTVQLDRSLGGQAVQVRVSQGKE 478          
BLAST of Gelsolin-like protein 2 vs. UniProt/SwissProt
Match: sp|Q7JQD3|GELS1_LUMTE (Gelsolin-like protein 1 OS=Lumbricus terrestris OX=6398 GN=AM PE=1 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 5.191e-79
Identity = 90/144 (62.50%), Postives = 104/144 (72.22%), Query Frame = 2
Query:   11 NMQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNI---KEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSK 433
             + K ++Y WKDSN+AL GS  +++VKK SA TE AWK A    K  L IWRI  FKV EWP  Q+G FY GDSYIILN      K N L YD+HFWIG  S+QDEYGTA YKTVELDT LDD+PVQHREVQ YES+LF++Y K
Sbjct:    4 GLIKAKEYDWKDSNLALFGSDTEKQVKKDSAATEPAWKGA--GQKEGLKIWRIVNFKVTEWPQNQHGKFYNGDSYIILNTYKPDPKSNELAYDVHFWIGSQSSQDEYGTAAYKTVELDTFLDDKPVQHREVQGYESELFRNYFK 145          

HSP 2 Score: 141.739 bits (356), Expect = 5.191e-79
Identity = 83/231 (35.93%), Postives = 131/231 (56.71%), Query Frame = 1
Query:  415 FQELFKE-LIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFT-ALSSQEKQIFRISDITGSLKFEKLK---FDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFN 1092
            F+  FK+ L  L+GG E+GF  V    Y PRLLH  G+K+ I V EV    + L+ +DVFILD G+ ++QW GK ++K+E FKA Q++  + S+R  K   E +++E T ++H+FY  L+      DE N    L  +E Q+ ++SD  G LK  ++K    +  +   NDVFI+D+G +  V++G+        +    +H +L +T HP AP+ V+    +G+    FN
Sbjct:  140 FRNYFKQGLTILEGGAETGFHHVKPTEYKPRLLHFSGQKQQIYVHEVPLVKERLDHKDVFILDLGLTLYQWNGKESSKEEGFKAMQYLGLMRSER-PKAEAETLEDESTPESHKFYTSLTGT----DEPNLVKPLVKEENQLLKVSDAGGHLKTTEVKRGAVNSKDFSSNDVFILDTGDQCFVWVGKGRFAVGEAEWTRISHAHLMKTCHPLAPIHVIK---EGQLCKAFN 362          
BLAST of Gelsolin-like protein 2 vs. UniProt/SwissProt
Match: sp|Q8MPM1|GELS2_LUMTE (Gelsolin-like protein 2 OS=Lumbricus terrestris OX=6398 GN=gelsolin PE=1 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 2.147e-73
Identity = 81/145 (55.86%), Postives = 98/145 (67.59%), Query Frame = 2
Query:   11 NMQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILN---IKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
             + K ++Y WKDSN+A+ GS+ D+ VKK SA  EAAWK   +  K  L IWRI  FKV EWP +  G F+ GDSYIILN   +K +E  L YD+HFWIG  STQDEY  A YKTVELD  LDD  +QHR+ +  ESDLF SY +N
Sbjct:    3 GLVKAKRYDWKDSNLAMFGSALDKSVKKESALKEAAWK--GVGEKVGLKIWRIVNFKVTEWPEKDYGSFFSGDSYIILNTYKLKGREE-LAYDVHFWIGSKSTQDEYCVAAYKTVELDAYLDDAAIQHRDAEGNESDLFLSYFEN 144          

HSP 2 Score: 147.517 bits (371), Expect = 2.147e-73
Identity = 81/208 (38.94%), Postives = 118/208 (56.73%), Query Frame = 1
Query:  436 LIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLS--DIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLK---FDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPV 1044
            L  ++GG E GF  V  + Y  RLLH  G K+ I V EV    + L S+DVFILD G  ++QW G G+NKDE+FKA Q++Q L ++R      + ++EE    +HEFY  L+  D    +D+ +  A+    K + R+SD  G  K   +K      S+LD  DVFI+D+G    V++G  +S  E++  L YAH +L +T HP  P+
Sbjct:  146 LTIMEGGAEMGFNNVKPEEYKARLLHFSGLKKHIVVKEVPLCPQRLKSDDVFILDLGRTLYQWNGTGSNKDERFKAMQYLQNLKAERG-AATSKTLEEEHIDKSHEFYTSLTGEDEDLPEDQTDSAAV----KTLLRVSDAAGHFKSTVVKTGHIAASDLDSKDVFILDNGSTCFVWVGNGASAQEKRNGLGYAHSHLMKTPHPLIPI 348          
BLAST of Gelsolin-like protein 2 vs. UniProt/SwissProt
Match: sp|Q24800|SEVE_ECHGR (Severin OS=Echinococcus granulosus OX=6210 GN=AG8 PE=2 SV=3)

HSP 1 Score: 154.066 bits (388), Expect = 1.635e-64
Identity = 76/141 (53.90%), Postives = 95/141 (67.38%), Query Frame = 2
Query:   11 NMQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKE--NVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSY 427
             + K + Y WKDSN+ L GSS+DR+VKK SA TE  W+         L++WR+ +F +   P+++ G FY GDSY+I         + LLY++HFWIGK ST DEYGTA YKTVELDT LDD  VQHREV+ YES LFKSY
Sbjct:    3 GLVKAKDYDWKDSNMELFGSSKDRQVKKESAMTEKCWEPVGRATSPFLMVWRVNQFTLEPVPSDEIGNFYNGDSYVICKATRSPGGDKLLYNVHFWIGKHSTADEYGTAAYKTVELDTFLDDAAVQHREVEGYESQLFKSY 143          

HSP 2 Score: 115.161 bits (287), Expect = 1.635e-64
Identity = 74/225 (32.89%), Postives = 122/225 (54.22%), Query Frame = 1
Query:  415 FQELFKELIYLK----GGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDN----HEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLN 1056
            F+  F +L+ LK    GG  SGFR V    Y PRLL      ++  + +V+ + ++++S DVFILD G + +Q+ G   +  EK  A  F+Q L S RN +C   V+DE +T  +    HEF+  L D+ PV   K         K ++++SD +G L+   +      K ++  +DV+II +   + VYIG++ S  E++ +L  AH++L+   +P  P+TV+ 
Sbjct:  140 FKSYFDKLVILKVILKGGYASGFRHVKPDEYRPRLLRFCKEGKTTYMRQVAFSKQSVHSGDVFILDLGSRAYQFNGSKCSAFEKSSAAAFLQDLESKRNGRCNTSVLDEADTPQDVGVLHEFWTALPDV-PV---KELEPPKEVIKSLYKLSDSSGKLELTIVSEGSASKHDIKPDDVYIILTKEGLFVYIGKDCSVLEKRNALSNAHKFLQTCPNPFLPITVVT 360          
BLAST of Gelsolin-like protein 2 vs. UniProt/SwissProt
Match: sp|Q10L71|VLN2_ORYSJ (Villin-2 OS=Oryza sativa subsp. japonica OX=39947 GN=VLN2 PE=2 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.832e-45
Identity = 54/94 (57.45%), Postives = 63/94 (67.02%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIIL--NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSK 433
            IWRI+ FK +  P    G FY GDSYI+L     +     L+D+HFWIGK S+QDE GTA  KTVELDT+L  R VQHRE+Q YESD F SY K
Sbjct:   23 IWRIQDFKPVPLPKADYGKFYNGDSYIVLQTTCSKGGGAYLFDIHFWIGKDSSQDEAGTAAIKTVELDTMLGGRAVQHRELQGYESDKFLSYFK 116          

HSP 2 Score: 95.1301 bits (235), Expect = 1.832e-45
Identity = 72/240 (30.00%), Postives = 118/240 (49.17%), Query Frame = 1
Query:  415 FQELFKE-LIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLN-SDRNDKCLVEVIDE---EETLDNHEFYNFLSDIKPV------DDEKNFTALSSQEKQIFRISDITGSLKFEKLKFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            F   FK  +I L+GG  SGF+      +  RL   KG KR+I V EV     +LN +DVFILDT  KI+Q+ G  +N  E+ KA + +Q L  +  N  C V ++D+   +   D+ EF+       P+      DD+     L +   +++ I++  G LK E     KS L+ N  F++D G ++ +++G  +  +ERK +     E++     P+   T + + + G     F + F
Sbjct:  111 FLSYFKPCIIPLEGGFASGFKTPEEDKFETRLYICKG-KRAIRVKEVPFARSSLNHDDVFILDTEKKIYQFNGANSNIQERAKALEAIQHLKETYHNGVCDVAIVDDGKLQAESDSGEFWVLFGGFAPIGKKAICDDD---VVLETTAPKLYSINN--GQLKLEDTVLTKSILENNKCFLVDCGSDLFIWVGRLTQVEERKAASAAVEEFIATQNRPK--TTRVTRVIQGYENHTFKSKF 342          

HSP 3 Score: 60.4622 bits (145), Expect = 2.279e-12
Identity = 60/243 (24.69%), Postives = 109/243 (44.86%), Query Frame = 1
Query:  415 FQELFKELIYLKGGCESGF------RIVNVQTYNP---RLLHVKGRK-RSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKF-EKLKFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETG--HPQAPVTVLNKKVDGKNLDRFNNIFT 1104
            F  LF+ ++ LKGG  SG+      + +  +TY+     L  + G    +  V +V A + NL+  D F+L +G  +F WIG  ++ +++  A +  + L      K  V V   +E  ++  F+ F    K     +N T    +E  ++  S   G L+  E   F + +L   D+ ++D+  EV V++G+     E++K+     +Y +        +P   L K V+G     F   F+
Sbjct:  486 FIALFQPMVILKGGISSGYQKFVEEKGLKDETYSGDGIALFRISGTSIHNNKVLQVDAVSSNLSPTDCFVLQSGNSMFTWIGNASSYEQQQWAAKVAEFL------KPGVAVKHCKEGTESSAFW-FALGGKQNYTSRNATHDVVREPHLYTFSLRNGKLEVTEIFNFSQDDLLTEDMMVLDTHGEVFVWMGQCVDAKEKQKAFEIGQKYAEHAAAFESLSPDVPLYKVVEGNEPCFFRTYFS 721          

HSP 4 Score: 33.8834 bits (76), Expect = 2.279e-12
Identity = 27/80 (33.75%), Postives = 34/80 (42.50%), Query Frame = 2
Query:  194 PNEQNGVFYEGDSYIIL-----NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLF 418
            P E+ G FY GD YI+L       K +E  L Y    WIGK S  ++   A      +   L  RP+  R  Q  E   F
Sbjct:  411 PKEELGKFYSGDCYIVLYTYHSGDKREEFYLTY----WIGKDSIPEDQEMAFQTANSIWNSLKGRPILGRIYQGKEPPQF 486          
BLAST of Gelsolin-like protein 2 vs. UniProt/SwissProt
Match: sp|Q07171|GELS_DROME (Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel PE=1 SV=2)

HSP 1 Score: 101.679 bits (252), Expect = 9.523e-45
Identity = 56/126 (44.44%), Postives = 75/126 (59.52%), Query Frame = 2
Query:   83 EVKKSSAETEAAWKR------AKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKE--KENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            E++ S   ++ A +R      A       L IWRIE F+ + +P    G FY GDS+I+LN  E  K+  L +D+HFW+G  ++ DE G A   TV+LD LL+  PVQHREVQ +ES LF SY KN
Sbjct:   43 EIQPSGQNSKQAARRVMHPSFANAGRTPGLEIWRIENFEPVIYPKTNYGKFYTGDSFIVLNTIENKKDKKLSWDVHFWLGLETSTDEAGAAAILTVQLDDLLNGGPVQHREVQDHESQLFLSYFKN 168          

HSP 2 Score: 101.293 bits (251), Expect = 9.523e-45
Identity = 69/246 (28.05%), Postives = 124/246 (50.41%), Query Frame = 1
Query:  415 FQELFKELI-YLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEET-LDNHEFYNFLS--------DIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIFTT 1107
            F   FK  I Y +GG  +GF+ V        RL  VKG KR++ V +V+ +  ++N+ D FILD G  I+ ++G  A + EK KA     Q+ + D N +  V+++D+  T  D   F++ L         D    D++  F    +    ++++SD +G LK + +      ++ LD  + FI+D+G  + V++G+ ++  E+  ++  A E+L+   +P    T +++ V+G     F   F T
Sbjct:  162 FLSYFKNGIRYEQGGVGTGFKHVETNAQGETRLFQVKG-KRNVRVRQVNLSVSSMNTGDCFILDAGSDIYVYVGSQAKRVEKLKAISAANQIRDQDHNGRARVQIVDDFSTDADKQHFFDVLGSGSADQVPDESTADEDSAFERTDAAAVSLYKVSDASGKLKVDIIGQKPLTQAMLDTRECFILDTGSGIFVWVGKGATQKEKTDAMAKAQEFLRTKKYP--AWTQIHRIVEGSESAPFKQYFDT 404          
BLAST of Gelsolin-like protein 2 vs. TrEMBL
Match: A0A267FTU3 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033145g1 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 5.041e-100
Identity = 99/238 (41.60%), Postives = 154/238 (64.71%), Query Frame = 1
Query:  415 FQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSD--IKPVDD--EKNFT-ALSSQEKQIFRISDITGSLKFEKLK----FDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            F+  F E+ Y+ GGC SGF  V+ + Y PRL H KG +R+I V EV+ + K L+  DV+ILD G + +QW  +G NKDE+FKA Q++++L  +RN +   EV+D+++  + HEFYN L+D  ++P+ D  + +F+ A S  +K ++R+S  +GSL+F ++       +  + E DVFIID+G E+ VY+GEN+SPDE   +L YAH+Y  E  +P  P+TV+N K   +    F ++F
Sbjct:  137 FKSYFPEITYMSGGCPSGFNKVHTREYTPRLFHFKGERRNIIVKEVTMSRKALDETDVYILDLGDRAYQWNSRGCNKDERFKAAQYLRKLCEERNGRLDTEVLDQDDAEEEHEFYNSLTDEELEPISDLEQASFSMAFSQPDKSVYRLSGESGSLEFSEVSRGPAASRGAVTEEDVFIIDNGHEIYVYVGENASPDEIHNALTYAHKYANELSNPLLPLTVVNSKAPARTRRAFESVF 374          

HSP 2 Score: 190.66 bits (483), Expect = 5.041e-100
Identity = 89/140 (63.57%), Postives = 112/140 (80.00%), Query Frame = 2
Query:   14 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNI--KEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSY 427
            MQKP++Y+WKD+N+AL GS E+R+VKK +AE E AW     C++  L +WRIE+FKV +W ++  G F++GDSYI+LN+  +E E+ L YD+HFWIG  ST DEYGTA YKTVELDTLLDDRPVQHREVQ +ESDLFKSY
Sbjct:    1 MQKPQQYSWKDTNLALFGSDEERKVKKEAAELEPAWAEVLECSEPKLFVWRIEQFKVAKWESDLYGKFFDGDSYIVLNVYQEEDEDKLCYDIHFWIGVHSTADEYGTAAYKTVELDTLLDDRPVQHREVQGHESDLFKSY 140          
BLAST of Gelsolin-like protein 2 vs. TrEMBL
Match: A0A1I8FYV1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 4.635e-98
Identity = 105/235 (44.68%), Postives = 151/235 (64.26%), Query Frame = 1
Query:  406 IRSFQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLKFD---KSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            +RS+   F E+ YL GGC SGFR V  + Y PRLLHV+G +++I V+EV  + K L++ DV+ILD G +  QW G GANK+EKFKA Q++  L S+RN +     ++E+ T   HEFY  L+D +   D  +  +  +Q K++ ++SD TG L F+ +  D   KSN+ E+DVFIID+G EV VY+GEN+S  ER  +L YAH YL+++ +P  PVTV+  +   K    FN +F
Sbjct:  135 MRSY---FPEITYLAGGCPSGFRNVTTREYKPRLLHVRGERQNIVVTEVPRSRKALDNTDVYILDLGDRAIQWNGSGANKNEKFKAAQYLSNLKSERNGRLAASTLEEDGTPTEHEFYTSLTDEEVERDSASGGSPGAQ-KRMMKLSDATGKLNFDLVSTDSLSKSNITEDDVFIIDNGFEVYVYVGENASMTERHNALAYAHNYLRDSVNPLLPVTVVTPQAPAKTKAAFNAVF 365          

HSP 2 Score: 182.57 bits (462), Expect = 4.635e-98
Identity = 89/138 (64.49%), Postives = 102/138 (73.91%), Query Frame = 2
Query:   14 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSY 427
            M KP++Y WKDSN+AL GS  +R+VKK SAE E AWK      K  L +WRIE FKV+EWP +  G FY GDSYIILN   + + L YD+HFWIGK ST DEYGTA YKTVELDTLLDD PVQHREVQ +ES L +SY
Sbjct:    1 MNKPKQYDWKDSNLALFGSDTERQVKKESAEKEPAWKPVLEAQKPQLYVWRIENFKVVEWPRDLYGKFYSGDSYIILNAYMEADKLCYDVHFWIGKESTADEYGTAAYKTVELDTLLDDLPVQHREVQGHESALMRSY 138          
BLAST of Gelsolin-like protein 2 vs. TrEMBL
Match: A0A1I8GIF7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 5.383e-98
Identity = 105/235 (44.68%), Postives = 151/235 (64.26%), Query Frame = 1
Query:  406 IRSFQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLKFD---KSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            +RS+   F E+ YL GGC SGFR V  + Y PRLLHV+G +++I V+EV  + K L++ DV+ILD G +  QW G GANK+EKFKA Q++  L S+RN +     ++E+ T   HEFY  L+D +   D  +  +  +Q K++ ++SD TG L F+ +  D   KSN+ E+DVFIID+G EV VY+GEN+S  ER  +L YAH YL+++ +P  PVTV+  +   K    FN +F
Sbjct:  135 MRSY---FPEITYLAGGCPSGFRNVTTREYKPRLLHVRGERQNIVVTEVPRSRKALDNTDVYILDLGDRAIQWNGSGANKNEKFKAAQYLSNLKSERNGRLAASTLEEDGTPTEHEFYTSLTDEEVERDSASGGSPGAQ-KRMMKLSDATGKLNFDLVSTDSLSKSNITEDDVFIIDNGFEVYVYVGENASLTERHNALAYAHNYLRDSVNPLLPVTVVTPQAPAKTKAAFNAVF 365          

HSP 2 Score: 182.57 bits (462), Expect = 5.383e-98
Identity = 89/138 (64.49%), Postives = 102/138 (73.91%), Query Frame = 2
Query:   14 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSY 427
            M KP++Y WKDSN+AL GS  +R+VKK SAE E AWK      K  L +WRIE FKV+EWP +  G FY GDSYIILN   + + L YD+HFWIGK ST DEYGTA YKTVELDTLLDD PVQHREVQ +ES L +SY
Sbjct:    1 MNKPKQYDWKDSNLALFGSDTERQVKKESAEKEPAWKPVLEAQKPQLYVWRIENFKVVEWPRDLYGKFYSGDSYIILNAYMEADKLCYDVHFWIGKESTADEYGTAAYKTVELDTLLDDLPVQHREVQGHESALMRSY 138          
BLAST of Gelsolin-like protein 2 vs. TrEMBL
Match: A0A1W6I1A3 (Gelsolin-like protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 4.794e-95
Identity = 104/141 (73.76%), Postives = 118/141 (83.69%), Query Frame = 2
Query:   14 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            M+K EKY WKDSNV L GSSEDR VKKSSA+TE AW  AK C  + L IWRIEKFKV+EWP ++ G F+EGDSYI+LNI +KE  LLYD+HFWIGK+STQDEYGTA YKTVELDTLLDD+P+QHREVQ YESD+FKSY  N
Sbjct:    1 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN 141          

HSP 2 Score: 156.762 bits (395), Expect = 4.794e-95
Identity = 72/105 (68.57%), Postives = 86/105 (81.90%), Query Frame = 1
Query:  415 FQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDE 729
            F+  F  +IYLKGGCESGFR VN + YNPRLLHV+G K +I +SEVS+T KNLNS+DVFI D+G  I+QWIGKGANKDE+ KA+QF QQLNSDRN K  +EV+DE
Sbjct:  135 FKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERXKAQQFAQQLNSDRNGKLKIEVLDE 239          
BLAST of Gelsolin-like protein 2 vs. TrEMBL
Match: A0A1I8GFK5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019412g3 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.061e-93
Identity = 89/142 (62.68%), Postives = 108/142 (76.06%), Query Frame = 2
Query:   14 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENV--LLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSK 433
            MQKP+KY WKDSN+AL GS  +++VKK+++E E AW+  K C    L +WRIEKFKV  WP E  G F+ GDSYI+LN+ +  +   LLYD+HFWIGK STQDEYGTA YKTVELDT LDD+ VQHREVQ +ES +FKSY K
Sbjct:    1 MQKPQKYDWKDSNLALFGSKTEKDVKKAASEVETAWQPVKECTSDELFVWRIEKFKVKAWPKEDYGKFFSGDSYIVLNVYKDPDGDELLYDVHFWIGKHSTQDEYGTAAYKTVELDTFLDDKAVQHREVQEHESSMFKSYFK 142          

HSP 2 Score: 185.652 bits (470), Expect = 1.061e-93
Identity = 95/228 (41.67%), Postives = 136/228 (59.65%), Query Frame = 1
Query:  415 FQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTA-LSSQEKQIFRISDITGSLKFEKLK---FDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDR 1086
            F+  FK + YLKGGC +GFR V  + Y PRLLH  G +R+I V EV  T K LNS DVFILD G   +QW GK  NKDE+ KA  F+QQL ++R+ K     +DE      H+FY  L D+          + + S +K +FR+SD +G L++  +      +S ++E+DV+IID+G+E+ VY+G  +S  E+  +L YAH+YLK T HP  PVT     +    +++
Sbjct:  137 FKSYFKTITYLKGGCATGFRQVKPEEYKPRLLHFCGVRRNIEVKEVKLTRKALNSNDVFILDLGRTAYQWNGKTCNKDERIKAAAFLQQLENERHGKTQTFTLDENSIGSEHKFYQSLPDVPYAKKSSEVKSDVRSGKKAMFRLSDESGKLQYSLVSEGNCPRSMINEDDVYIIDTGVEIFVYVGARASDAEKMNALQYAHDYLKTTQHPLIPVTACRGNMKNPQMEK 364          
BLAST of Gelsolin-like protein 2 vs. Ensembl Cavefish
Match: gsna (gelsolin-like [Source:NCBI gene;Acc:103033745])

HSP 1 Score: 104.76 bits (260), Expect = 1.076e-46
Identity = 72/230 (31.30%), Postives = 130/230 (56.52%), Query Frame = 1
Query:  409 RSFQELFKE-LIYLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKP-----VDDEKNFTALSSQEKQIFRISDITGSLKFEKLK----FDKSNLDENDVFIIDSGM--EVIVYIGENSSPDERKKSLIYAHEYLKETGHP-QAPVTVL 1053
            ++F   FK+ L Y+KGG  SGF+ +V  +    R+L VKGR R +  +EV  +  + N+ D FILD G +I+QW G  +N+ EK K+ Q  + + +++R+ +  V V D  E ++  +    L + KP       D+    A + +  +++++SD +GS+    +     F +S L+  D FI+D G   ++ V+ G++++ +ERK ++  A E++K+ G+P Q  V +L
Sbjct:  103 KTFLGYFKKGLQYMKGGVASGFKHVVTNEVVVQRVLQVKGR-RVVRATEVPVSWDSFNTGDCFILDLGNEIYQWCGSKSNRFEKLKSTQLAKAIRDNERSGRARVYVCD--EGVEREKILEVLGE-KPDLPEGAGDDLKADASNRKLAKLYKVSDASGSMTMALVADENPFSQSALESTDCFILDHGSNGKIFVWKGKDANVEERKAAMKAADEFIKKMGYPKQTQVQIL 328          

HSP 2 Score: 102.064 bits (253), Expect = 1.076e-46
Identity = 48/98 (48.98%), Postives = 64/98 (65.31%), Query Frame = 2
Query:  143 KSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILN-IKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSK 433
            +  L +WRIEKF ++  P    G FY GD+Y+ILN IK++   L YDLHFW+G   TQDE G+A   TV++D  L  +P+Q+REVQ +ES  F  Y K
Sbjct:   13 QPGLQVWRIEKFDLVAVPENLYGGFYTGDAYVILNTIKQRSGNLQYDLHFWLGDHCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGFESKTFLGYFK 110          

HSP 3 Score: 65.0846 bits (157), Expect = 2.898e-19
Identity = 60/232 (25.86%), Postives = 101/232 (43.53%), Query Frame = 1
Query:  430 KELIYLKGGCE-SGFRIVNVQTYNPRLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQ----EKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            K ++  KGG    G +    +T   RL  V+      T + EV A + NLNS D FIL T    F W+G GA+  EK    Q  Q L       C +  +   E  +  E  +F + +      +  T L  +      ++F  S+ TG    E++  +  + +L  +DV I+D+  +V V++G  +  +E+ +++  A  Y++     + P T + K   G     F   F
Sbjct:  499 KPMVVYKGGTSREGGQSALAET---RLFQVRSNSAGCTRAVEVDAVSSNLNSNDAFILVTPAGSFMWVGVGASDSEK----QGAQGL-------CDILGVSASEITEGGESDDFWAALGGKAAYRTSTRLKDKMDVHPPRLFACSNKTGRFIIEEVPGEMTQEDLATDDVMILDTWDQVFVWVGNEAQEEEKTEAVASAARYIETDPAKRDPRTPIVKIKQGSEPPTFTGWF 716          

HSP 4 Score: 49.6766 bits (117), Expect = 2.898e-19
Identity = 29/75 (38.67%), Postives = 36/75 (48.00%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQ 382
            IWRIE    +      +G FY GDSYIIL          + ++ W G  STQDE G +     +LD  L   PVQ
Sbjct:  397 IWRIEGADKVPVDPSTHGQFYGGDSYIILYNYRHGGRQGHIIYIWQGVDSTQDEIGASAILAAQLDDELGGGPVQ 471          
BLAST of Gelsolin-like protein 2 vs. Ensembl Cavefish
Match: gsna (gelsolin-like [Source:NCBI gene;Acc:103033745])

HSP 1 Score: 104.76 bits (260), Expect = 1.239e-46
Identity = 72/230 (31.30%), Postives = 130/230 (56.52%), Query Frame = 1
Query:  409 RSFQELFKE-LIYLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKP-----VDDEKNFTALSSQEKQIFRISDITGSLKFEKLK----FDKSNLDENDVFIIDSGM--EVIVYIGENSSPDERKKSLIYAHEYLKETGHP-QAPVTVL 1053
            ++F   FK+ L Y+KGG  SGF+ +V  +    R+L VKGR R +  +EV  +  + N+ D FILD G +I+QW G  +N+ EK K+ Q  + + +++R+ +  V V D  E ++  +    L + KP       D+    A + +  +++++SD +GS+    +     F +S L+  D FI+D G   ++ V+ G++++ +ERK ++  A E++K+ G+P Q  V +L
Sbjct:  103 KTFLGYFKKGLQYMKGGVASGFKHVVTNEVVVQRVLQVKGR-RVVRATEVPVSWDSFNTGDCFILDLGNEIYQWCGSKSNRFEKLKSTQLAKAIRDNERSGRARVYVCD--EGVEREKILEVLGE-KPDLPEGAGDDLKADASNRKLAKLYKVSDASGSMTMALVADENPFSQSALESTDCFILDHGSNGKIFVWKGKDANVEERKAAMKAADEFIKKMGYPKQTQVQIL 328          

HSP 2 Score: 101.679 bits (252), Expect = 1.239e-46
Identity = 48/98 (48.98%), Postives = 64/98 (65.31%), Query Frame = 2
Query:  143 KSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILN-IKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSK 433
            +  L +WRIEKF ++  P    G FY GD+Y+ILN IK++   L YDLHFW+G   TQDE G+A   TV++D  L  +P+Q+REVQ +ES  F  Y K
Sbjct:   13 QPGLQVWRIEKFDLVAVPENLYGGFYTGDAYVILNTIKQRSGNLQYDLHFWLGDHCTQDESGSAAIFTVQMDDYLGGKPIQYREVQGFESKTFLGYFK 110          

HSP 3 Score: 65.0846 bits (157), Expect = 1.404e-20
Identity = 60/232 (25.86%), Postives = 101/232 (43.53%), Query Frame = 1
Query:  430 KELIYLKGGC-ESGFRIVNVQTYNPRLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQ----EKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            K ++  KGG    G +    +T   RL  V+      T + EV A + NLNS D FIL T    F W+G GA+  EK    Q  Q L       C +  +   E  +  E  +F + +      +  T L  +      ++F  S+ TG    E++  +  + +L  +DV I+D+  +V V++G  +  +E+ +++  A  Y++     + P T + K   G     F   F
Sbjct:  490 KPMVVYKGGTSREGGQSALAET---RLFQVRSNSAGCTRAVEVDAVSSNLNSNDAFILVTPAGSFMWVGVGASDSEK----QGAQGL-------CDILGVSASEITEGGESDDFWAALGGKAAYRTSTRLKDKMDVHPPRLFACSNKTGRFIIEEVPGEMTQEDLATDDVMILDTWDQVFVWVGNEAQEEEKTEAVASAARYIETDPAKRDPRTPIVKIKQGSEPPTFTGWF 707          

HSP 4 Score: 53.9138 bits (128), Expect = 1.404e-20
Identity = 33/83 (39.76%), Postives = 40/83 (48.19%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
            IWRIE    +      +G FY GDSYIIL          + ++ W G  STQDE G +     +LD  L   PVQ R VQ  E
Sbjct:  397 IWRIEGADKVPVDPSTHGQFYGGDSYIILYNYRHGGRQGHIIYIWQGVDSTQDEIGASAILAAQLDDELGGGPVQVRVVQGKE 479          
BLAST of Gelsolin-like protein 2 vs. Ensembl Cavefish
Match: scin (scinderin [Source:NCBI gene;Acc:103042167])

HSP 1 Score: 100.908 bits (250), Expect = 4.047e-43
Identity = 69/224 (30.80%), Postives = 120/224 (53.57%), Query Frame = 1
Query:  412 SFQELFKELI-YLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDI--KPV----DDEKNFTALSSQEK--QIFRISDITG----SLKFEKLKFDKSNLDENDVFIIDSGMEVIVYI--GENSSPDERKKSLIYAHEYLKETGHP 1032
            +F   FK  I Y  GG  SGF+ +V       RL H+KGR R++  ++V     + N+ D FI+D G  I+QW G   N+ E+ KA Q    + +++RN +  V +++     D HE     S +  KP     DD  +  A  S  +  +++ +SD +G    SL  E+  F +++L  ++ FI+D G   ++Y+  G N++P+ERK+++  A  ++++ G+P
Sbjct:  104 AFTSYFKGGITYKTGGVSSGFQHVVTNDLSAQRLFHIKGR-RTVRATQVPLDWNSFNTGDCFIVDLGAIIYQWCGSKCNRFERLKATQVANSIRDNERNGRAQVVIVE-----DGHEPGQLTSVLGDKPTLPDEDDNDDIAADMSNRRMAKLYMVSDASGKMQVSLVSEENPFSQTHLLSDECFILDHGKSKMIYVWKGRNANPNERKEAMKTAEGFIQQMGYP 321          

HSP 2 Score: 93.9745 bits (232), Expect = 4.047e-43
Identity = 45/98 (45.92%), Postives = 62/98 (63.27%), Query Frame = 2
Query:  143 KSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            ++ L IWRIE  ++   P   +G FY GD+Y+IL   ++++V  YDLHFW+GK  TQDE   A   TV++D  L  +PVQ+RE+Q  ES  F SY K 
Sbjct:   14 RTGLQIWRIENMELAPVPESLHGNFYVGDAYLILRTVKQKDVSFYDLHFWLGKECTQDESTAAAIFTVQMDDYLGGKPVQYRELQGCESTAFTSYFKG 111          

HSP 3 Score: 57.3806 bits (137), Expect = 2.201e-15
Identity = 52/205 (25.37%), Postives = 103/205 (50.24%), Query Frame = 1
Query:  424 LFKE---LIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSIT-VSEVSATTKNLNSEDVFILDTG-MKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALS-SQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYL 1014
            LFK    ++Y  G    G +     T   RL  V+    +IT +SEV A   +LNS D ++L     + + W+GKGA+++E+   +   + L      +C ++ I E +  +  +F+  L         +   + + +   ++F  S+ TG    E++  +F++ +L E+DV ++D   +V V+IG++++  E+ +S+  A  Y+
Sbjct:  487 LFKAKPLVVYKNGTSREGGQAPAAPT---RLFQVRRNLGTITRISEVDAVASSLNSNDAYLLKVPEGEGYMWVGKGASEEEEHGVKYMSELL------QCKMKRITEGQ--EPGDFWKALGGKTEYQTSERLESKTITHAPRLFGCSNKTGRFIIEEVPGEFNQDDLAEDDVMLLDVWDQVFVWIGKDANEVEKMESVKSAKMYI 680          

HSP 4 Score: 43.8986 bits (102), Expect = 2.201e-15
Identity = 35/97 (36.08%), Postives = 45/97 (46.39%), Query Frame = 2
Query:  158 IWRIEKFKVME--WPNEQN--GVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYES----DLFKS 424
            IWR+E     E   P +    G FY GD YIIL   ++  ++    + W G  ST DE   + + TVELD  L    VQ R  Q  E      LFK+
Sbjct:  398 IWRVETCNKGESKIPVDPKTYGQFYGGDCYIILYTYKRGQII----YTWQGSCSTIDELTASAFLTVELDRSLGGNAVQVRVTQGKEPAHLLSLFKA 490          
BLAST of Gelsolin-like protein 2 vs. Ensembl Cavefish
Match: gsnb (gelsolin [Source:NCBI gene;Acc:103027267])

HSP 1 Score: 93.9745 bits (232), Expect = 7.941e-40
Identity = 48/103 (46.60%), Postives = 60/103 (58.25%), Query Frame = 2
Query:  131 KLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILN-IKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            K   +  L +WRIEK  ++  P    G FY GD+YI+LN IK+    L YDLHFW G+  T DE   A   TV++D  L   PVQ+REVQ YES  F  Y K+
Sbjct:    9 KAGQQPGLQVWRIEKMDLVSVPENLYGSFYTGDTYIVLNTIKQHLGNLQYDLHFWQGEICTTDESAAAAIFTVQMDDFLGGSPVQYREVQGYESKTFVGYFKS 111          

HSP 2 Score: 89.7373 bits (221), Expect = 7.941e-40
Identity = 59/220 (26.82%), Postives = 116/220 (52.73%), Query Frame = 1
Query:  409 RSFQELFKE-LIYLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNH-EFYNFLSDIKPVD-DEKNFTALSSQEKQIFRISDITGSLKFEKLK----FDKSNLDENDVFIIDSGM--EVIVYIGENSSPDERKKSLIYAHEYLKETGHPQ 1035
            ++F   FK  + Y++GG  SGFR +   +    R+LHV GR R +  +EV  +  + N  D FILD G +++QW G  +N  E+ KA    + + +++R  +  + V +E    D   E      ++   D D+    A + +  +++++SD +G +    +     F ++ L+ +D FI+D G   ++  + G+ ++P+ER   +  A E++++ G+P+
Sbjct:  103 KTFVGYFKSGMKYMQGGVASGFRHVTGDEEGRQRVLHVTGR-RIVRATEVPLSWDSFNKGDCFILDLGEELYQWCGSKSNHFERLKATNISKTIRDNERRGRAKLHVCEEGAEPDKMLEILGPKPELPDTDCDDTEIDASNRKMAKLYKVSDASGDMSVTLIAGENPFFQNALESSDCFILDHGSNGKIFFWKGKGANPEERSAGMKAAEEFIQKMGYPK 321          

HSP 3 Score: 61.6178 bits (148), Expect = 8.579e-10
Identity = 50/184 (27.17%), Postives = 88/184 (47.83%), Query Frame = 1
Query:  502 RLLHVK----GRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDE-EETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHP 1032
            RL  V+    G  R++   EV A   NLNS D FIL        W+GKG +  EK  A+Q  + L  + ++    E  D   E L     Y     +K        + + S   ++F  S+ TG  + E++  +  + +L  +DV ++D+  +V V+IG+ ++ +E+ +++  A  Y++   HP
Sbjct:  512 RLFQVRSSTAGHTRAV---EVDAVASNLNSNDAFILVNPSGSVLWVGKGTSDAEKHGAKQLSEILQVEVSEVVEGEEGDTFWEALGGKTEYRTSERLK--------SKMDSHPPRLFACSNKTGQFRIEEVPGEMTQEDLAPDDVMLLDTWDQVFVWIGKEANEEEKTEAVTSAARYIET--HP 682          
BLAST of Gelsolin-like protein 2 vs. Ensembl Cavefish
Match: scinlb (scinderin like b [Source:ZFIN;Acc:ZDB-GENE-040426-2068])

HSP 1 Score: 102.064 bits (253), Expect = 2.458e-37
Identity = 71/213 (33.33%), Postives = 114/213 (53.52%), Query Frame = 1
Query:  412 SFQELFKELI-YLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDE-EETLDNHEFYNFLSDIKPVD-DEKNFTALSSQEKQIFRISDITGSLK----FEKLKFDKSNLDENDVFIIDSGME--VIVYIGENSSPDERKKSLIYAHEYLK 1017
            SF   FK  I Y KGG  SGF+ V     N  RLLHVKGR R+I  +EV  +  + N  D FI+D G  ++QW G G N+ EK KA +    + +++RN +  + ++DE  E     +       I P   D++     +  +  ++ ISD TGS+K     +   F ++ L + + +I+D+G +  V V+ G  ++PDERK ++  A +++K
Sbjct:  100 SFLGYFKSGIKYKKGGVASGFQHVVTNDANVKRLLHVKGR-RAIRATEVDFSWGSFNQGDCFIVDLGKDVYQWSGSGCNRFEKLKASEVAIDIRDNERNGRAKLHMVDEGAEPQAIIDALGAKPAIAPATADDEQVDKSNKTKGALYMISDATGSMKTSVVAQSSPFKQAMLSDEECYILDNGADNNVFVWKGPKANPDERKAAMKVAQDFIK 311          

HSP 2 Score: 73.559 bits (179), Expect = 2.458e-37
Identity = 37/95 (38.95%), Postives = 52/95 (54.74%), Query Frame = 2
Query:  152 LLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            L +WRIE   +   P    G FY GD+Y++L+     +   Y +H W+G   +QDE G A   + +LD  L   PVQ+REVQ+ ES  F  Y K+
Sbjct:   16 LQVWRIENMDLKPVPKNLYGNFYTGDAYLLLHTTTAPS---YSIHMWLGDECSQDESGAAAIFSTQLDDFLGGSPVQYREVQNNESVSFLGYFKS 107          

HSP 3 Score: 62.3882 bits (150), Expect = 1.049e-13
Identity = 55/226 (24.34%), Postives = 102/226 (45.13%), Query Frame = 1
Query:  412 SFQELFKE---LIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLK--FDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKE--TGHPQAPVTVLNKKVD 1068
            +   LFK    +I+  G   +G +    Q    RL H+  R  S     V+ +  +LN+ DVF+L T   +F W G GA+ DE   A+  V  L          +  D  E  +   F++ L         K    +  +  ++F  S+ TG L  E++   F +S+L  +DV ++D+  ++ +++G +++  E+  +   A EY+    +G    P+T + +  +
Sbjct:  465 TLMSLFKGKPMVIHSGGTSRAGGQ---SQAGGTRLFHI--RTSSPPGPPVNPSASSLNTNDVFVLKTPDSLFVWRGVGASADESDAAKHVVSFLGG--------KPTDVAEGKEPAGFWSALGGKAEYQSSKTLQKV-VKTPRLFGCSNKTGRLVVEEVPGDFTQSDLATDDVMLLDTWDQIFLWVGNDANEVEKTGAPKIAKEYVDSDPSGRRGIPITTIKQGAE 676          

HSP 4 Score: 33.113 bits (74), Expect = 1.049e-13
Identity = 20/55 (36.36%), Postives = 29/55 (52.73%), Query Frame = 2
Query:  233 YIIL---NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHR 388
            Y+IL    +  +E  ++Y    W G  STQDE   + + TV+LD  +   PVQ R
Sbjct:  403 YLILYSYKLGGREQHIIYT---WQGLKSTQDELAASAFLTVQLDDSMGGAPVQVR 454          
BLAST of Gelsolin-like protein 2 vs. Ensembl Sea Lamprey
Match: avil (advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683])

HSP 1 Score: 97.8265 bits (242), Expect = 1.618e-42
Identity = 69/244 (28.28%), Postives = 123/244 (50.41%), Query Frame = 1
Query:  415 FQELFKE-LIYLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLS--------DIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIID-SGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            F+  FK  ++Y KGG  SGF      +YN  RLLH+KGRK ++T +EV+ +  + +  DVF+LD G  I QW G  +N+ EK K  Q    + + +R  +  + V++  +   + E    L+        D+ P   ++          +++ +S+  G+L  E++      +  L+ +D +I+D  G+++ V+ G  SS +ER+ ++  A  Y+K  G+P +  T +    DG     F  +F
Sbjct:  104 FRGYFKSGVVYKKGGVASGFHHTETNSYNVQRLLHIKGRK-AVTATEVNLSWDSFSRGDVFLLDLGKVIIQWNGPDSNRVEKIKGMQLASDIRDRERGGRAQIGVVEGNDEDSSPELMAVLTAALGERHGDLSPGSPDEPTDHSRKANVKLYHVSEKGGNLMVEEVATRPLTQDLLNHDDCYILDQGGIKIYVWKGRGSSKEERQAAMKRALGYIKAKGYPVS--TNVETVADGAESAIFKQLF 344          

HSP 2 Score: 92.4337 bits (228), Expect = 1.618e-42
Identity = 44/103 (42.72%), Postives = 64/103 (62.14%), Query Frame = 2
Query:  134 LCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKEN--VLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            L   + L IWR+EK ++   P +  G F+EGD YIIL+ K+  +     YD+H+W+G+ S+QDE   A   T +LD  L   PVQHRE Q +ES++F+ Y K+
Sbjct:    8 LPKSAGLHIWRVEKMELAAVPQKAYGSFFEGDCYIILSAKKAGSSPTPTYDVHYWVGQESSQDEQAAAAMYTTQLDDALGGFPVQHREYQGHESEVFRGYFKS 110          

HSP 3 Score: 85.5001 bits (210), Expect = 8.503e-29
Identity = 58/182 (31.87%), Postives = 91/182 (50.00%), Query Frame = 1
Query:  502 RLLHVKGRKR-SITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQ-EKQIFRISDITGSLKFEKLK-FDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQA 1038
            RL  V+G    +    EV A    LNS DVF+L+  +  F W GKG + DE+  AR     L   R DK  V      E  +  EF+  L    P   EK      ++ + ++F  S  TG     ++  F + +LDE+DV ++D+  +V +++G+ +S  E+K+S+  A +YL+   HP A
Sbjct:  522 RLFQVRGTDEFNTKAVEVPARASALNSNDVFVLNAEVACFLWCGKGCSGDEREMARSLADGLT--RRDKQTVL-----EGQEPPEFWAALGGKAPYASEKRMQVEEAEVQPRLFECSTQTGRFVVTEISDFSQDDLDEDDVMLLDTWDQVFLWVGQGASDAEKKESMTTAADYLRT--HPGA 694          

HSP 4 Score: 58.9214 bits (141), Expect = 8.503e-29
Identity = 35/102 (34.31%), Postives = 47/102 (46.08%), Query Frame = 2
Query:  113 AAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLF 418
            AA  R       T  ++RIE  ++       +G FY GD Y++L      N L Y L+ W G+ +TQDE   + Y+ V LD      PVQ R V   E   F
Sbjct:  385 AAQHRMVDDGSGTAEMFRIEDLELKPVEKRLHGQFYGGDCYLVLYTYTSNNKLAYLLYMWQGRHATQDEVAASAYQAVALDQKYGGEPVQVRVVMGKEPKHF 486          
BLAST of Gelsolin-like protein 2 vs. Ensembl Sea Lamprey
Match: gsna (gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653])

HSP 1 Score: 98.2117 bits (243), Expect = 3.060e-36
Identity = 44/99 (44.44%), Postives = 63/99 (63.64%), Query Frame = 2
Query:  143 KSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            +  L +WR+EK  ++  P E  G FY GD+Y++L +++ +   + YDLHFW+G   +QDE G A   TV++D  L  +PVQHREVQ +ES  F  Y KN
Sbjct:   13 QPGLQVWRVEKLDLVAVPKELYGSFYTGDAYVLLFSVRNRAGNMQYDLHFWLGNECSQDESGAAAIFTVQMDDHLGGQPVQHREVQGFESTAFSGYFKN 111          

HSP 2 Score: 71.2478 bits (173), Expect = 3.060e-36
Identity = 43/113 (38.05%), Postives = 67/113 (59.29%), Query Frame = 1
Query:  412 SFQELFKELI-YLKGGCESGFR-----IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDE 729
            +F   FK  I Y  GG  SGFR     +V+V+    RLLHVKGR R++  +EV  +  + N  D FI+D G  I+QW G  +N+ E+ KA Q  + + +++R+ +  V+V++E
Sbjct:  104 AFSGYFKNGIKYKPGGVASGFRHVVPNLVDVK----RLLHVKGR-RTVRATEVPLSWASFNQGDCFIVDLGANIYQWCGSKSNRFERLKATQVAKGIRDNERSGRARVDVLEE 211          
BLAST of Gelsolin-like protein 2 vs. Ensembl Nematostella
Match: EDO40348 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7K4])

HSP 1 Score: 172.94 bits (437), Expect = 5.150e-82
Identity = 86/139 (61.87%), Postives = 104/139 (74.82%), Query Frame = 2
Query:   11 NMQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSY 427
             ++K ++Y WKDSN+AL GS  ++ VKK SA+TE AW  A    K  + IWRI KFKV +WP E  G FY GDSYIIL  K++   L++D+HFWIGK ST DEYGTA YKTVELDT LDD+PVQHREV+ +ESDLFKSY
Sbjct:    3 GLRKQKEYDWKDSNLALFGSDTEKNVKKESAQTETAWIGAG--EKPGMKIWRIVKFKVTKWPEENYGSFYNGDSYIILRTKKENEELVHDVHFWIGKKSTADEYGTAAYKTVELDTFLDDKPVQHREVEGHESDLFKSY 139          

HSP 2 Score: 150.214 bits (378), Expect = 5.150e-82
Identity = 91/231 (39.39%), Postives = 134/231 (58.01%), Query Frame = 1
Query:  415 FQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNF---TALSSQEKQIFRISDITGSLKFEKL----KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLN---KKVDGKN 1077
            F+  F E+  L GG ESGF+ V  + Y PRL  V+G K+++T++ +     NL ++D FI+D G+++FQW G  ANK+EK+KA +  +   S R  K    V+D + T++  E    L  I P D E +F         EK +F +SD TG L+  ++    +  +S L E+DV+I DSG    VY+G+ +S DER+ ++ YAH YL  T HP  PVTV+N   K VD +N
Sbjct:  136 FKSYFSEMTLLDGGAESGFKHVGPKEYTPRLFLVRGNKKNVTLTNIELVKGNLTNDDCFIIDLGLELFQWNGIDANKEEKWKAGEICRDWRSKRGGKPRHIVLD-DCTVEKIEELEELEGILP-DGENSFKKQAGSEPSEKVLFSLSDRTGQLQCNEIARGKEVKRSLLKEDDVYIFDSGRHCYVYVGKAASIDERRNAMTYAHNYLMRTEHPLLPVTVINGGQKSVDFEN 364          
BLAST of Gelsolin-like protein 2 vs. Ensembl Nematostella
Match: EDO43190 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ87])

HSP 1 Score: 161.384 bits (407), Expect = 1.287e-74
Identity = 82/145 (56.55%), Postives = 102/145 (70.34%), Query Frame = 2
Query:   11 NMQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKE------NVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSY 427
             + K +KY WKDSN+AL GS  ++ VKK SAE E AW+ A    +  + +WRI KFKV  WP +  G FY GDSYI+LN  +K+        L YD+HFWIG+FS+QDEYGTA YKTVELD  LDD+PV+HREV+ +ES LFKSY
Sbjct:    3 GLVKAKKYDWKDSNLALFGSDLEKNVKKESAEGEPAWEGAG--KEVGVQVWRIVKFKVTHWPKQDYGHFYNGDSYIVLNTYKKDPSSEACGELSYDVHFWIGRFSSQDEYGTAAYKTVELDHFLDDKPVEHREVEGHESTLFKSY 145          

HSP 2 Score: 137.117 bits (344), Expect = 1.287e-74
Identity = 86/237 (36.29%), Postives = 132/237 (55.70%), Query Frame = 1
Query:  415 FQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFV----QQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLK----FDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            F+  F  LI LKGG E+GFR VN + Y PRLLH   + + I V+E S    N+N+ DVFI+D G+ ++QW G   + DEKF A  F+    +++++++  K +   I  +  L+  EF + LS  +PV +        S       +SD +G L F ++       +S L+ NDVFI+DSG    V+ G+ SS DER++++ +AH YL ++  P  P+T +   V+G   D FN  F
Sbjct:  142 FKSYFDALITLKGGAETGFRRVNPEAYKPRLLHFCKKNKKIEVTEKSLKRANMNNGDVFIVDLGLTLYQWNGSRCSPDEKFSAAHFMDIIQKEISTNKGRKSVKSGI-LKLLLERVEFNSTLSS-EPVAE--CLVLCQSNIICFMVLSDASGHLVFSEVSRGSAVKRSQLNTNDVFIMDSGDHCYVWSGKGSSVDERRRAMEFAHNYLMKSDSPFLPITCV---VEGNETDDFNKAF 371          
BLAST of Gelsolin-like protein 2 vs. Ensembl Nematostella
Match: EDO43191 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ88])

HSP 1 Score: 161.384 bits (407), Expect = 2.163e-69
Identity = 82/141 (58.16%), Postives = 101/141 (71.63%), Query Frame = 2
Query:   11 NMQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENV--LLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSY 427
             + K +KY WKDSN+AL GS  ++ VKK SAE E AW+ A    +  + +WRI KFKV  WP E  G F+ GDSYI+LN  ++ +   LLYD+HFWIGKFS+QDEYGTA YKTVELD  L+D PVQHREV+ +ES LFK Y
Sbjct:    3 GLVKAKKYDWKDSNLALFGSDLEKNVKKESAEGEPAWEGAG--KEVGVQVWRIVKFKVEHWPKEDYGKFFNGDSYIVLNTYKEPSTENLLYDVHFWIGKFSSQDEYGTAAYKTVELDHFLNDVPVQHREVEGHESKLFKGY 141          

HSP 2 Score: 119.783 bits (299), Expect = 2.163e-69
Identity = 78/235 (33.19%), Postives = 114/235 (48.51%), Query Frame = 1
Query:  415 FQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDD--EKNFTALSSQEKQIFRISDITGSLKFEKL----KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            F+  F  L  +KGG +SGF+ V  + Y PRL HV    + + V +      N+ + DVFI+D G+ I+QW     N    +   Q V+  N       L + I E                KP  D  +   + L   E +   +SD +GSL  E++       +S LD NDVF+ D+G    V++G  +S DER K++ YAH YL +T HP  PVTV+    +GK  + FN+ F
Sbjct:  138 FKGYFSTLTIMKGGADSGFKHVLPEAYTPRLFHVFKEGKCVIVRQKQMKRTNMCNSDVFIVDLGLVIYQWYSVLLNA-VFYTENQTVENFNPK-----LAKTIPEG---------------KPKKDKVQALLSLLIKAEMEQMEVSDASGSLNCEEVSRGSAISRSQLDSNDVFLFDTGCHCYVWVGAGASIDERGKAMTYAHNYLGQTDHPFLPVTVV---AEGKETNDFNSAF 348          
BLAST of Gelsolin-like protein 2 vs. Ensembl Nematostella
Match: EDO49236 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGV1])

HSP 1 Score: 166.777 bits (421), Expect = 6.793e-50
Identity = 89/144 (61.81%), Postives = 106/144 (73.61%), Query Frame = 2
Query:   11 NMQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIIL-NIKEKENV-LLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
             + K +K   KDSN+AL G+  +R VKKS+AE E AWK A    K  L IWRI KFKV EWP E+ G FY GDSYIIL   +EKE+  L YDLHFWIG+ STQDEYGTA YKTVELDT L+D PVQHRE+ ++ESD+FK+Y K+
Sbjct:    5 GLTKQKKTELKDSNLALFGTDIERNVKKSAAEGEVAWKNA--GEKVGLQIWRINKFKVEEWPKEKYGQFYAGDSYIILWTYEEKEDTELCYDLHFWIGRGSTQDEYGTAAYKTVELDTYLNDVPVQHREIMNHESDMFKTYFKS 146          
BLAST of Gelsolin-like protein 2 vs. Ensembl Nematostella
Match: EDO38658 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCC4])

HSP 1 Score: 114.39 bits (285), Expect = 3.044e-49
Identity = 76/244 (31.15%), Postives = 133/244 (54.51%), Query Frame = 1
Query:  409 RSFQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSE-VSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDE--EETLDNHEFYNFLSDIKPV----DDEKNFTALSSQEKQIFRISDITGSLKFEKLK---FDKSNLDENDVFIIDSGME-VIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIFT 1104
            R F   FK++ YL+GG ESGFR V    Y  RL H+KG KR++ V + V    K+LN  DVFILD G+ I+ W G   ++ E+ K     +++ + +R  +  V +IDE  ++ L++ +F++ L     +     D+  F   S     ++++SD +G L+  +++     KSNLD ND FI+D G   V V++G+  + +E+  ++    +++++ G+P    T + + V+G     F   F+
Sbjct:  102 RKFLSHFKDIKYLEGGMESGFRKVQRDVYQKRLFHIKG-KRNVRVQQVVELHYKSLNKGDVFILDDGLNIYCWNGSQCSRVERMKGIDVAKRIRDEERGGRAQVHIIDECKDKGLES-KFFDALGSRGEIAEDSGDDAEFEKTSQSAVTLYQVSDASGELEMREIEAKPLKKSNLDTNDCFILDCGSSGVFVWVGKGCTKNEKSAAMKNGIDFIEKKGYPNW--TQVTRVVEGGETPIFKQFFS 341          

HSP 2 Score: 99.3673 bits (246), Expect = 3.044e-49
Identity = 51/99 (51.52%), Postives = 65/99 (65.66%), Query Frame = 2
Query:  140 NKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
             K  L IWRIEK KV+    +  G FY GDSYI L+ +  E+ L +D+HFW+GK ++QDE G   YKTVELD  L   PVQ+REVQ +ES  F S+ K+
Sbjct:   12 QKPGLEIWRIEKLKVVAQDPKTYGTFYSGDSYICLSTRLVESHLEWDIHFWLGKNTSQDEAGVCAYKTVELDDHLGGGPVQYREVQDHESRKFLSHFKD 110          

HSP 3 Score: 50.0618 bits (118), Expect = 1.304e-6
Identity = 28/90 (31.11%), Postives = 48/90 (53.33%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIIL---NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLF 418
            IWR+E   ++  P E +G+F+ GD Y+I+    +  +E+V++Y   FW G  S+ DE   +     ++D  +     Q R VQ+ E + F
Sbjct:  396 IWRVEDHDLVLVPLELHGLFFSGDCYVIMYTYKVNMRESVIIY---FWQGVQSSTDEKAASAMLADQIDKKMGGIATQVRVVQYKEPEHF 482          
BLAST of Gelsolin-like protein 2 vs. Ensembl Medaka
Match: gsna (gelsolin [Source:NCBI gene;Acc:101167720])

HSP 1 Score: 102.834 bits (255), Expect = 1.198e-45
Identity = 68/223 (30.49%), Postives = 124/223 (55.61%), Query Frame = 1
Query:  409 RSFQELFKELI-YLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKP-----VDDEKNFTALSSQEKQIFRISDITGSLKFEKLK----FDKSNLDENDVFIIDSGME--VIVYIGENSSPDERKKSLIYAHEYLKETGHPQ 1035
            ++F   FK  I Y++GG  SGF+ +V  +    RLL +KGR R +  +EV+    + N +D FILD G +I+QW G  +N+ EK KA Q  + + +++R+ +  V V D  E ++  +    L   KP       D+ +    + +  +++++S+ +G +    +     F +S L+  D FI+D G +  + V+ G++++ DERK +L  A E++K+ G+P+
Sbjct:  200 KTFLGYFKSGIKYMQGGVASGFKHVVTNEVSVQRLLQIKGR-RVVRATEVAVGWDSFNQDDCFILDLGDEIYQWCGSQSNRFEKLKATQVAKDIRDNERSGRARVYVCD--EGMEREQMLKVLGP-KPDLPAGASDDIHADVSNRKSAKLYKVSNASGGMTIALVAAENPFAQSALESGDCFILDYGSDGKIFVWKGKDANMDERKAALKAADEFIKKMGYPK 418          

HSP 2 Score: 100.138 bits (248), Expect = 1.198e-45
Identity = 45/96 (46.88%), Postives = 64/96 (66.67%), Query Frame = 2
Query:  152 LLIWRIEKFKVMEWPNEQNGVFYEGDSYIILN-IKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            L +WR+EKF ++  P    G FY GD+Y++LN IK++   L YDLHFW+G   +QDE G+A   TV++D  L  +P+Q+REVQ +ES  F  Y K+
Sbjct:  113 LQVWRVEKFNLVPVPENLYGGFYTGDAYLVLNTIKQRSGQLQYDLHFWLGDSCSQDESGSAAIFTVQMDDFLGGKPIQYREVQGHESKTFLGYFKS 208          

HSP 3 Score: 63.929 bits (154), Expect = 4.163e-18
Identity = 61/235 (25.96%), Postives = 103/235 (43.83%), Query Frame = 1
Query:  430 KELIYLKGGC-ESGFRIVNVQTYNPRLLHVK----GRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALS----SQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            K ++  KGG    G +    +T   RL  V+    G  R++   E+ A   NLNS D F+L T      W+G GA++ EK    Q  QQL       C +  +   E  +  E   F   +    D +  T L     +   ++F  S+ TG+   E++  +  + +L  +DV I+D+  +V V+IG  +  +E+ +++  A  Y++     + P T + K   G     F   F
Sbjct:  599 KPMVVYKGGTSREGGQSAPAET---RLFQVRSNSTGHTRAV---ELDAAASNLNSNDAFLLVTPNGTSLWMGAGASEAEK----QGAQQL-------CDILGVSASELSEGGETAQFWGALGGKADYRTSTRLKDKMDAHPPRLFACSNKTGNFVIEEVPGELTQDDLATDDVMILDTWDQVFVWIGNEAQEEEKTEAMASAVRYVETDPANRDPRTPIVKIKQGFEPPTFTGWF 816          

HSP 4 Score: 46.9802 bits (110), Expect = 4.163e-18
Identity = 28/79 (35.44%), Postives = 35/79 (44.30%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREV 394
            IWR+E            G FY GDSYIIL          + ++ W G  S+QDE G       +LD  L   PVQ  +V
Sbjct:  494 IWRVEGSDKAPVDPSTYGQFYGGDSYIILYNYRHGGRQGHIIYLWQGMDSSQDEKGACAILGAQLDEELGGGPVQFSQV 572          
BLAST of Gelsolin-like protein 2 vs. Ensembl Medaka
Match: gsna (gelsolin [Source:NCBI gene;Acc:101167720])

HSP 1 Score: 103.219 bits (256), Expect = 1.280e-45
Identity = 68/223 (30.49%), Postives = 124/223 (55.61%), Query Frame = 1
Query:  409 RSFQELFKELI-YLKGGCESGFR-IVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKP-----VDDEKNFTALSSQEKQIFRISDITGSLKFEKLK----FDKSNLDENDVFIIDSGME--VIVYIGENSSPDERKKSLIYAHEYLKETGHPQ 1035
            ++F   FK  I Y++GG  SGF+ +V  +    RLL +KGR R +  +EV+    + N +D FILD G +I+QW G  +N+ EK KA Q  + + +++R+ +  V V D  E ++  +    L   KP       D+ +    + +  +++++S+ +G +    +     F +S L+  D FI+D G +  + V+ G++++ DERK +L  A E++K+ G+P+
Sbjct:  200 KTFLGYFKSGIKYMQGGVASGFKHVVTNEVSVQRLLQIKGR-RVVRATEVAVGWDSFNQDDCFILDLGDEIYQWCGSQSNRFEKLKATQVAKDIRDNERSGRARVYVCD--EGMEREQMLKVLGP-KPDLPAGASDDIHADVSNRKSAKLYKVSNASGGMTIALVAAENPFAQSALESGDCFILDYGSDGKIFVWKGKDANMDERKAALKAADEFIKKMGYPK 418          

HSP 2 Score: 100.138 bits (248), Expect = 1.280e-45
Identity = 45/96 (46.88%), Postives = 64/96 (66.67%), Query Frame = 2
Query:  152 LLIWRIEKFKVMEWPNEQNGVFYEGDSYIILN-IKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            L +WR+EKF ++  P    G FY GD+Y++LN IK++   L YDLHFW+G   +QDE G+A   TV++D  L  +P+Q+REVQ +ES  F  Y K+
Sbjct:  113 LQVWRVEKFNLVPVPENLYGGFYTGDAYLVLNTIKQRSGQLQYDLHFWLGDSCSQDESGSAAIFTVQMDDFLGGKPIQYREVQGHESKTFLGYFKS 208          

HSP 3 Score: 63.929 bits (154), Expect = 7.326e-19
Identity = 61/235 (25.96%), Postives = 103/235 (43.83%), Query Frame = 1
Query:  430 KELIYLKGGC-ESGFRIVNVQTYNPRLLHVK----GRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALS----SQEKQIFRISDITGSLKFEKL--KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            K ++  KGG    G +    +T   RL  V+    G  R++   E+ A   NLNS D F+L T      W+G GA++ EK    Q  QQL       C +  +   E  +  E   F   +    D +  T L     +   ++F  S+ TG+   E++  +  + +L  +DV I+D+  +V V+IG  +  +E+ +++  A  Y++     + P T + K   G     F   F
Sbjct:  587 KPMVVYKGGTSREGGQSAPAET---RLFQVRSNSTGHTRAV---ELDAAASNLNSNDAFLLVTPNGTSLWMGAGASEAEK----QGAQQL-------CDILGVSASELSEGGETAQFWGALGGKADYRTSTRLKDKMDAHPPRLFACSNKTGNFVIEEVPGELTQDDLATDDVMILDTWDQVFVWIGNEAQEEEKTEAMASAVRYVETDPANRDPRTPIVKIKQGFEPPTFTGWF 804          

HSP 4 Score: 49.2914 bits (116), Expect = 7.326e-19
Identity = 30/83 (36.14%), Postives = 37/83 (44.58%), Query Frame = 2
Query:  158 IWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
            IWR+E            G FY GDSYIIL          + ++ W G  S+QDE G       +LD  L   PVQ R +Q  E
Sbjct:  494 IWRVEGSDKAPVDPSTYGQFYGGDSYIILYNYRHGGRQGHIIYLWQGMDSSQDEKGACAILGAQLDEELGGGPVQVRVIQGKE 576          
BLAST of Gelsolin-like protein 2 vs. Ensembl Medaka
Match: vill (villin like [Source:NCBI gene;Acc:101155645])

HSP 1 Score: 95.1301 bits (235), Expect = 2.235e-41
Identity = 71/247 (28.74%), Postives = 127/247 (51.42%), Query Frame = 1
Query:  415 FQELFKE-LIYLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDI---KP------VDDEKNFTALSSQEKQIFRISDITGSLKFEKLKFDKSNLD---ENDVFIID-SGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIFTT 1107
            F+  FK  +IY  GG  SGF  V+  +YN  RL+HVKG+K  +T  EV  +  + N+ D+F+LDTG  I QW G  +N+ EK KA    Q + + +R  +  + V++     ++ E    ++ +   KP      + DEK+   + +   +++ + +  G+L  +++       D    +D FI+D  G  V+V+ G+ +S  ER++++  A  Y+K   +P  P T +    +G     F ++F +
Sbjct:  126 FRSYFKSGIIYKTGGVSSGFTHVDTNSYNILRLMHVKGKKH-VTAKEVEVSWNSFNNGDIFLLDTGKLIVQWNGPQSNRTEKLKAVLLAQDIRDRERGGRAQIGVVEGSNERESPELMKIMTTVLGEKPNKLRDAIPDEKH-DQMQTNSVRLYHVFENGGNLVVQEVATQPLTQDLLLSSDCFIVDHKGSSVMVWKGKRASKVERQEAMNRALGYIKAKNYP--PSTGVEVMSEGGESAMFKHLFKS 368          

HSP 2 Score: 93.9745 bits (232), Expect = 2.235e-41
Identity = 46/102 (45.10%), Postives = 62/102 (60.78%), Query Frame = 2
Query:  134 LCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLL-YDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            +  K+ L IW I   K++  P +  G F+EGD YI+LNI+E +      D+H+WIG  S+QDE G A     +LD  L   PVQ+REVQ YES  F+SY K+
Sbjct:   31 ISRKAGLQIWTINNMKMVSVPTKAFGNFFEGDCYIVLNIRENKGAAQSIDVHYWIGNSSSQDEQGAAAIYVTQLDEYLGGSPVQYREVQGYESPQFRSYFKS 132          

HSP 3 Score: 73.559 bits (179), Expect = 1.261e-13
Identity = 64/217 (29.49%), Postives = 102/217 (47.00%), Query Frame = 1
Query:  409 RSFQELFK-ELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSIT-VSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQE----KQIFRISDITGSLKF-EKLKFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQA 1038
            R F  +FK + I  +GG  +G         + RL  V+G     T  +EV A   +LNS DVF+L T    + W GKG + DE+  A+     L   R DK +V        ++  E  NF   +       +   L  +E     ++F  S+ TG  +  E   F +S+LDE+DV ++D+  E+ ++IG++++  E   +   A EYL+   HP  
Sbjct:  506 RHFLAIFKGKFIIFEGG--TGRAGAANPESSTRLFQVRGTNEMNTKATEVPARASSLNSNDVFLLKTDRVCYLWYGKGCSGDERVMAKTTSDVLF--RQDKQVV--------MEGQEPANFWVALGGKSSYASDKRLQKEELIHSPRLFECSNQTGRFRMTEVYDFAQSDLDEDDVMLLDTWEELFLWIGKHANKSETTDAWKSAQEYLRS--HPAG 708          

HSP 4 Score: 63.929 bits (154), Expect = 1.823e-10
Identity = 36/111 (32.43%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  113 AAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN*YI 445
            AA +R        + +WRIE  +++E   + +G FY GD Y++L    + N   Y L+ W G+ +TQDE     Y+ V +D+  +  PVQ R V   E   F +  K  +I
Sbjct:  407 AAQQRMVDDASGDVTVWRIENLELVEVDPKTHGQFYGGDCYLVLYTYLRSNQKQYILYMWQGRHATQDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFI 517          
BLAST of Gelsolin-like protein 2 vs. Ensembl Medaka
Match: vill (villin like [Source:NCBI gene;Acc:101155645])

HSP 1 Score: 95.1301 bits (235), Expect = 2.428e-41
Identity = 71/247 (28.74%), Postives = 127/247 (51.42%), Query Frame = 1
Query:  415 FQELFKE-LIYLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQL-NSDRNDKCLVEVIDEEETLDNHEFYNFLSDI---KP------VDDEKNFTALSSQEKQIFRISDITGSLKFEKLKFDKSNLD---ENDVFIID-SGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIFTT 1107
            F+  FK  +IY  GG  SGF  V+  +YN  RL+HVKG+K  +T  EV  +  + N+ D+F+LDTG  I QW G  +N+ EK KA    Q + + +R  +  + V++     ++ E    ++ +   KP      + DEK+   + +   +++ + +  G+L  +++       D    +D FI+D  G  V+V+ G+ +S  ER++++  A  Y+K   +P  P T +    +G     F ++F +
Sbjct:  108 FRSYFKSGIIYKTGGVSSGFTHVDTNSYNILRLMHVKGKKH-VTAKEVEVSWNSFNNGDIFLLDTGKLIVQWNGPQSNRTEKLKAVLLAQDIRDRERGGRAQIGVVEGSNERESPELMKIMTTVLGEKPNKLRDAIPDEKH-DQMQTNSVRLYHVFENGGNLVVQEVATQPLTQDLLLSSDCFIVDHKGSSVMVWKGKRASKVERQEAMNRALGYIKAKNYP--PSTGVEVMSEGGESAMFKHLFKS 350          

HSP 2 Score: 93.9745 bits (232), Expect = 2.428e-41
Identity = 46/102 (45.10%), Postives = 62/102 (60.78%), Query Frame = 2
Query:  134 LCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLL-YDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            +  K+ L IW I   K++  P +  G F+EGD YI+LNI+E +      D+H+WIG  S+QDE G A     +LD  L   PVQ+REVQ YES  F+SY K+
Sbjct:   13 ISRKAGLQIWTINNMKMVSVPTKAFGNFFEGDCYIVLNIRENKGAAQSIDVHYWIGNSSSQDEQGAAAIYVTQLDEYLGGSPVQYREVQGYESPQFRSYFKS 114          

HSP 3 Score: 73.559 bits (179), Expect = 1.403e-13
Identity = 64/217 (29.49%), Postives = 102/217 (47.00%), Query Frame = 1
Query:  409 RSFQELFK-ELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSIT-VSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQE----KQIFRISDITGSLKF-EKLKFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQA 1038
            R F  +FK + I  +GG  +G         + RL  V+G     T  +EV A   +LNS DVF+L T    + W GKG + DE+  A+     L   R DK +V        ++  E  NF   +       +   L  +E     ++F  S+ TG  +  E   F +S+LDE+DV ++D+  E+ ++IG++++  E   +   A EYL+   HP  
Sbjct:  488 RHFLAIFKGKFIIFEGG--TGRAGAANPESSTRLFQVRGTNEMNTKATEVPARASSLNSNDVFLLKTDRVCYLWYGKGCSGDERVMAKTTSDVLF--RQDKQVV--------MEGQEPANFWVALGGKSSYASDKRLQKEELIHSPRLFECSNQTGRFRMTEVYDFAQSDLDEDDVMLLDTWEELFLWIGKHANKSETTDAWKSAQEYLRS--HPAG 690          

HSP 4 Score: 63.929 bits (154), Expect = 1.810e-10
Identity = 36/111 (32.43%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  113 AAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN*YI 445
            AA +R        + +WRIE  +++E   + +G FY GD Y++L    + N   Y L+ W G+ +TQDE     Y+ V +D+  +  PVQ R V   E   F +  K  +I
Sbjct:  389 AAQQRMVDDASGDVTVWRIENLELVEVDPKTHGQFYGGDCYLVLYTYLRSNQKQYILYMWQGRHATQDEIAACAYQAVTVDSKYNGAPVQVRVVMGKEPRHFLAIFKGKFI 499          
BLAST of Gelsolin-like protein 2 vs. Ensembl Medaka
Match: scinlb (gelsolin [Source:NCBI gene;Acc:101159773])

HSP 1 Score: 95.5153 bits (236), Expect = 6.383e-36
Identity = 65/219 (29.68%), Postives = 117/219 (53.42%), Query Frame = 1
Query:  412 SFQELFKELI-YLKGGCESGFRIVNVQTYN-PRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQF-VQQLNSDRNDKCLVEVIDE-EETLDNHEFYNFLSDIKP-VDDEKNFTALSSQEKQIFRISDITGSLKF----EKLKFDKSNLDENDVFIIDSGME--VIVYIGENSSPDERKKSLIYAHEYLKETGHPQ 1035
            +F   FK  I Y KGG  SGF+ V     N  RLL VKGR R+I  +EV  +  + N  D FI+D G  ++ W G  +N+ E+ KA Q  +   +++RN +  + +++E  E  +  E     + I P   D+    A++     ++ ISD +G++K     +   F ++ L   + +I+D+G +  + V+ G  ++  ERK++++ A +++K+ G+ Q
Sbjct:  100 AFLGYFKSGIKYQKGGVASGFQHVVTNDMNVKRLLQVKGR-RAIRATEVEMSWSSFNKGDCFIVDLGKDVYVWCGSESNRFERLKASQVGIDIRDNERNGRAKLHMVEEGAEPSELTEVLGPTTTIAPSTPDDDKVEAVNRNNSALYMISDASGAMKVTVVAQSSPFKQAMLSPEECYILDNGPDKNIFVWKGPKANEKERKQAMLAAQQFMKDKGYSQ 317          

HSP 2 Score: 75.0998 bits (183), Expect = 6.383e-36
Identity = 36/95 (37.89%), Postives = 53/95 (55.79%), Query Frame = 2
Query:  152 LLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            L +WRIE   +   P +  G FY GD+Y++L      +   Y++H W+G   +QDE G A     ++D  L   PVQ REVQ++ES+ F  Y K+
Sbjct:   16 LQVWRIENLDLKPVPKKLYGSFYTGDAYLLLFTTAAPS---YNIHMWLGDECSQDESGAAAIFATQMDDFLGGGPVQFREVQNHESNAFLGYFKS 107          

HSP 3 Score: 71.2478 bits (173), Expect = 2.870e-22
Identity = 56/218 (25.69%), Postives = 106/218 (48.62%), Query Frame = 1
Query:  430 KELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVS-EVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLK--FDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKE--TGHPQAPVTVLNKKVD 1068
            K +I L GG     +    Q  + RL H++      T + EV+ T  NLN+ DVF+L +   ++ W GKGA+ +E   A+  V  L    ++     V + +E  D   F++ L   K     K+   +  +  ++F  S+ TG L  E++   F +S+L  +DV I+D+  ++ +++G  ++ +E+  +   A +Y+     G    P+T + +  +
Sbjct:  486 KPMIILSGGTSR--KGGQSQAGSTRLFHIRQSSAGATRAVEVNPTASNLNTNDVFVLKSPSALYVWRGKGASDEEVKAAKHVVNFLGGTPSN-----VSENKEPAD---FWSALGGKKEYQTSKSLQGI-IKPPRLFGCSNKTGRLVVEEVPGDFTQSDLATDDVMILDTWDQLFIWVGNEANEEEKNGAPKIAKDYVDSDPAGRRGIPITTIKQGAE 692          

HSP 4 Score: 53.5286 bits (127), Expect = 2.870e-22
Identity = 32/92 (34.78%), Postives = 45/92 (48.91%), Query Frame = 2
Query:  140 NKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIIL---NIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYE 406
             K  + IWR+E  + +       G+FY GD Y+IL       +E  L+Y    W G   TQDE G + + T++LD  +   PVQ R  Q  E
Sbjct:  387 GKGKVQIWRVENGEKVPVDPASYGLFYGGDCYLILYSYRQGARERHLIYT---WQGLKCTQDELGASAFLTIQLDDSMGGAPVQVRVTQGQE 475          
BLAST of Gelsolin-like protein 2 vs. Planmine SMEST
Match: SMESG000015922.1 (SMESG000015922.1)

HSP 1 Score: 466.848 bits (1200), Expect = 0.000e+0
Identity = 228/232 (98.28%), Postives = 229/232 (98.71%), Query Frame = 1
Query:  415 FQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLKFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIFTTQ 1110
            F+  FKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRN KCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLKFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIFTTQ
Sbjct:  135 FKSYFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNGKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLKFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIFTTQ 366          

HSP 2 Score: 289.271 bits (739), Expect = 0.000e+0
Identity = 138/140 (98.57%), Postives = 139/140 (99.29%), Query Frame = 2
Query:   14 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSK 433
            MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWK+AKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSY K
Sbjct:    1 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKKAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYFK 140          
BLAST of Gelsolin-like protein 2 vs. Planmine SMEST
Match: SMESG000015928.1 (SMESG000015928.1)

HSP 1 Score: 295.434 bits (755), Expect = 1.868e-143
Identity = 142/231 (61.47%), Postives = 178/231 (77.06%), Query Frame = 1
Query:  415 FQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNI 1098
            F+  FK LIYLKGGCESGFR V    Y PRLLHV+G KR+I VSEV+AT  NLNS DVFI DTG  IF+WIGKGANKDEKFK ++F Q LNSDRN K  VEV+DE    +NHEFY  LSD++P +D+K    LS ++K++FRISD +GSLKFE +   KF K +++E+D+FI+D+G+EV VYIGEN+SP+ER+ +LIYAH YLK+T +PQ PVTV+ K V GKN + FN +
Sbjct:  135 FKSYFKNLIYLKGGCESGFRHVKTVEYTPRLLHVRGEKRNIIVSEVTATKHNLNSNDVFIYDTGTHIFEWIGKGANKDEKFKGQEFAQALNSDRNGKAKVEVVDEANISENHEFYKHLSDLQPDEDDKWQNKLSVKDKKLFRISDASGSLKFENIAIGKFAKKDINEDDIFIVDNGLEVYVYIGENASPNERQNALIYAHNYLKQTEYPQVPVTVMKKDVKGKNAENFNKV 365          

HSP 2 Score: 233.802 bits (595), Expect = 1.868e-143
Identity = 110/141 (78.01%), Postives = 123/141 (87.23%), Query Frame = 2
Query:   14 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            MQK +KY WKDSNV L GSSEDR VKKSSAE E AWK+AK C+ S L IWRIEKFKV+EWP +Q+G FYEGDSYI+LNI ++EN LLYD+HFWIGK+STQDEYGTA YKTVELD LLDD+PVQHREVQHYES+LFKSY KN
Sbjct:    1 MQKTKKYDWKDSNVELIGSSEDRAVKKSSAENEPAWKKAKACSHSELFIWRIEKFKVVEWPQKQHGEFYEGDSYIVLNIYQRENELLYDVHFWIGKYSTQDEYGTAAYKTVELDNLLDDKPVQHREVQHYESELFKSYFKN 141          
BLAST of Gelsolin-like protein 2 vs. Planmine SMEST
Match: SMESG000015924.1 (SMESG000015924.1)

HSP 1 Score: 296.59 bits (758), Expect = 1.975e-140
Identity = 141/232 (60.78%), Postives = 181/232 (78.02%), Query Frame = 1
Query:  415 FQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLK---FDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNIF 1101
            F+  F  +IYLKGGCESGFR VN + YNPRLLHV+G K +I +SEVS+T KNLNS+DVFI D+G  I+QWIGKGANKDE+FKA+QF QQLNSDRN K  +EV+DE +   NHEFYN LS+ +P+ D+KN  +L++ EK++FRISD TG LKFE++    F+KSN+ ENDVFIID+G  + VY+GE +S +ERK +LIYAH YLK T +PQAP+TV+ K + GKN + FN + 
Sbjct:  135 FKSYFPNIIYLKGGCESGFRHVNTREYNPRLLHVRGEKNNIIISEVSSTKKNLNSDDVFIFDSGSCIYQWIGKGANKDERFKAQQFAQQLNSDRNGKLKIEVLDEGQMSPNHEFYNKLSNNEPIADDKNHKSLTAHEKKLFRISDETGHLKFEQVASGNFNKSNIHENDVFIIDNGQVIYVYVGEKASDNERKNALIYAHNYLKATDYPQAPITVVKKDIKGKNAEEFNKVL 366          

HSP 2 Score: 222.631 bits (566), Expect = 1.975e-140
Identity = 104/141 (73.76%), Postives = 118/141 (83.69%), Query Frame = 2
Query:   14 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            M+K EKY WKDSNV L GSSEDR VKKSSA+TE AW  AK C  + L IWRIEKFKV+EWP ++ G F+EGDSYI+LNI +KE  LLYD+HFWIGK+STQDEYGTA YKTVELDTLLDD+P+QHREVQ YESD+FKSY  N
Sbjct:    1 MKKAEKYDWKDSNVELIGSSEDRSVKKSSADTEKAWNAAKTCKTTALFIWRIEKFKVVEWPKQRFGEFFEGDSYIVLNIYQKEKELLYDIHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPIQHREVQDYESDMFKSYFPN 141          
BLAST of Gelsolin-like protein 2 vs. Planmine SMEST
Match: SMESG000015927.1 (SMESG000015927.1)

HSP 1 Score: 291.197 bits (744), Expect = 2.077e-135
Identity = 141/231 (61.04%), Postives = 178/231 (77.06%), Query Frame = 1
Query:  415 FQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNI 1098
            F+  F+ ++YLKGG ESGFR VN + Y PRLLH KG KR+I ++E+SAT KNL S+DVFI DTG  IFQWIGKGANKDEK+KA+QF QQLN+DRN K  +EV+DEEET  NHE +  LSD  P +++++   L+ QE Q+F+ISD TGSLKFEK+   K +KS ++E DVFI+D+G  V VY+GE SSP+ERK +LIYAH YLKET +PQAPVTV+NK V G N + FN +
Sbjct:  135 FKSYFQNIVYLKGGHESGFRHVNTREYIPRLLHFKGDKRNIIITEISATKKNLKSDDVFIYDTGSSIFQWIGKGANKDEKYKAQQFAQQLNADRNGKLNIEVLDEEETPSNHELFKHLSDSDPEEEDQHLKVLNLQETQLFKISDATGSLKFEKVAAGKLNKSQINEEDVFIVDNGQIVYVYVGEGSSPNERKNALIYAHNYLKETDYPQAPVTVINKDVKGANAENFNKL 365          

HSP 2 Score: 211.075 bits (536), Expect = 2.077e-135
Identity = 106/141 (75.18%), Postives = 117/141 (82.98%), Query Frame = 2
Query:   14 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN 436
            M++  KY WKDSNV L GSSEDR VKKSSAETE AW  AK CN + L +WRIEKFKV+EWP  Q G FYEGDSYI+L I EKE  L YD+HFWIGK+STQDEYGTA YKTVELDTLLDD+PVQHREVQHYES+LFKSY +N
Sbjct:    1 MKRSAKYDWKDSNVELIGSSEDRSVKKSSAETEKAWAAAKACNHAALFVWRIEKFKVVEWPKVQYGEFYEGDSYIVLKIFEKEKQLNYDVHFWIGKYSTQDEYGTAAYKTVELDTLLDDKPVQHREVQHYESNLFKSYFQN 141          
BLAST of Gelsolin-like protein 2 vs. Planmine SMEST
Match: SMESG000015925.1 (SMESG000015925.1)

HSP 1 Score: 248.44 bits (633), Expect = 5.810e-124
Identity = 124/233 (53.22%), Postives = 168/233 (72.10%), Query Frame = 1
Query:  415 FQELFKELIYLKGGCESGFRIVNVQTYNPRLLHVKGRKRSITVSEVSATTKNLNSEDVFILDTGMKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEFYNFLSD--IKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKL---KFDKSNLDENDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLNKKVDGKNLDRFNNI 1098
            F+  F +LIYL GG ESGFR V  + Y+PRLLHV+G K  + VSEV+AT +NLNS+DVF+ DTG  IFQWIGKGANKDE++  ++F QQL+SDRN K  +EV+DE+++  N  FYN LSD   +  DD+K+   L   EK +FRISD TG LKFEK+      ++ ++E+DVFIID+G ++ VYIGE SS  ER+ +LIYAH YLK T +PQAP++V+ K + G + ++F  +
Sbjct:  135 FKSYFSQLIYLNGGIESGFRHVITKEYSPRLLHVRGDKLKVIVSEVAATKRNLNSDDVFLYDTGTHIFQWIGKGANKDERYHGQRFAQQLSSDRNGKVKIEVVDEDDSSSNLIFYNKLSDEISEDWDDDKHHKPLCEHEKLLFRISDETGKLKFEKIGKGNISRAQINEDDVFIIDNGQQIFVYIGEKSSRAERQNALIYAHNYLKGTEYPQAPISVVKKDLKGNSAEQFKKV 367          

HSP 2 Score: 216.083 bits (549), Expect = 5.810e-124
Identity = 100/138 (72.46%), Postives = 112/138 (81.16%), Query Frame = 2
Query:   14 MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIWRIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQDEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSY 427
            M KP+KY+WKDSNV L G+ EDR +KK SAETE AW + K CN   L IWRIEKFKV+EWP  Q G FY GDSYIILNI  + N +LYD+HFWIGK+STQDEYGTA YKTVELD  LDD+PVQHREVQHYES+LFKSY
Sbjct:    1 MVKPKKYSWKDSNVELIGTKEDRSIKKISAETEKAWAKVKSCNHPELFIWRIEKFKVVEWPKNQFGEFYNGDSYIILNIYTRGNEILYDVHFWIGKYSTQDEYGTAAYKTVELDNFLDDKPVQHREVQHYESELFKSY 138          
The following BLAST results are available for this feature:
BLAST of Gelsolin-like protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VIL11.373e-4046.81villin 1 [Source:HGNC Symbol;Acc:HGNC:12690][more]
VIL13.192e-4046.81villin 1 [Source:HGNC Symbol;Acc:HGNC:12690][more]
GSN1.515e-3844.66gelsolin [Source:HGNC Symbol;Acc:HGNC:4620][more]
GSN1.864e-3844.66gelsolin [Source:HGNC Symbol;Acc:HGNC:4620][more]
GSN2.008e-3844.66gelsolin [Source:HGNC Symbol;Acc:HGNC:4620][more]
back to top
BLAST of Gelsolin-like protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gsnl-13.168e-4329.11Gelsolin-like protein 1 [Source:UniProtKB/Swiss-P... [more]
fli-11.341e-1124.37pep chromosome:WBcel235:III:8675297:8683732:-1 gen... [more]
back to top
BLAST of Gelsolin-like protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gel1.252e-4544.44gene:FBgn0010225 transcript:FBtr0078973[more]
Gel1.252e-4544.44gene:FBgn0010225 transcript:FBtr0309256[more]
Gel1.252e-4544.44gene:FBgn0010225 transcript:FBtr0078969[more]
Gel1.252e-4544.44gene:FBgn0010225 transcript:FBtr0078968[more]
Gel1.406e-4544.44gene:FBgn0010225 transcript:FBtr0309257[more]
back to top
BLAST of Gelsolin-like protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
scin3.388e-4532.42scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6][more]
scin3.965e-4532.42scinderin [Source:ZFIN;Acc:ZDB-GENE-060503-6][more]
gsna2.127e-4430.49gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
gsna2.127e-4430.49gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
gsna2.127e-4430.49gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
back to top
BLAST of Gelsolin-like protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ndc803.985e-4032.27NDC80 kinetochore complex component [Source:Xenbas... [more]
ndc804.292e-4032.27NDC80 kinetochore complex component [Source:Xenbas... [more]
ndc804.329e-4032.27NDC80 kinetochore complex component [Source:Xenbas... [more]
ndc804.437e-4032.27NDC80 kinetochore complex component [Source:Xenbas... [more]
ndc804.625e-4032.27NDC80 kinetochore complex component [Source:Xenbas... [more]
back to top
BLAST of Gelsolin-like protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vil15.816e-4146.74villin 1 [Source:MGI Symbol;Acc:MGI:98930][more]
Gsn1.914e-4044.66gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Gsn1.921e-4044.66gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Gsn2.374e-4044.66gelsolin [Source:MGI Symbol;Acc:MGI:95851][more]
Scin3.798e-3831.88scinderin [Source:MGI Symbol;Acc:MGI:1306794][more]
back to top
BLAST of Gelsolin-like protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7JQD3|GELS1_LUMTE5.191e-7962.50Gelsolin-like protein 1 OS=Lumbricus terrestris OX... [more]
sp|Q8MPM1|GELS2_LUMTE2.147e-7355.86Gelsolin-like protein 2 OS=Lumbricus terrestris OX... [more]
sp|Q24800|SEVE_ECHGR1.635e-6453.90Severin OS=Echinococcus granulosus OX=6210 GN=AG8 ... [more]
sp|Q10L71|VLN2_ORYSJ1.832e-4557.45Villin-2 OS=Oryza sativa subsp. japonica OX=39947 ... [more]
sp|Q07171|GELS_DROME9.523e-4544.44Gelsolin OS=Drosophila melanogaster OX=7227 GN=Gel... [more]
back to top
BLAST of Gelsolin-like protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FTU35.041e-10041.60Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8FYV14.635e-9844.68Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8GIF75.383e-9844.68Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1W6I1A34.794e-9573.76Gelsolin-like protein OS=Schmidtea mediterranea OX... [more]
A0A1I8GFK51.061e-9362.68Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Gelsolin-like protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsna1.076e-4631.30gelsolin-like [Source:NCBI gene;Acc:103033745][more]
gsna1.239e-4631.30gelsolin-like [Source:NCBI gene;Acc:103033745][more]
scin4.047e-4330.80scinderin [Source:NCBI gene;Acc:103042167][more]
gsnb7.941e-4046.60gelsolin [Source:NCBI gene;Acc:103027267][more]
scinlb2.458e-3733.33scinderin like b [Source:ZFIN;Acc:ZDB-GENE-040426-... [more]
back to top
BLAST of Gelsolin-like protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
avil1.618e-4228.28advillin [Source:ZFIN;Acc:ZDB-GENE-060421-6683][more]
gsna3.060e-3644.44gelsolin a [Source:ZFIN;Acc:ZDB-GENE-030131-9653][more]
back to top
BLAST of Gelsolin-like protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gelsolin-like protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO403485.150e-8261.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431901.287e-7456.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431912.163e-6958.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492366.793e-5061.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO386583.044e-4931.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gelsolin-like protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gsna1.198e-4530.49gelsolin [Source:NCBI gene;Acc:101167720][more]
gsna1.280e-4530.49gelsolin [Source:NCBI gene;Acc:101167720][more]
vill2.235e-4128.74villin like [Source:NCBI gene;Acc:101155645][more]
vill2.428e-4128.74villin like [Source:NCBI gene;Acc:101155645][more]
scinlb6.383e-3629.68gelsolin [Source:NCBI gene;Acc:101159773][more]
back to top
BLAST of Gelsolin-like protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015922.10.000e+098.28SMESG000015922.1[more]
SMESG000015928.11.868e-14361.47SMESG000015928.1[more]
SMESG000015924.11.975e-14060.78SMESG000015924.1[more]
SMESG000015927.12.077e-13561.04SMESG000015927.1[more]
SMESG000015925.15.810e-12453.22SMESG000015925.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031686 ID=SMED30031686|Name=Gelsolin-like protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1247bp
TCCGATCTAAAATATGCAAAAACCAGAAAAATATGCCTGGAAAGATTCGA
ATGTTGCCTTAACTGGGTCAAGTGAAGATCGAGAAGTTAAAAAAAGCTCG
GCAGAAACTGAAGCTGCTTGGAAAAGAGCTAAATTATGTAATAAATCTAC
ATTGCTCATTTGGAGAATCGAGAAATTCAAAGTTATGGAGTGGCCAAATG
AGCAAAATGGCGTATTTTATGAAGGTGATTCGTATATCATATTAAATATA
AAAGAAAAAGAAAATGTTCTACTTTATGATTTACATTTTTGGATTGGGAA
GTTTTCGACTCAGGATGAATATGGGACAGCAGTTTACAAAACAGTTGAAT
TAGACACATTGCTAGATGATCGGCCAGTTCAACATCGAGAGGTTCAACAT
TATGAATCAGATCTTTTCAAGAGCTATTCAAAGAATTAATATATCTAAAA
GGAGGCTGTGAAAGTGGATTTCGGATAGTAAATGTGCAAACCTATAATCC
GCGATTACTGCATGTGAAAGGTAGAAAGCGCTCTATCACTGTTTCTGAGG
TATCTGCTACTACAAAAAATCTGAATTCGGAAGATGTTTTTATTCTCGAT
ACTGGAATGAAAATATTTCAATGGATTGGAAAAGGTGCAAATAAAGATGA
GAAATTCAAGGCTCGACAATTTGTTCAACAACTTAATTCAGACAGGAATG
ATAAGTGCTTAGTTGAAGTTATCGATGAAGAAGAAACTCTTGACAATCAT
GAATTTTATAATTTTCTATCGGATATTAAACCTGTAGACGATGAAAAGAA
TTTTACGGCACTAAGTTCACAAGAAAAACAAATTTTCAGGATATCAGATA
TTACCGGAAGTTTGAAATTTGAAAAACTTAAATTTGATAAATCAAATCTA
GATGAAAATGATGTTTTTATTATTGACAGTGGAATGGAAGTCATTGTTTA
TATAGGAGAAAATTCCAGTCCGGATGAACGAAAGAAATCTCTGATTTATG
CTCATGAATATTTAAAGGAAACAGGGCACCCCCAGGCTCCAGTTACTGTA
TTAAACAAAAAAGTAGATGGCAAAAATTTGGATAGATTTAATAACATTTT
TACCACCCAGTAAAAATGTCTTTTTTTAGATTGAAAATCAACAAAACTGT
TTATTTTTACACCATTTTTGTCAATTTTACATTTAAAATTCACTTTAATA
ACTTTGGTTTAATCTTAATATAATTGTTCATTCAAAACTTTAAAAAA
back to top

protein sequence of SMED30031686-orf-1

>SMED30031686-orf-1 ID=SMED30031686-orf-1|Name=SMED30031686-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=169bp
MKIFQWIGKGANKDEKFKARQFVQQLNSDRNDKCLVEVIDEEETLDNHEF
YNFLSDIKPVDDEKNFTALSSQEKQIFRISDITGSLKFEKLKFDKSNLDE
NDVFIIDSGMEVIVYIGENSSPDERKKSLIYAHEYLKETGHPQAPVTVLN
KKVDGKNLDRFNNIFTTQ*
back to top

protein sequence of SMED30031686-orf-2

>SMED30031686-orf-2 ID=SMED30031686-orf-2|Name=SMED30031686-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=142bp
MQKPEKYAWKDSNVALTGSSEDREVKKSSAETEAAWKRAKLCNKSTLLIW
RIEKFKVMEWPNEQNGVFYEGDSYIILNIKEKENVLLYDLHFWIGKFSTQ
DEYGTAVYKTVELDTLLDDRPVQHREVQHYESDLFKSYSKN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0051015actin filament binding
GO:0003779actin binding
GO:0005509calcium ion binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR007122Villin/Gelsolin
IPR007123Gelsolin-like_dom
IPR029006ADF-H/Gelsolin-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
Vocabulary: biological process
TermDefinition
GO:0007275multicellular organism development
GO:0030041actin filament polymerization
GO:0030043actin filament fragmentation
GO:0045010actin nucleation
GO:0051014actin filament severing
GO:0051693actin filament capping
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007122Villin/GelsolinSMARTSM00262VILL_6coord: 46..143
e-value: 2.8E-17
score: 73.4
IPR007122Villin/GelsolinPANTHERPTHR11977VILLINcoord: 34..142
IPR007123Gelsolin-like domainPFAMPF00626Gelsolincoord: 67..136
e-value: 1.3E-13
score: 50.6
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 30..143
e-value: 5.2E-37
score: 128.8
NoneNo IPR availablePANTHERPTHR11977:SF85VILLIN-2coord: 34..142
NoneNo IPR availableCDDcd11290gelsolin_S1_likecoord: 41..141
e-value: 2.83181E-50
score: 154.303
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 44..142