Fibronectin leucine rich transmembrane protein 2

Overview
NameFibronectin leucine rich transmembrane protein 2
Smed IDSMED30031665
Length (bp)2770
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fibronectin leucine rich transmembrane protein 2 (SMED30031665) t-SNE clustered cells

Violin plots show distribution of expression levels for Fibronectin leucine rich transmembrane protein 2 (SMED30031665) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fibronectin leucine rich transmembrane protein 2 (SMED30031665) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fibronectin leucine rich transmembrane protein 2 (SMED30031665) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031665

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30031665SMESG000023338.1 dd_Smed_v4_11266_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30031665SMESG000023338.1 dd_Smed_v4_11266_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30031665SMESG000023338.1 SmedASXL_016099SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30031665SMESG000023338.1 dd_Smed_v4_11266_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031665SMESG000023338.1 dd_Smed_v6_11266_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30031665SMESG000023338.1 OX_Smed_1.0.22715ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Human
Match: LRIG2 (leucine rich repeats and immunoglobulin like domains 2 [Source:HGNC Symbol;Acc:HGNC:20889])

HSP 1 Score: 97.8265 bits (242), Expect = 5.155e-20
Identity = 93/317 (29.34%), Postives = 149/317 (47.00%), Query Frame = 3
Query:  453 EMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLK-MIPDF--FFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPV--IWTKNG---YKVEETVNKFQIFNSGNE--NFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            + L ++Q  I  I  + ++    LS L L+++ L R+  +AF  LS L  L+L  N++    D +  +L     NL+ L L NN +   I D    F  L+SL KL+L      S  I+ +AF GL SLE LDL N+ I +I    E+ F +   L+ L+L  +  +CDCHL+WL ++L      +     + V   C  P+ L    I+  +D       +F+ P    R  P  ++     ++ LTC   S    P+  +W K+    Y V +T N  + +    E   + S LH+ ++   D G + C V + F
Sbjct:  290 QQLYVSQNAIERISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFL----SNLQTLDLRNNEISWAIEDASEAFAGLTSLTKLILQGNQIKS--ITKKAFIGLESLEHLDLNNNAIMSIQ---ENAFSQTH-LKELILNTSSLLCDCHLKWLLQWL------VDNNFQHSVNVSCAHPEWLAGQSIL-NVDLKDFVCDDFLKPQI--RTHPETIIALRGMNVTLTCTAVSSSDSPMSTVWRKDSEILYDV-DTENFVRYWQQAGEALEYTSILHLFNVNFTDEGKYQCIVTNHF 586          

HSP 2 Score: 54.299 bits (129), Expect = 1.296e-6
Identity = 54/187 (28.88%), Postives = 91/187 (48.66%), Query Frame = 3
Query:  399 GDPKSQI---ELIPNPLPD----------ATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSY-LTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRV 917
            G+P S I    L+ N +P+          A E L ++   I  IK   F   ++L  L+L+ + +  +    F NLS  L ++ L+ N++     S+    I  L +L+ L+L  N +K++    F+ L SLR L +   G   L+    AF GLN++EEL+L ++ +  +NK      R ++ L V
Sbjct:  116 GEPTSNITLLSLVHNIIPEINAQALQFYPALESLDLSSNIISEIKTSSFPR-MQLKYLNLSNNRITTLEAGCFDNLSSSLLVVKLNRNRM-----SMIPPKIFKLPHLQFLELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLK--DGAFFGLNNMEELELEHNNLTRVNKGWLYGLRMLQQLYV 294          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Human
Match: SLIT1 (slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGNC:11085])

HSP 1 Score: 87.4261 bits (215), Expect = 1.934e-17
Identity = 63/190 (33.16%), Postives = 89/190 (46.84%), Query Frame = 3
Query:  411 SQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYL 980
            + ++ IP  +P  TE L +   NI  I + DF  + +L  L L  + +  + R AF ++  L  L L+ N+L +    LP  L  N   L  L L+ N ++ IP   F+  + L+ L L+        I   AF  L  LE L L N+ I TI     S F  M  LR   L  N   CDCHL WL ++L
Sbjct:   50 TGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHM----LPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISC--IEEGAFRALRGLEVLTLNNNNITTIPV---SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWL 230          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Human
Match: LRIG3 (leucine rich repeats and immunoglobulin like domains 3 [Source:HGNC Symbol;Acc:HGNC:30991])

HSP 1 Score: 87.4261 bits (215), Expect = 8.162e-17
Identity = 93/343 (27.11%), Postives = 146/343 (42.57%), Query Frame = 3
Query:  453 EMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLND--------------CGFDSLR-----------ISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGE--IQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVC---PIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVI--WTKNGYKVE--ETVNKFQIFNSGNE--NFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            E+L +   N+  I +     +L L  L L+ + + RI  +A++    L+ LDL+ N L   DDS  S+L  +L+N  H+   NN +  I D  F+ LSSL+ L L +               G D LR           I+ +AF GL++LE LDL ++ I ++       F +MK L+ L L  +  +CDC L+WL +++ E   Q F        V   C  P+ L+   I A           FVC   P     V P         +L+  C   S    P+   W K+   +   E  N   +   G E   + + L +R ++    G + C + + F
Sbjct:  206 EILQLDHNNLTEITKGWLYGLLMLQELHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDS--SFLGLSLLNTLHIG--NNRVSYIADCAFRGLSSLKTLDLKNNEISWTIEDMNGAFSGLDKLRRLILQGNRIRSITKKAFTGLDALEHLDLSDNAIMSLQGNA---FSQMKKLQQLHLNTSSLLCDCQLKWLPQWVAENNFQSF--------VNASCAHPQLLKGRSIFAVSPDG------FVCDDFPKPQITVQPETQSAIKGSNLSFICSAASSSDSPMTFAWKKDNELLHDAEMENYAHLRAQGGEVMEYTTILRLREVEFASEGKYQCVISNHF 527          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Human
Match: SLIT1 (slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGNC:11085])

HSP 1 Score: 87.4261 bits (215), Expect = 8.360e-17
Identity = 63/190 (33.16%), Postives = 89/190 (46.84%), Query Frame = 3
Query:  411 SQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYL 980
            + ++ IP  +P  TE L +   NI  I + DF  + +L  L L  + +  + R AF ++  L  L L+ N+L +    LP  L  N   L  L L+ N ++ IP   F+  + L+ L L+        I   AF  L  LE L L N+ I TI     S F  M  LR   L  N   CDCHL WL ++L
Sbjct:   50 TGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHM----LPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISC--IEEGAFRALRGLEVLTLNNNNITTIPV---SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWL 230          

HSP 2 Score: 63.1586 bits (152), Expect = 2.262e-9
Identity = 64/225 (28.44%), Postives = 104/225 (46.22%), Query Frame = 3
Query:  522 LSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPG--NVVLDSEKSLNLTC 1190
            ++ + L  + ++ I   AF     L  +DLS N++      +       L +L  L L  N +  +P   F  L +L+ LLLN    + +R    AF  L +L  L L ++ I+++ K     F  ++ ++ L L +NP+ICDC+L+WL        +F+        G RC  P+RL N RI       Q K  +F C  K     PG  +  L+SE + ++ C
Sbjct:  311 MTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIA----EIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIR--PDAFQDLQNLSLLSLYDNKIQSLAK---GTFTSLRAIQTLHLAQNPFICDCNLKWL-------ADFLRTNPIETSGARCASPRRLANKRI------GQIKSKKFRCSAKEQYFIPGTEDYQLNSECNSDVVC 513          

HSP 3 Score: 56.6102 bits (135), Expect = 2.497e-7
Identity = 86/364 (23.63%), Postives = 147/364 (40.38%), Query Frame = 3
Query:  381 KRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFK---NVLELSTLSLTFSNLERIHRNAFKNLSYL--------TILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLR-ISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYL--GEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPV-IWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQNFTLKINPNSIFPMAAS 1427
            KR+++ G+P+ Q        PD    + +     P  + E+ +     L         + L+ + R + K+L  L        T L L GN+  L    L ++    LV+L     +NN +  + +  F  +S L  L+L+   +++L+ I   AF GL SL  L L  + I T+    E  F ++  L  L +G NP  CDCHLRWL  ++  G  +  I          RC  P+ +E   ++       +K  E   P   +  +  ++ L S      TC   +DP++       +GYK  +        +SG      T H    +  +   ++C     F+  T  +N +     A +
Sbjct:  688 KRKIVTGNPRCQN-------PDFLRQIPLQDVAFPDFRCEEGQEEGGCLPRPQCPQECACLDTVVRCSNKHLRALPKGIPKNVTELYLDGNQFTLVPGQLSTFKYLQLVDL-----SNNKISSLSNSSFTNMSQLTTLILS---YNALQCIPPLAFQGLRSLRLLSLHGNDISTL---QEGIFADVTSLSHLAIGANPLYCDCHLRWLSSWVKTGYKEPGIA---------RCAGPQDMEGKLLLT----TPAKKFECQGPPTLAVQAKCDLCLSSPCQNQGTCH--NDPLEVYRCACPSGYKGRDCEVSLDSCSSGPCENGGTCHA---QEGEDAPFTCSCPTGFEGPTCGVNTDDCVDHACA 1015          

HSP 4 Score: 53.9138 bits (128), Expect = 1.680e-6
Identity = 47/160 (29.38%), Postives = 76/160 (47.50%), Query Frame = 3
Query:  576 FKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRL 1055
            FK L++L  ++LS NK+   +D           ++  L LT N L+ I    F+ L  LR L+L +       I + +F GL ++  L L ++ I T++      F  ++ L  L L  NP+ C+C L WL  +L   ++ +T        PRC+ P  L
Sbjct:  561 FKKLTHLKKINLSNNKVSEIEDGA----FEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISC--IHNDSFTGLRNVRLLSLYDNQITTVSP---GAFDTLQSLSTLNLLANPFNCNCQLAWLGGWL-RKRKIVTGN------PRCQNPDFL 704          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Human
Match: SLIT1 (slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGNC:11085])

HSP 1 Score: 87.0409 bits (214), Expect = 8.648e-17
Identity = 63/190 (33.16%), Postives = 89/190 (46.84%), Query Frame = 3
Query:  411 SQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYL 980
            + ++ IP  +P  TE L +   NI  I + DF  + +L  L L  + +  + R AF ++  L  L L+ N+L +    LP  L  N   L  L L+ N ++ IP   F+  + L+ L L+        I   AF  L  LE L L N+ I TI     S F  M  LR   L  N   CDCHL WL ++L
Sbjct:   33 TGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLHM----LPELLFQNNQALSRLDLSENAIQAIPRKAFRGATDLKNLQLDKNQISC--IEEGAFRALRGLEVLTLNNNNITTIPV---SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWL 213          

HSP 2 Score: 58.5362 bits (140), Expect = 5.331e-8
Identity = 42/134 (31.34%), Postives = 65/134 (48.51%), Query Frame = 3
Query:  795 ISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPG--NVVLDSEKSLNLTC 1190
            I   AF  L +L  L L ++ I+++ K     F  ++ ++ L L +NP+ICDC+L+WL        +F+        G RC  P+RL N RI       Q K  +F C  K     PG  +  L+SE + ++ C
Sbjct:  389 IRPDAFQDLQNLSLLSLYDNKIQSLAK---GTFTSLRAIQTLHLAQNPFICDCNLKWLA-------DFLRTNPIETSGARCASPRRLANKRI------GQIKSKKFRCSAKEQYFIPGTEDYQLNSECNSDVVC 506          

HSP 3 Score: 53.9138 bits (128), Expect = 1.295e-6
Identity = 46/157 (29.30%), Postives = 76/157 (48.41%), Query Frame = 3
Query:  576 FKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQP 1046
            FK L++L  ++LS NK+   +D           ++  L LT N L+ I    F+ L  LR L+L +       I + +F GL ++  L L ++ I T++      F  ++ L  L L  NP+ C+C L WL  +L + ++ +T        PRC+ P
Sbjct:  554 FKKLTHLKKINLSNNKVSEIEDGA----FEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISC--IHNDSFTGLRNVRLLSLYDNQITTVSP---GAFDTLQSLSTLNLLANPFNCNCQLAWLGGWLRK-RKIVT------GNPRCQNP 694          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Celegans
Match: slt-1 (Slit homolog 1 protein [Source:UniProtKB/Swiss-Prot;Acc:G5EFX6])

HSP 1 Score: 68.9366 bits (167), Expect = 1.441e-11
Identity = 53/189 (28.04%), Postives = 86/189 (45.50%), Query Frame = 3
Query:  414 QIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYL 980
            Q+  +P  +P+ T  L +    I  I   DF +++ L  L L  + +  IH  +F +L +L  L LS N++      LP  +  N + L HL L+ N + ++ D   +    L  L L+      L   +       SLE L L  + + T  +   + FR++       L  NPW CDC LRW+ ++L
Sbjct:   34 QLTEVPQNIPNDTIRLDLQDNEITKIGPNDFSSLMNLKALQLMDNQIVTIHNQSFSSLVFLQKLRLSRNRI----RHLPDNVFQNNLKLTHLDLSENDITVVSDAQLQGPEFLEVLNLDKNHIFCLE--NNVISSWVSLEVLTLNGNRLTTFEEPSNARFRQLD------LFNNPWNCDCRLRWMRKWL 210          

HSP 2 Score: 60.077 bits (144), Expect = 8.645e-9
Identity = 72/282 (25.53%), Postives = 112/282 (39.72%), Query Frame = 3
Query:  342 KGCVVTLVNP---TSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKV-GPRCKQPKRLENYRIIAGIDRNQSK---------------YVEFVCPIKC 1130
            K C    + P   T     V C D  S +  +P  LP +T  + + Q  I  I    FKN+  L+ L L+ + +  I   AF  L  L  L L GN               N+ +LK           +       L+ +R+                 F  +  L  L L ++ I++I+   E  F+ +  L  L L +NP ICDC+L+WL +        I LQ + +  G RC+QPKRL   +  A +  N+ K               +++ +CP +C
Sbjct:  252 KTCETAEICPLPCTCTGTTVDCRD--SGLTYVPTNLPPSTTEIRLEQNQISSIPSHSFKNLKNLTRLDLSKNIITEIQPKAFLGLHNLHTLVLYGN---------------NITDLKSDTFEGLGSLQLLLLNANQLTCIRR---------------GTFDHVPKLSMLSLYDNDIKSIS---EVTFQNLTSLSTLHLAKNPLICDCNLQWLAQ--------INLQKNIETSGARCEQPKRLRKKK-FATLPPNKFKCKGSESFVSMYADSCFIDSICPTQC 489          

HSP 3 Score: 52.7582 bits (125), Expect = 1.285e-6
Identity = 53/228 (23.25%), Postives = 104/228 (45.61%), Query Frame = 3
Query:  546 SNLERIHRNAFKNL-SYLTILDLSGNKLILNDD---SLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLR-ISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAG------IDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKC 1196
            S L+R+ R + KNL S+ + +     +L L+ +    +P++ +  L +L  L L++N L  + +  F  L+ L  L+++   ++ LR +   AF+GLN+L  L L  + I  +    +S F  +  +  + +G N   CDC++ W  +++    +FI   +      RC+ P  + N  ++         D      +   C +  +     N + ++  S   TC C
Sbjct:  682 SCLDRVVRCSNKNLTSFPSRIPFDTTELYLDANYINEIPAHDLNRLYSLTKLDLSHNRLISLENNTFSNLTRLSTLIIS---YNKLRCLQPLAFNGLNALRILSLHGNDISFL---PQSAFSNLTSITHIAVGSNSLYCDCNMAWFSKWIKS--KFIEAGI-----ARCEYPNTVSNQLLLTAQPYQFTCDSKVPTKLATKCDLCLNSPCKNNAICETTSSRKYTCNC 896          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Celegans
Match: pan-1 (P-granule-associated novel protein 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9U3A0])

HSP 1 Score: 59.3066 bits (142), Expect = 1.070e-8
Identity = 45/135 (33.33%), Postives = 71/135 (52.59%), Query Frame = 3
Query:  531 LSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGEN 935
            LSL  + ++++ +  F  L  L  LDL+ NK+      +       L  ++ L L  N ++++    F  + +L+KL L +C  +   I   AF GLNSLE+L L N+ +E I+ T+   F  +K LRVL LG N
Sbjct:  132 LSLRENRIKKLEKGLFTGLKSLKTLDLAMNKI----QEIDVGAFEELKKVEELLLNENDIRVLKTGTFDGMKNLKKLTLQNCNLEI--IQKGAFRGLNSLEQLILSNNNLENIDWTI---FSALKNLRVLDLGSN 257          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Celegans
Match: sma-10 (Leucine-rich repeats and immunoglobulin-like domains protein sma-10 [Source:UniProtKB/Swiss-Prot;Acc:Q965M2])

HSP 1 Score: 58.9214 bits (141), Expect = 1.719e-8
Identity = 50/192 (26.04%), Postives = 89/192 (46.35%), Query Frame = 3
Query:  504 FKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLD-NKVGPRCKQPKRLENYRIIA 1076
            F+ + +L  L L+ ++++ +H+ A   +S L  LDLS N L +  +       T++  L+ L+ TNN L++IP                           RAF    +LEELDL ++ I TI+     +  E   L+ L++  +  +CDC + WL  ++        L+LD + +  +C  P  L +  ++A
Sbjct:  335 FRVLRQLEELILSANSIDSLHKFALVGMSSLHKLDLSSNTLAVCVEDGAVLYNTSMPFLRSLRFTNNQLRVIP--------------------------KRAFERFPALEELDLTDNPIATIHP----EAFEPLELKRLVMNSSSILCDCQISWLASWIYR------LKLDKSSIIAKCSYPPPLADLYVVA 490          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Celegans
Match: sma-10 (Leucine-rich repeats and immunoglobulin-like domains protein sma-10 [Source:UniProtKB/Swiss-Prot;Acc:Q965M2])

HSP 1 Score: 58.9214 bits (141), Expect = 1.719e-8
Identity = 50/192 (26.04%), Postives = 89/192 (46.35%), Query Frame = 3
Query:  504 FKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLD-NKVGPRCKQPKRLENYRIIA 1076
            F+ + +L  L L+ ++++ +H+ A   +S L  LDLS N L +  +       T++  L+ L+ TNN L++IP                           RAF    +LEELDL ++ I TI+     +  E   L+ L++  +  +CDC + WL  ++        L+LD + +  +C  P  L +  ++A
Sbjct:  335 FRVLRQLEELILSANSIDSLHKFALVGMSSLHKLDLSSNTLAVCVEDGAVLYNTSMPFLRSLRFTNNQLRVIP--------------------------KRAFERFPALEELDLTDNPIATIHP----EAFEPLELKRLVMNSSSILCDCQISWLASWIYR------LKLDKSSIIAKCSYPPPLADLYVVA 490          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Celegans
Match: lron-7 (ELRR (Extracellular Leucine-Rich Repeat) ONly [Source:UniProtKB/TrEMBL;Acc:Q21164])

HSP 1 Score: 58.5362 bits (140), Expect = 1.985e-8
Identity = 62/233 (26.61%), Postives = 102/233 (43.78%), Query Frame = 3
Query:  480 IPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLN---------DCGFDSL-----------------------RISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGI 1082
            I   ++E FK +  L  LSL   N+E +  + F+ L  L  L L  N L    + +P+ ++ +L +LK + L+   L  I D  F   S L +++L          DCGF  L                        I S+  H   ++  L + NS I TI++ M  D+  +K  +V   G NPW C+C  +++      ++E    + D+ V P+C  P  L N R++  +
Sbjct:  289 IKAWRKEMFKGLDSLEELSLDNCNIENLPADIFEYLPKLVKLSLRENPL----EEIPA-VVAHLKSLKDIDLSVTNLTEIRDHAFAGDSDLEEIILEKMPFLTVVRDCGFCGLPQLKTLILNDNKYLQELHPNAFGYIKSQPGHKSAAITSLQIHNSNISTISEHM-VDYDNLKTFQV---GGNPWNCNCDTQFM------LEEKFAFKQDS-VAPKCTSPAGL-NGRLLVTV 504          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Fly
Match: kek2 (gene:FBgn0015400 transcript:FBtr0080252)

HSP 1 Score: 107.842 bits (268), Expect = 1.624e-23
Identity = 103/364 (28.30%), Postives = 170/364 (46.70%), Query Frame = 3
Query:  381 KRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDF--KNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLR----WLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKC-SRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNG---------------YKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDV----FQNFTLKI 1394
            K+ V CG    Q+  +P  +   T++L  +   + V++ E F   ++L L  + L+ + L RIH  AF+ L+ L  LDLS N L     ++PS    +  +L  L L+ NP++ +    F+ LS L  L L++C  +  RI + AF G+++LE L L  + I  I  T        K L  + L  N W CDC L     WL  Y   + E           P+C +P RL+  ++I  + R Q   +  V P    + VS G       +++++TC   + P   V+W  NG               Y ++ET+       SG E   S + I ++ + D+G++SC  +++    F N+TL++
Sbjct:   33 KQTVECGG--QQLSNLPEGMDPGTQVLNFSGNALQVLQSERFLRMDLLNLQKIYLSRNQLIRIHEKAFRGLTNLVELDLSENAL----QNVPSETFQDYSSLMRLSLSGNPIRELKTSAFRHLSFLTTLELSNCQVE--RIENEAFVGMDNLEWLRLDGNRIGFIQGT----HILPKSLHGISLHSNRWNCDCRLLDIHFWLVNYNTPLAE----------EPKCMEPARLKG-QVIKSLQREQLACLPEVSPQSSYTEVSEG-------RNMSITCLVRAIPEPKVLWLFNGQVMSNDSLMDNLHMYYYIDETIGV-----SGAEEKRSEIFIYNVGAEDNGTFSCVGQNIAGTTFSNYTLRV 361          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330734)

HSP 1 Score: 96.2857 bits (238), Expect = 9.198e-20
Identity = 67/217 (30.88%), Postives = 108/217 (49.77%), Query Frame = 3
Query:  426 IPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGP--RCKQPKRLENYRI 1070
            +P  +    E L +   N+ VI E DF+ + +L  L LT + +  I RN+F++L  L  L L+ N+L     ++P   +T+  +L  L ++NN +  +    FK   SLR L L++     L     AF GL  LE L L N+ + ++   +   F  +  LR L L +NP+ CDCHL WL R+         L+   ++ P  RC+ P +L+   +
Sbjct:   94 VPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRL----KAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCL--DEHAFKGLVELEILTLNNNNLTSLPHNI---FGGLGRLRALRLSDNPFACDCHLSWLSRF---------LRSATRLAPYTRCQSPSQLKGQNV 292          

HSP 2 Score: 64.3142 bits (155), Expect = 5.488e-10
Identity = 67/215 (31.16%), Postives = 92/215 (42.79%), Query Frame = 3
Query:  426 IPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRI 1070
            +P  LPD T  L + Q  I  +  + F +   L  + L+ +N+ RI  +A   L  LT L L GNK+      LPS +   L +L+ L L  N +  I    F+ L SL  L L D    SL                          N T    F  MK ++ + L +NP+ICDC+LRWL  YL +             G RC+ PKR+   RI
Sbjct:  340 VPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKI----KDLPSGVFKGLGSLQLLLLNANEISCIRKDAFRDLHSLSLLSLYDNNIQSL-------------------------ANGT----FDAMKSIKTVHLAKNPFICDCNLRWLADYLHK-------NPIETSGARCESPKRMHRRRI 514          

HSP 3 Score: 61.2326 bits (147), Expect = 4.955e-9
Identity = 50/186 (26.88%), Postives = 80/186 (43.01%), Query Frame = 3
Query:  519 ELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIA 1076
            E S L L  + +E+IH    ++L  LT LDLS N++ +    L +Y   NL  L  L ++ N L+ +                             A  GLN+L  L L  + I  +    E  F ++K L  + LG NP  CDC L+W         ++I L        RC +P+++++  I++
Sbjct:  767 ETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITI----LSNYTFANLTKLSTLIISYNKLQCL--------------------------QRHALSGLNNLRVLSLHGNRISML---PEGSFEDLKSLTHIALGSNPLYCDCGLKWF-------SDWIKLDYVEPGIARCAEPEQMKDKLILS 912          

HSP 4 Score: 55.4546 bits (132), Expect = 2.619e-7
Identity = 52/189 (27.51%), Postives = 87/189 (46.03%), Query Frame = 3
Query:  519 ELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSL----PSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLR-ISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRI 1070
            E +T+  T   L+ I R+          + L   +L+LND+ L       L   L +L  L+L  N L  I    F+  S +++L L   G + ++ IS++ F GL+ L+ L+L ++ I  +   M   F  +  L  L L  NP+ C+CHL W         E++  +  N    RC  P ++ + +I
Sbjct:  550 EGTTVDCTGRGLKEIPRD----------IPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQL---GENKIKEISNKMFLGLHQLKTLNLYDNQISCV---MPGSFEHLNSLTSLNLASNPFNCNCHLAWF-------AEWLRKKSLNGGAARCGAPSKVRDVQI 715          

HSP 5 Score: 53.1434 bits (126), Expect = 1.642e-6
Identity = 38/131 (29.01%), Postives = 64/131 (48.85%), Query Frame = 3
Query:  408 KSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLN------DCGF 782
            ++Q++ IP  +P  T  L +    I  I  E  +++  L+ L L+ + +  +    F NL+ L+ L +S NKL      L  + ++ L NL+ L L  N + M+P+  F+ L SL  + L       DCG 
Sbjct:  754 RNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKL----QCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGL 880          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330733)

HSP 1 Score: 95.9005 bits (237), Expect = 1.077e-19
Identity = 67/217 (30.88%), Postives = 108/217 (49.77%), Query Frame = 3
Query:  426 IPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGP--RCKQPKRLENYRI 1070
            +P  +    E L +   N+ VI E DF+ + +L  L LT + +  I RN+F++L  L  L L+ N+L     ++P   +T+  +L  L ++NN +  +    FK   SLR L L++     L     AF GL  LE L L N+ + ++   +   F  +  LR L L +NP+ CDCHL WL R+         L+   ++ P  RC+ P +L+   +
Sbjct:   94 VPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRL----KAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCL--DEHAFKGLVELEILTLNNNNLTSLPHNI---FGGLGRLRALRLSDNPFACDCHLSWLSRF---------LRSATRLAPYTRCQSPSQLKGQNV 292          

HSP 2 Score: 63.929 bits (154), Expect = 6.946e-10
Identity = 67/215 (31.16%), Postives = 96/215 (44.65%), Query Frame = 3
Query:  426 IPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRI 1070
            +P  LPD T  L + Q  I  +  + F +   L  + L+ +N+ RI  +A   L  LT L L GNK+                            K +P   FK L SL+ LLLN      +R    AF  L+SL  L L ++ I+++       F  MK ++ + L +NP+ICDC+LRWL  YL +             G RC+ PKR+   RI
Sbjct:  340 VPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKI----------------------------KDLPSGVFKGLGSLQLLLLNANEISCIR--KDAFRDLHSLSLLSLYDNNIQSL---ANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHK-------NPIETSGARCESPKRMHRRRI 514          

HSP 3 Score: 60.8474 bits (146), Expect = 6.138e-9
Identity = 50/186 (26.88%), Postives = 80/186 (43.01%), Query Frame = 3
Query:  519 ELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIA 1076
            E S L L  + +E+IH    ++L  LT LDLS N++ +    L +Y   NL  L  L ++ N L+ +                             A  GLN+L  L L  + I  +    E  F ++K L  + LG NP  CDC L+W         ++I L        RC +P+++++  I++
Sbjct:  767 ETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITI----LSNYTFANLTKLSTLIISYNKLQCL--------------------------QRHALSGLNNLRVLSLHGNRISML---PEGSFEDLKSLTHIALGSNPLYCDCGLKWF-------SDWIKLDYVEPGIARCAEPEQMKDKLILS 912          

HSP 4 Score: 55.4546 bits (132), Expect = 2.492e-7
Identity = 52/189 (27.51%), Postives = 87/189 (46.03%), Query Frame = 3
Query:  519 ELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSY----LITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLR-ISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRI 1070
            E +T+  T   L+ I R+          + L   +L+LND+ L       L   L +L  L+L  N L  I    F+  S +++L L   G + ++ IS++ F GL+ L+ L+L ++ I  +   M   F  +  L  L L  NP+ C+CHL W         E++  +  N    RC  P ++ + +I
Sbjct:  550 EGTTVDCTGRGLKEIPRD----------IPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQL---GENKIKEISNKMFLGLHQLKTLNLYDNQISCV---MPGSFEHLNSLTSLNLASNPFNCNCHLAWF-------AEWLRKKSLNGGAARCGAPSKVRDVQI 715          

HSP 5 Score: 53.5286 bits (127), Expect = 1.088e-6
Identity = 38/131 (29.01%), Postives = 64/131 (48.85%), Query Frame = 3
Query:  408 KSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLN------DCGF 782
            ++Q++ IP  +P  T  L +    I  I  E  +++  L+ L L+ + +  +    F NL+ L+ L +S NKL      L  + ++ L NL+ L L  N + M+P+  F+ L SL  + L       DCG 
Sbjct:  754 RNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKL----QCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGL 880          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Fly
Match: sli (gene:FBgn0264089 transcript:FBtr0330731)

HSP 1 Score: 95.9005 bits (237), Expect = 1.077e-19
Identity = 67/217 (30.88%), Postives = 108/217 (49.77%), Query Frame = 3
Query:  426 IPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGP--RCKQPKRLENYRI 1070
            +P  +    E L +   N+ VI E DF+ + +L  L LT + +  I RN+F++L  L  L L+ N+L     ++P   +T+  +L  L ++NN +  +    FK   SLR L L++     L     AF GL  LE L L N+ + ++   +   F  +  LR L L +NP+ CDCHL WL R+         L+   ++ P  RC+ P +L+   +
Sbjct:   94 VPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRL----KAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCL--DEHAFKGLVELEILTLNNNNLTSLPHNI---FGGLGRLRALRLSDNPFACDCHLSWLSRF---------LRSATRLAPYTRCQSPSQLKGQNV 292          

HSP 2 Score: 63.929 bits (154), Expect = 6.946e-10
Identity = 67/215 (31.16%), Postives = 96/215 (44.65%), Query Frame = 3
Query:  426 IPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRI 1070
            +P  LPD T  L + Q  I  +  + F +   L  + L+ +N+ RI  +A   L  LT L L GNK+                            K +P   FK L SL+ LLLN      +R    AF  L+SL  L L ++ I+++       F  MK ++ + L +NP+ICDC+LRWL  YL +             G RC+ PKR+   RI
Sbjct:  340 VPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKI----------------------------KDLPSGVFKGLGSLQLLLLNANEISCIR--KDAFRDLHSLSLLSLYDNNIQSL---ANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHK-------NPIETSGARCESPKRMHRRRI 514          

HSP 3 Score: 60.8474 bits (146), Expect = 6.138e-9
Identity = 50/186 (26.88%), Postives = 80/186 (43.01%), Query Frame = 3
Query:  519 ELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIA 1076
            E S L L  + +E+IH    ++L  LT LDLS N++ +    L +Y   NL  L  L ++ N L+ +                             A  GLN+L  L L  + I  +    E  F ++K L  + LG NP  CDC L+W         ++I L        RC +P+++++  I++
Sbjct:  767 ETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITI----LSNYTFANLTKLSTLIISYNKLQCL--------------------------QRHALSGLNNLRVLSLHGNRISML---PEGSFEDLKSLTHIALGSNPLYCDCGLKWF-------SDWIKLDYVEPGIARCAEPEQMKDKLILS 912          

HSP 4 Score: 55.4546 bits (132), Expect = 2.492e-7
Identity = 52/189 (27.51%), Postives = 87/189 (46.03%), Query Frame = 3
Query:  519 ELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSY----LITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLR-ISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRI 1070
            E +T+  T   L+ I R+          + L   +L+LND+ L       L   L +L  L+L  N L  I    F+  S +++L L   G + ++ IS++ F GL+ L+ L+L ++ I  +   M   F  +  L  L L  NP+ C+CHL W         E++  +  N    RC  P ++ + +I
Sbjct:  550 EGTTVDCTGRGLKEIPRD----------IPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQL---GENKIKEISNKMFLGLHQLKTLNLYDNQISCV---MPGSFEHLNSLTSLNLASNPFNCNCHLAWF-------AEWLRKKSLNGGAARCGAPSKVRDVQI 715          

HSP 5 Score: 53.5286 bits (127), Expect = 1.088e-6
Identity = 38/131 (29.01%), Postives = 64/131 (48.85%), Query Frame = 3
Query:  408 KSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLN------DCGF 782
            ++Q++ IP  +P  T  L +    I  I  E  +++  L+ L L+ + +  +    F NL+ L+ L +S NKL      L  + ++ L NL+ L L  N + M+P+  F+ L SL  + L       DCG 
Sbjct:  754 RNQLKEIPRGIPAETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITILSNYTFANLTKLSTLIISYNKL----QCLQRHALSGLNNLRVLSLHGNRISMLPEGSFEDLKSLTHIALGSNPLYCDCGL 880          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Fly
Match: kek6 (gene:FBgn0039862 transcript:FBtr0330107)

HSP 1 Score: 94.3597 bits (233), Expect = 2.659e-19
Identity = 91/345 (26.38%), Postives = 160/345 (46.38%), Query Frame = 3
Query:  372 TSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFK--NVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVV-LDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQNFTLKIN 1397
            T+ K+  +C     Q+  IPN L    ++L++   +IP +  E+F    +L L  + L  S ++ IH+ +F+NL  L  +DLS NKL + D    +++  +   L+ L L  NPLK +  + F  L  LR L ++DC    +   S A     +L  L+  N     +    E  F+ M  L+ L L ENPW C+C LR    +      ++  +L + V   CK P   ++ R    +D        F CP +    +   V  +D   +   +C  + DP+  V W  NG  ++     F+  +  ++  +S L + ++ S+D+G+++C   +   + T  I+
Sbjct:   47 TNGKKSAICS--SLQLTTIPNTLSTELQVLVLNDNHIPYLNREEFSTLGLLNLQRIYLKKSEVQYIHKESFRNLKILVEIDLSDNKLEMLDKD--TFMGND--RLRILYLNGNPLKRLAAYQFPILPHLRTLDMHDCLISYIDPMSLA-----NLNLLEFLNLKNNLLESLSEYVFQHMANLKTLSLEENPWQCNCKLRKFRGW------YVNSRL-SSVSLVCKGPPAQKD-RTWDSVDDEL-----FGCPPRVEIFNNEEVQNIDIGSNTTFSCLVYGDPLPEVAWELNGKILDNDNVLFESESIASDKLWSNLTVFNVTSLDAGTYACTGSNSIGSMTQNIS 367          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Zebrafish
Match: lrig2 (leucine-rich repeats and immunoglobulin-like domains 2 [Source:ZFIN;Acc:ZDB-GENE-041111-75])

HSP 1 Score: 98.2117 bits (243), Expect = 2.360e-20
Identity = 88/316 (27.85%), Postives = 143/316 (45.25%), Query Frame = 3
Query:  456 MLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKM-IPDF--FFKPLSSLRKLLLNDCGFDSLR-ISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVC---PIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPV--IWTKNGYKV-EETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            +L + Q NI +I+ + ++    L  L L+F++L R+    F  LS L  L+L  N++      L   + ++L N++ L + NN + + I DF   F  L  L  L+L +   + +R I+ RAF GL  LE LDL  +GI +I+      F  +K L+ L L  +  +CDC L+WL ++L      I  +        C  P  L    ++A       K  EFVC   P       P   V     ++ L C  FS    P+   W K+G  + E  V  +  +      + + LH+ ++   D G + C + + F
Sbjct:  223 ILRVNQNNIGLIRADAWEFCHRLEELDLSFNHLSRLEDWVFAGLSLLQSLNLGDNQI----SHLGEGVFSSLANVRTLDIRNNEISLAIEDFIGMFVGLKRLNSLVLQN---NKIRTITKRAFEGLMELENLDLSKNGIMSIHPDA---FTHLK-LKTLDLNSSSLLCDCQLQWLGQWL------INSRFQQSCTAVCAHPASLAGSSVLA------VKPEEFVCSDFPKPQITAHPKTAVALRGTNVTLNCSAFSSSDSPMSTAWRKDGEVLYEAQVQNYARYQDQRLLYTTILHLLNVNFTDEGQYQCVLSNHF 515          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 86.2705 bits (212), Expect = 7.946e-17
Identity = 97/424 (22.88%), Postives = 168/424 (39.62%), Query Frame = 3
Query:  321 SKDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLND-------------------------CGFDSLR--------------------ISSRAFHGLNSLEELDLRNSGIETINKTMESD---------------------FREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIW-TKNGYKVEETVNKFQI--FNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQNFT 1385
             ++AV        + + ++   RV+C   +  +E +P+ + + T  L + +  I VIK + FK++  L  L L+ + + +I   AF  L  L  L+L  N+L L    +PS     L  L+ L L NNP++ +P + F  + SLR+L L +                         CG   +                     I   +F GL SL +L L +S +  I +    D                     F  ++ L  + L  NPW+C+C + WL  +L E     T+  +     RC  P  L+  + I  +D++      F C        P ++ +    +  L C+  +  +  V W T NG  +     + +I   + G  NF + + +R     D+G ++C V +   N T
Sbjct:   30 GQEAVGAASTCPAVCSCSNQASRVICA--RQHLEEVPDNISNNTRYLNLQENTIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTL----VPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAFDDLKNLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKE-----TVPSNTTCCARCHAPPYLKG-KYIGELDQSH-----FTCYAPVIVEPPTDLNVTEGMAAELKCRTGTS-MTSVNWITPNGTLMTHGSYRVRISVLHDGTLNF-TNVTLR-----DTGQYTCMVTNSAGNTT 429          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 85.8853 bits (211), Expect = 9.377e-17
Identity = 98/424 (23.11%), Postives = 170/424 (40.09%), Query Frame = 3
Query:  321 SKDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLND-------------------------CG------------FDSLRISSR--------AFHGLNSLEELDLRNSGIETINKTMESD---------------------FREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIW-TKNGYKVEETVNKFQI--FNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQNFT 1385
             ++AV        + + ++   RV+C   +  +E +P+ + + T  L + +  I VIK + FK++  L  L L+ + + +I   AF  L  L  L+L  N+L L    +PS     L  L+ L L NNP++ +P + F  + SLR+L L +                         CG             + L +S          +F GL SL +L L +S +  I +    D                     F  ++ L  + L  NPW+C+C + WL  +L E     T+  +     RC  P  L+  + I  +D++      F C        P ++ +    +  L C+  +  +  V W T NG  +     + +I   + G  NF + + +R     D+G ++C V +   N T
Sbjct:   30 GQEAVGAASTCPAVCSCSNQASRVICA--RQHLEEVPDNISNNTRYLNLQENTIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTL----VPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAFDDLKNLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKE-----TVPSNTTCCARCHAPPYLKG-KYIGELDQSH-----FTCYAPVIVEPPTDLNVTEGMAAELKCRTGTS-MTSVNWITPNGTLMTHGSYRVRISVLHDGTLNF-TNVTLR-----DTGQYTCMVTNSAGNTT 429          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 85.8853 bits (211), Expect = 9.377e-17
Identity = 98/424 (23.11%), Postives = 170/424 (40.09%), Query Frame = 3
Query:  321 SKDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLND-------------------------CG------------FDSLRISSR--------AFHGLNSLEELDLRNSGIETINKTMESD---------------------FREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIW-TKNGYKVEETVNKFQI--FNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQNFT 1385
             ++AV        + + ++   RV+C   +  +E +P+ + + T  L + +  I VIK + FK++  L  L L+ + + +I   AF  L  L  L+L  N+L L    +PS     L  L+ L L NNP++ +P + F  + SLR+L L +                         CG             + L +S          +F GL SL +L L +S +  I +    D                     F  ++ L  + L  NPW+C+C + WL  +L E     T+  +     RC  P  L+  + I  +D++      F C        P ++ +    +  L C+  +  +  V W T NG  +     + +I   + G  NF + + +R     D+G ++C V +   N T
Sbjct:   30 GQEAVGAASTCPAVCSCSNQASRVICA--RQHLEEVPDNISNNTRYLNLQENTIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTL----VPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAFDDLKNLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKE-----TVPSNTTCCARCHAPPYLKG-KYIGELDQSH-----FTCYAPVIVEPPTDLNVTEGMAAELKCRTGTS-MTSVNWITPNGTLMTHGSYRVRISVLHDGTLNF-TNVTLR-----DTGQYTCMVTNSAGNTT 429          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Zebrafish
Match: lrrc4ba (leucine rich repeat containing 4Ba [Source:ZFIN;Acc:ZDB-GENE-080327-25])

HSP 1 Score: 86.2705 bits (212), Expect = 9.750e-17
Identity = 97/424 (22.88%), Postives = 168/424 (39.62%), Query Frame = 3
Query:  321 SKDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLND-------------------------CGFDSLR--------------------ISSRAFHGLNSLEELDLRNSGIETINKTMESD---------------------FREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIW-TKNGYKVEETVNKFQI--FNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQNFT 1385
             ++AV        + + ++   RV+C   +  +E +P+ + + T  L + +  I VIK + FK++  L  L L+ + + +I   AF  L  L  L+L  N+L L    +PS     L  L+ L L NNP++ +P + F  + SLR+L L +                         CG   +                     I   +F GL SL +L L +S +  I +    D                     F  ++ L  + L  NPW+C+C + WL  +L E     T+  +     RC  P  L+  + I  +D++      F C        P ++ +    +  L C+  +  +  V W T NG  +     + +I   + G  NF + + +R     D+G ++C V +   N T
Sbjct:   30 GQEAVGAASTCPAVCSCSNQASRVICA--RQHLEEVPDNISNNTRYLNLQENTIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLTL----VPSQAFEYLSKLRELWLRNNPIETLPGYAFHRVPSLRRLDLGELKKLDYISDAAFVGLINLRYLNLGMCGLKDIPNLTPLVRLEELELSGNRLEIIRPGSFQGLESLRKLWLMHSQMSVIERNAFDDLKNLEELNLSHNSLHSLPHDLFTPLQKLERVHLNHNPWVCNCDVLWLSWWLKE-----TVPSNTTCCARCHAPPYLKG-KYIGELDQSH-----FTCYAPVIVEPPTDLNVTEGMAAELKCRTGTS-MTSVNWITPNGTLMTHGSYRVRISVLHDGTLNF-TNVTLR-----DTGQYTCMVTNSAGNTT 429          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Xenopus
Match: lrrc4 (leucine rich repeat containing 4 [Source:NCBI gene;Acc:100493671])

HSP 1 Score: 91.2781 bits (225), Expect = 3.168e-18
Identity = 99/406 (24.38%), Postives = 161/406 (39.66%), Query Frame = 3
Query:  387 RVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLND-------------------------------------CGFDSLRISSR--------AFHGLNSLEELDLRNSGIETINKTMESD---------------------FREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLT------CKCFSDPIKPVIW-TKNGYKVEETVN--KFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQN 1379
            +V+C   +  +  +P  +P  T  L + + NI +I+ + F+++  L  L L  +++ +I   AF  L+ L  L+L  N L +    +PS     L  L+ L L NNP++ IP + F  + SL +L L +                                      G + L IS          +FHGL SL++L + NS I TI +    D                     F  +K L  L L  NPW CDC + WL  +L   +E+I    ++    RC  P  +   + +  +D +           +CS       ++D+ + LN++       KC +  +  V W   NG  +    N  +  I N G  NF   L        D+G ++C V +V  N
Sbjct:   52 KVVC--TRRGLSEVPQGIPSNTRSLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTV----IPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLYNLKYLNLGMCNIRDMPNLTPLVGLEELEISGNNFPEIKPGSFHGLRSLKKLWIMNSQINTIERNAFDDLTSLVELNLAHNNVTSLPHDLFAPLKYLVELHLHHNPWDCDCDVLWLSWWL---REYI--PTNSTCCGRCHSPPHMRG-KYVVEVDHSM---------FQCS----APFIMDAPRDLNISEGRMAELKCRTSAMSSVRWLLPNGTVLTHASNHPRITILNDGTLNFSQVL------LTDTGVYTCMVTNVAGN 426          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Xenopus
Match: rorc (RAR related orphan receptor C [Source:Xenbase;Acc:XB-GENE-481075])

HSP 1 Score: 90.1225 bits (222), Expect = 1.094e-17
Identity = 82/318 (25.79%), Postives = 138/318 (43.40%), Query Frame = 3
Query:  459 LIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVC---PIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVI--WTKNGYKVEETVNKFQI--FNSGNE------NFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            L+++  N+  + E    ++  L  L L+++++  I   AFK L  L IL+L  N++    +      I  L +L  L L  N +K                           ++ RAF G+ SLE L+L  + + +++      F EMK L+ L++G + ++CDCHL+WL ++L       + +L  KV   C  P  L N  I +   R+      FVC   P    RV P   +    K++  TC   S    P+   W K+     E ++  ++  F SG E       + + LH+R+L     G + C + + F
Sbjct:  299 LVLSHNNLTRLDEGSLADLGVLDVLRLSYNSISHIAEGAFKGLKSLRILELDHNEISGTIEDTNGAFI-GLESLNKLTLFGNKIK--------------------------SVAKRAFSGIESLEHLNLGENALRSVHSEA---FGEMKNLKELVVGSSSFLCDCHLKWLPQWL------TSRRLQTKVKASCAHPGSLNNTSIFSVPPRS------FVCDDLPKPQIRVQPETTMAVLGKAIRFTCSAASSSPSPMTFAWKKD----NEILHNAEVENFASGTEREGEVTEYTTILHLRNLTFAHEGRYQCIITNDF 570          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Xenopus
Match: rorc (RAR related orphan receptor C [Source:Xenbase;Acc:XB-GENE-481075])

HSP 1 Score: 88.5817 bits (218), Expect = 2.368e-17
Identity = 82/318 (25.79%), Postives = 138/318 (43.40%), Query Frame = 3
Query:  459 LIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVC---PIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVI--WTKNGYKVEETVNKFQI--FNSGNE------NFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            L+++  N+  + E    ++  L  L L+++++  I   AFK L  L IL+L  N++    +      I  L +L  L L  N +K                           ++ RAF G+ SLE L+L  + + +++      F EMK L+ L++G + ++CDCHL+WL ++L       + +L  KV   C  P  L N  I +   R+      FVC   P    RV P   +    K++  TC   S    P+   W K+     E ++  ++  F SG E       + + LH+R+L     G + C + + F
Sbjct:  274 LVLSHNNLTRLDEGSLADLGVLDVLRLSYNSISHIAEGAFKGLKSLRILELDHNEISGTIEDTNGAFI-GLESLNKLTLFGNKIK--------------------------SVAKRAFSGIESLEHLNLGENALRSVHSEA---FGEMKNLKELVVGSSSFLCDCHLKWLPQWL------TSRRLQTKVKASCAHPGSLNNTSIFSVPPRS------FVCDDLPKPQIRVQPETTMAVLGKAIRFTCSAASSSPSPMTFAWKKD----NEILHNAEVENFASGTEREGEVTEYTTILHLRNLTFAHEGRYQCIITNDF 545          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Xenopus
Match: rorc (RAR related orphan receptor C [Source:Xenbase;Acc:XB-GENE-481075])

HSP 1 Score: 88.5817 bits (218), Expect = 2.426e-17
Identity = 81/316 (25.63%), Postives = 136/316 (43.04%), Query Frame = 3
Query:  459 LIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVC---PIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVI--WTKNGYKVEETVNKFQIFNSGNE------NFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            L+++  N+  + E    ++  L  L L+++++  I   AFK L  L IL+L  N++    +      I  L +L  L L  N +K                           ++ RAF G+ SLE L+L  + + +++      F EMK L+ L++G + ++CDCHL+WL ++L       + +L  KV   C  P  L N  I +   R+      FVC   P    RV P   +    K++  TC   S    P+   W K+   +     + + F SG E       + + LH+R+L     G + C + + F
Sbjct:  299 LVLSHNNLTRLDEGSLADLGVLDVLRLSYNSISHIAEGAFKGLKSLRILELDHNEISGTIEDTNGAFI-GLESLNKLTLFGNKIK--------------------------SVAKRAFSGIESLEHLNLGENALRSVHSEA---FGEMKNLKELVVGSSSFLCDCHLKWLPQWL------TSRRLQTKVKASCAHPGSLNNTSIFSVPPRS------FVCDDLPKPQIRVQPETTMAVLGKAIRFTCSAASSSPSPMTFAWKKDNEILHNA--EVENFASGTEREGEVTEYTTILHLRNLTFAHEGRYQCIITNDF 570          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Xenopus
Match: rorc (RAR related orphan receptor C [Source:Xenbase;Acc:XB-GENE-481075])

HSP 1 Score: 88.5817 bits (218), Expect = 2.450e-17
Identity = 82/318 (25.79%), Postives = 138/318 (43.40%), Query Frame = 3
Query:  459 LIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVC---PIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVI--WTKNGYKVEETVNKFQI--FNSGNE------NFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            L+++  N+  + E    ++  L  L L+++++  I   AFK L  L IL+L  N++    +      I  L +L  L L  N +K                           ++ RAF G+ SLE L+L  + + +++      F EMK L+ L++G + ++CDCHL+WL ++L       + +L  KV   C  P  L N  I +   R+      FVC   P    RV P   +    K++  TC   S    P+   W K+     E ++  ++  F SG E       + + LH+R+L     G + C + + F
Sbjct:  274 LVLSHNNLTRLDEGSLADLGVLDVLRLSYNSISHIAEGAFKGLKSLRILELDHNEISGTIEDTNGAFI-GLESLNKLTLFGNKIK--------------------------SVAKRAFSGIESLEHLNLGENALRSVHS---EAFGEMKNLKELVVGSSSFLCDCHLKWLPQWL------TSRRLQTKVKASCAHPGSLNNTSIFSVPPRS------FVCDDLPKPQIRVQPETTMAVLGKAIRFTCSAASSSPSPMTFAWKKD----NEILHNAEVENFASGTEREGEVTEYTTILHLRNLTFAHEGRYQCIITNDF 545          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Mouse
Match: Lrig2 (leucine-rich repeats and immunoglobulin-like domains 2 [Source:MGI Symbol;Acc:MGI:2443718])

HSP 1 Score: 90.8929 bits (224), Expect = 4.972e-18
Identity = 91/316 (28.80%), Postives = 147/316 (46.52%), Query Frame = 3
Query:  453 EMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLK-MIPDF--FFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPV--IWTKNG---YKVE-ETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            + L ++Q  I  I  + ++    LS L L+++ L R+  +AF  LS L  L+L  N++    D +  +L     NL+ L L NN +   I D    F  L SL KL+L      S  ++ +AF GL SLE LDL N+ I +I    E+ F +   L+ L+L  +  +CDCHL+WL ++L      +     + V   C  P+ L    I+  +D       +F+ P    R  P + +     ++ LTC   S    P+  IW K+    Y V+ E   +++  +     + S L + S+   D G + C V + F
Sbjct:  289 QQLYMSQNAIEKISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFL----SNLQTLDLRNNDISWAIEDASEAFSGLKSLTKLILQGNRIKS--VTQKAFIGLESLEYLDLNNNAIMSIQ---ENAFSQTH-LKGLVLNTSSLLCDCHLKWLLQWL------VDNNFHHSVNVSCAHPEWLAGQSIL-NVDLKDFVCDDFLKPQI--RTHPESTIALRGVNVTLTCTAVSSSDSPMSTIWRKDSEILYDVDIENFVRYRQQDGEALEYTSVLRLFSVNFTDEGKYQCIVTNHF 585          

HSP 2 Score: 53.1434 bits (126), Expect = 2.037e-6
Identity = 52/187 (27.81%), Postives = 88/187 (47.06%), Query Frame = 3
Query:  411 SQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLI---------LNDDSLPSYL-----------ITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPL 911
            ++I     P P+ T +L +    IP I  E F+    L +L L+ + +  I  ++F  +S L  L+LS N++          L+D  L   L           +  L +L+ L+L  N +K++    F+ L SLR L +   G   L+    AF GLN++EEL+L ++ +  +NK      R ++ L
Sbjct:  109 TEIPYFGEPTPNIT-LLSLVHNLIPEINAEAFELYSALESLDLSSNIISEIKTSSFPRMS-LKYLNLSNNRISTLEAGCFDNLSDSLLVVKLNRNRISMIPPKVFKLPHLQFLELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLK--DGAFFGLNNMEELELEHNNLTGVNKGWLYGLRMLQQL 291          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Mouse
Match: Lrig2 (leucine-rich repeats and immunoglobulin-like domains 2 [Source:MGI Symbol;Acc:MGI:2443718])

HSP 1 Score: 90.5077 bits (223), Expect = 5.483e-18
Identity = 91/316 (28.80%), Postives = 147/316 (46.52%), Query Frame = 3
Query:  453 EMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLK-MIPDF--FFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPV--IWTKNG---YKVE-ETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            + L ++Q  I  I  + ++    LS L L+++ L R+  +AF  LS L  L+L  N++    D +  +L     NL+ L L NN +   I D    F  L SL KL+L      S  ++ +AF GL SLE LDL N+ I +I    E+ F +   L+ L+L  +  +CDCHL+WL ++L      +     + V   C  P+ L    I+  +D       +F+ P    R  P + +     ++ LTC   S    P+  IW K+    Y V+ E   +++  +     + S L + S+   D G + C V + F
Sbjct:  289 QQLYMSQNAIEKISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFL----SNLQTLDLRNNDISWAIEDASEAFSGLKSLTKLILQGNRIKS--VTQKAFIGLESLEYLDLNNNAIMSIQ---ENAFSQTH-LKGLVLNTSSLLCDCHLKWLLQWL------VDNNFHHSVNVSCAHPEWLAGQSIL-NVDLKDFVCDDFLKPQI--RTHPESTIALRGVNVTLTCTAVSSSDSPMSTIWRKDSEILYDVDIENFVRYRQQDGEALEYTSVLRLFSVNFTDEGKYQCIVTNHF 585          

HSP 2 Score: 52.7582 bits (125), Expect = 2.610e-6
Identity = 52/187 (27.81%), Postives = 88/187 (47.06%), Query Frame = 3
Query:  411 SQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLI---------LNDDSLPSYL-----------ITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPL 911
            ++I     P P+ T +L +    IP I  E F+    L +L L+ + +  I  ++F  +S L  L+LS N++          L+D  L   L           +  L +L+ L+L  N +K++    F+ L SLR L +   G   L+    AF GLN++EEL+L ++ +  +NK      R ++ L
Sbjct:  109 TEIPYFGEPTPNIT-LLSLVHNLIPEINAEAFELYSALESLDLSSNIISEIKTSSFPRMS-LKYLNLSNNRISTLEAGCFDNLSDSLLVVKLNRNRISMIPPKVFKLPHLQFLELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLK--DGAFFGLNNMEELELEHNNLTGVNKGWLYGLRMLQQL 291          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Mouse
Match: Lrrc4 (leucine rich repeat containing 4 [Source:MGI Symbol;Acc:MGI:2182081])

HSP 1 Score: 88.5817 bits (218), Expect = 1.476e-17
Identity = 96/406 (23.65%), Postives = 162/406 (39.90%), Query Frame = 3
Query:  387 RVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLND-------------------------------------CGFDSLRISSR--------AFHGLNSLEELDLRNSGIETINKTMESDFREM------------------KPLRVLL---LGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLT------CKCFSDPIKPVIW-TKNGYKVEETVN--KFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQN 1379
            +V+C   +  +  +P  +P  T  L + + NI +I+ + F+++  L  L L  +++ +I   AF  L+ L  L+L  N L +    +PS     L  L+ L L NNP++ IP + F  + SL +L L +                                      G + L +S          +FHGL+SL++L + NS +  I +        +                   PLR L+   L  NPW CDC + WL  +L   +E+I    ++    RC  P  +   R +  +D+            +CS       ++D+ + LN++       KC + P+  V W   NG  +       +  + N G  NF   L I      D+G ++C V +V  N
Sbjct:   57 KVVCT--RRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTV----IPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWL---REYI--PTNSTCCGRCHAPMHMRG-RYLVEVDQ---------AAFQCS----APFIMDAPRDLNISEDRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSRVLLI------DTGVYTCMVTNVAGN 431          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Mouse
Match: Lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:MGI Symbol;Acc:MGI:2443955])

HSP 1 Score: 88.5817 bits (218), Expect = 2.517e-17
Identity = 89/319 (27.90%), Postives = 138/319 (43.26%), Query Frame = 3
Query:  459 LIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLK-MIPDF--FFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGE--IQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVC---PIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVI--WTKNGYKVE--ETVNKFQIFNSGNE--NFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            L ++Q  I  I  + ++   +LS L LTF++L R+  ++F  LS L  L +  NK+    D         L +LK L L NN +   I D    F  L  LR+L+L   G     I+ +AF GL++LE LDL  + I ++       F +MK L+ L L  +  +CDC LRWL +++ E   Q F        V   C  P+ L+   I             FVC   P     V P          ++ TC   S    P+   W K+   ++  E  N   +   G E   + + L +R+++    G + C + + F
Sbjct:  292 LHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNALHIGNNKVSYIADCA----FRGLTSLKTLDLRNNEISWTIEDMSGAFSGLDRLRQLILQ--GNRIRSITKKAFAGLDTLEHLDLSGNAIMSLQSNA---FSQMKKLQQLHLNTSSLLCDCQLRWLPQWVAENNFQSF--------VNASCAHPQLLKGRSIFTVSPDG------FVCDDFPKPQITVQPETQSAIKGSDVSFTCSAASSSDSPMTFAWKKDNEALQDAEMENYAHLRAQGGELMEYTTILRLRNVEFTSEGKYQCVISNHF 587          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Mouse
Match: Slit1 (slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:1315203])

HSP 1 Score: 87.8113 bits (216), Expect = 4.483e-17
Identity = 66/193 (34.20%), Postives = 91/193 (47.15%), Query Frame = 3
Query:  411 SQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISS---RAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYL 980
            + ++ IP  +P  TE L +   NI  I + DF  + +L  L L  + +  + R AF ++  L  L L+ N+L +    LP  L  N   L  L L+ N L+ +P   F+  + L+ L L     D  RIS     AF  L  LE L L N+ I TI     S F  M  LR   L  N   CDCHL WL ++L
Sbjct:   50 TGLQAIPKNIPRNTERLELNGNNITRIHKNDFAGLKQLRVLQLMENQIGAVERGAFDDMKELERLRLNRNQLQV----LPELLFQNNQALSRLDLSENFLQAVPRKAFRGATDLKNLQL-----DKNRISCIEEGAFRALRGLEVLTLNNNNITTIPV---SSFNHMPKLRTFRLHSNHLFCDCHLAWLSQWL 230          

HSP 2 Score: 65.0846 bits (157), Expect = 4.737e-10
Identity = 64/225 (28.44%), Postives = 104/225 (46.22%), Query Frame = 3
Query:  522 LSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPG--NVVLDSEKSLNLTC 1190
            ++ + L  + ++ I   AF     L  +DLS N++      +       L +L  L L  N +  +P   F  L +L+ LLLN    + +R    AF  L +L  L L ++ I+++ K     F  ++ ++ L L +NP+ICDC+L+WL        +F+        G RC  P+RL N RI       Q K  +F C  K     PG  +  L+SE + ++ C
Sbjct:  311 MTEIRLELNGIKSIPPGAFSPYRKLRRIDLSNNQIA----EIAPDAFQGLRSLNSLVLYGNKITDLPRGVFGGLYTLQLLLLNANKINCIR--PDAFQDLQNLSLLSLYDNKIQSLAK---GTFTSLRAIQTLHLAQNPFICDCNLKWL-------ADFLRTNPIETTGARCASPRRLANKRI------GQIKSKKFRCSAKEQYFIPGTEDYHLNSECTSDVAC 513          

HSP 3 Score: 58.9214 bits (141), Expect = 3.368e-8
Identity = 50/160 (31.25%), Postives = 77/160 (48.12%), Query Frame = 3
Query:  576 FKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRL 1055
            FK LS+L  ++LS NK+   +D           ++  L LT N L+ I    F+ L  LR L+L +       I + +F GL ++  L L ++ I TI+      F  ++ L  L L  NP+ C+CHL WL  +L   ++ +T        PRC+ P  L
Sbjct:  561 FKKLSHLKKINLSNNKVSEIEDGT----FEGAASVSELHLTANQLESIRSGMFRGLDGLRTLMLRNNRISC--IHNDSFTGLRNVRLLSLYDNHITTISP---GAFDTLQALSTLNLLANPFNCNCHLSWLGDWL-RKRKIVTGN------PRCQNPDFL 704          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. UniProt/SwissProt
Match: sp|O94898|LRIG2_HUMAN (Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Homo sapiens OX=9606 GN=LRIG2 PE=2 SV=3)

HSP 1 Score: 97.8265 bits (242), Expect = 2.476e-19
Identity = 93/317 (29.34%), Postives = 149/317 (47.00%), Query Frame = 3
Query:  453 EMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLK-MIPDF--FFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPV--IWTKNG---YKVEETVNKFQIFNSGNE--NFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            + L ++Q  I  I  + ++    LS L L+++ L R+  +AF  LS L  L+L  N++    D +  +L     NL+ L L NN +   I D    F  L+SL KL+L      S  I+ +AF GL SLE LDL N+ I +I    E+ F +   L+ L+L  +  +CDCHL+WL ++L      +     + V   C  P+ L    I+  +D       +F+ P    R  P  ++     ++ LTC   S    P+  +W K+    Y V +T N  + +    E   + S LH+ ++   D G + C V + F
Sbjct:  290 QQLYVSQNAIERISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFL----SNLQTLDLRNNEISWAIEDASEAFAGLTSLTKLILQGNQIKS--ITKKAFIGLESLEHLDLNNNAIMSIQ---ENAFSQTH-LKELILNTSSLLCDCHLKWLLQWL------VDNNFQHSVNVSCAHPEWLAGQSIL-NVDLKDFVCDDFLKPQI--RTHPETIIALRGMNVTLTCTAVSSSDSPMSTVWRKDSEILYDV-DTENFVRYWQQAGEALEYTSILHLFNVNFTDEGKYQCIVTNHF 586          

HSP 2 Score: 54.299 bits (129), Expect = 6.224e-6
Identity = 54/187 (28.88%), Postives = 91/187 (48.66%), Query Frame = 3
Query:  399 GDPKSQI---ELIPNPLPD----------ATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSY-LTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRV 917
            G+P S I    L+ N +P+          A E L ++   I  IK   F   ++L  L+L+ + +  +    F NLS  L ++ L+ N++     S+    I  L +L+ L+L  N +K++    F+ L SLR L +   G   L+    AF GLN++EEL+L ++ +  +NK      R ++ L V
Sbjct:  116 GEPTSNITLLSLVHNIIPEINAQALQFYPALESLDLSSNIISEIKTSSFPR-MQLKYLNLSNNRITTLEAGCFDNLSSSLLVVKLNRNRM-----SMIPPKIFKLPHLQFLELKRNRIKIVEGLTFQGLDSLRSLKMQRNGISKLK--DGAFFGLNNMEELELEHNNLTRVNKGWLYGLRMLQQLYV 294          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. UniProt/SwissProt
Match: sp|P24014|SLIT_DROME (Protein slit OS=Drosophila melanogaster OX=7227 GN=sli PE=1 SV=2)

HSP 1 Score: 95.9005 bits (237), Expect = 1.079e-18
Identity = 67/217 (30.88%), Postives = 108/217 (49.77%), Query Frame = 3
Query:  426 IPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGP--RCKQPKRLENYRI 1070
            +P  +    E L +   N+ VI E DF+ + +L  L LT + +  I RN+F++L  L  L L+ N+L     ++P   +T+  +L  L ++NN +  +    FK   SLR L L++     L     AF GL  LE L L N+ + ++   +   F  +  LR L L +NP+ CDCHL WL R+         L+   ++ P  RC+ P +L+   +
Sbjct:   94 VPRKISADVERLELQGNNLTVIYETDFQRLTKLRMLQLTDNQIHTIERNSFQDLVSLERLRLNNNRL----KAIPENFVTSSASLLRLDISNNVITTVGRRVFKGAQSLRSLQLDNNQITCL--DEHAFKGLVELEILTLNNNNLTSLPHNI---FGGLGRLRALRLSDNPFACDCHLSWLSRF---------LRSATRLAPYTRCQSPSQLKGQNV 292          

HSP 2 Score: 63.929 bits (154), Expect = 6.963e-9
Identity = 67/215 (31.16%), Postives = 96/215 (44.65%), Query Frame = 3
Query:  426 IPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRI 1070
            +P  LPD T  L + Q  I  +  + F +   L  + L+ +N+ RI  +A   L  LT L L GNK+                            K +P   FK L SL+ LLLN      +R    AF  L+SL  L L ++ I+++       F  MK ++ + L +NP+ICDC+LRWL  YL +             G RC+ PKR+   RI
Sbjct:  340 VPVTLPDDTTELRLEQNFITELPPKSFSSFRRLRRIDLSNNNISRIAHDALSGLKQLTTLVLYGNKI----------------------------KDLPSGVFKGLGSLQLLLLNANEISCIR--KDAFRDLHSLSLLSLYDNNIQSL---ANGTFDAMKSIKTVHLAKNPFICDCNLRWLADYLHK-------NPIETSGARCESPKRMHRRRI 514          

HSP 3 Score: 60.8474 bits (146), Expect = 6.153e-8
Identity = 50/186 (26.88%), Postives = 80/186 (43.01%), Query Frame = 3
Query:  519 ELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIA 1076
            E S L L  + +E+IH    ++L  LT LDLS N++ +    L +Y   NL  L  L ++ N L+ +                             A  GLN+L  L L  + I  +    E  F ++K L  + LG NP  CDC L+W         ++I L        RC +P+++++  I++
Sbjct:  767 ETSELYLESNEIEQIHYERIRHLRSLTRLDLSNNQITI----LSNYTFANLTKLSTLIISYNKLQCL--------------------------QRHALSGLNNLRVLSLHGNRISML---PEGSFEDLKSLTHIALGSNPLYCDCGLKWF-------SDWIKLDYVEPGIARCAEPEQMKDKLILS 912          

HSP 4 Score: 55.4546 bits (132), Expect = 2.498e-6
Identity = 52/189 (27.51%), Postives = 87/189 (46.03%), Query Frame = 3
Query:  519 ELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSY----LITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLR-ISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRI 1070
            E +T+  T   L+ I R+          + L   +L+LND+ L       L   L +L  L+L  N L  I    F+  S +++L L   G + ++ IS++ F GL+ L+ L+L ++ I  +   M   F  +  L  L L  NP+ C+CHL W         E++  +  N    RC  P ++ + +I
Sbjct:  550 EGTTVDCTGRGLKEIPRD----------IPLHTTELLLNDNELGRISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQL---GENKIKEISNKMFLGLHQLKTLNLYDNQISCV---MPGSFEHLNSLTSLNLASNPFNCNCHLAWF-------AEWLRKKSLNGGAARCGAPSKVRDVQI 715          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. UniProt/SwissProt
Match: sp|Q52KR2|LRIG2_MOUSE (Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus OX=10090 GN=Lrig2 PE=1 SV=1)

HSP 1 Score: 90.5077 bits (223), Expect = 3.835e-17
Identity = 91/316 (28.80%), Postives = 147/316 (46.52%), Query Frame = 3
Query:  453 EMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLK-MIPDF--FFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPV--IWTKNG---YKVE-ETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            + L ++Q  I  I  + ++    LS L L+++ L R+  +AF  LS L  L+L  N++    D +  +L     NL+ L L NN +   I D    F  L SL KL+L      S  ++ +AF GL SLE LDL N+ I +I    E+ F +   L+ L+L  +  +CDCHL+WL ++L      +     + V   C  P+ L    I+  +D       +F+ P    R  P + +     ++ LTC   S    P+  IW K+    Y V+ E   +++  +     + S L + S+   D G + C V + F
Sbjct:  289 QQLYMSQNAIEKISPDAWEFCQRLSELDLSYNQLTRLDESAFVGLSLLERLNLGDNRVTHIADGVFRFL----SNLQTLDLRNNDISWAIEDASEAFSGLKSLTKLILQGNRIKS--VTQKAFIGLESLEYLDLNNNAIMSIQ---ENAFSQTH-LKGLVLNTSSLLCDCHLKWLLQWL------VDNNFHHSVNVSCAHPEWLAGQSIL-NVDLKDFVCDDFLKPQI--RTHPESTIALRGVNVTLTCTAVSSSDSPMSTIWRKDSEILYDVDIENFVRYRQQDGEALEYTSVLRLFSVNFTDEGKYQCIVTNHF 585          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. UniProt/SwissProt
Match: sp|Q99PH1|LRRC4_MOUSE (Leucine-rich repeat-containing protein 4 OS=Mus musculus OX=10090 GN=Lrrc4 PE=1 SV=2)

HSP 1 Score: 88.5817 bits (218), Expect = 1.032e-16
Identity = 96/406 (23.65%), Postives = 162/406 (39.90%), Query Frame = 3
Query:  387 RVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLND-------------------------------------CGFDSLRISSR--------AFHGLNSLEELDLRNSGIETINKTMESDFREM------------------KPLRVLL---LGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLT------CKCFSDPIKPVIW-TKNGYKVEETVN--KFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQN 1379
            +V+C   +  +  +P  +P  T  L + + NI +I+ + F+++  L  L L  +++ +I   AF  L+ L  L+L  N L +    +PS     L  L+ L L NNP++ IP + F  + SL +L L +                                      G + L +S          +FHGL+SL++L + NS +  I +        +                   PLR L+   L  NPW CDC + WL  +L   +E+I    ++    RC  P  +   R +  +D+            +CS       ++D+ + LN++       KC + P+  V W   NG  +       +  + N G  NF   L I      D+G ++C V +V  N
Sbjct:   57 KVVCT--RRGLSEVPQGIPSNTRYLNLMENNIQMIQADTFRHLHHLEVLQLGRNSIRQIEVGAFNGLASLNTLELFDNWLTV----IPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLFNLKYLNLGMCNIKDMPNLTPLVGLEELEMSGNHFPEIRPGSFHGLSSLKKLWVMNSQVSLIERNAFDGLASLVELNLAHNNLSSLPHDLFTPLRYLVELHLHHNPWNCDCDILWLAWWL---REYI--PTNSTCCGRCHAPMHMRG-RYLVEVDQ---------AAFQCS----APFIMDAPRDLNISEDRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSRVLLI------DTGVYTCMVTNVAGN 431          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. UniProt/SwissProt
Match: sp|Q6P1C6|LRIG3_MOUSE (Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus OX=10090 GN=Lrig3 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 1.761e-16
Identity = 89/319 (27.90%), Postives = 138/319 (43.26%), Query Frame = 3
Query:  459 LIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLK-MIPDF--FFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGE--IQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVC---PIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVI--WTKNGYKVE--ETVNKFQIFNSGNE--NFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            L ++Q  I  I  + ++   +LS L LTF++L R+  ++F  LS L  L +  NK+    D         L +LK L L NN +   I D    F  L  LR+L+L   G     I+ +AF GL++LE LDL  + I ++       F +MK L+ L L  +  +CDC LRWL +++ E   Q F        V   C  P+ L+   I             FVC   P     V P          ++ TC   S    P+   W K+   ++  E  N   +   G E   + + L +R+++    G + C + + F
Sbjct:  292 LHLSQNAINRISPDAWEFCQKLSELDLTFNHLSRLDDSSFLGLSLLNALHIGNNKVSYIADCA----FRGLTSLKTLDLRNNEISWTIEDMSGAFSGLDRLRQLILQ--GNRIRSITKKAFAGLDTLEHLDLSGNAIMSLQSNA---FSQMKKLQQLHLNTSSLLCDCQLRWLPQWVAENNFQSF--------VNASCAHPQLLKGRSIFTVSPDG------FVCDDFPKPQITVQPETQSAIKGSDVSFTCSAASSSDSPMTFAWKKDNEALQDAEMENYAHLRAQGGELMEYTTILRLRNVEFTSEGKYQCVISNHF 587          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. TrEMBL
Match: A0A3S5CDM6 (Ig-like domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS5876 PE=4 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 1.866e-37
Identity = 105/356 (29.49%), Postives = 180/356 (50.56%), Query Frame = 3
Query:  336 AIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSS--LRKLLLNDC-GFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRY--------LGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKC--FSDPIKPVIWTKNGYKVEETVNKFQI-FNSGNENFYSTLHIRSLKSVDSGSWSCRV 1361
            A+KGC + L++P    ++ +C    + +  IP+ LP+    L I +Q +  +  E  +++ +L +L +  S LE I    F  +  L  L L  N + L  + L    I  L++L+ L LT NPL  +PD FF+ L+   LR+L L     F++  +   +   L+ LEE+DL  + ++T+++++      M  L++LLLG+NPW CDCHLRWL  +        +    +  +  +  +  P C+ P  L    I      ++ +  +F CP    RV   + V+ +    N+T +C  F+DP + V+W K+G  V+    +     N  N NF + L I  L++ D+G+W CR+
Sbjct:   96 AVKGCSI-LLDPEMRWKKAICDSTPATLTTIPDDLPNNLVDLQILRQVVRHLNRESLRSLSQLESLVIESSQLESIEPGTFSGMPRLKRLILRNNSIHLGPNGLSGGAIKGLLHLEELDLTLNPLGRLPDDFFEGLAGGRLRRLKLGHVKSFEAFHLEPNSLAPLSRLEEIDLTAARMQTLHESLGRCLSGMPDLKLLLLGKNPWHCDCHLRWLKVWNMIYNRTSVMYHPDSASSDIAAEFEPVCQTPAELRGKSIFPRPGADEIRLSDFYCP---PRVFSRDTVVKAGLGSNVTLRCDFFADPAETVVWLKDGLVVKAHWERVVTQVNRANRNFSTVLQITDLQARDTGNWECRI 447          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. TrEMBL
Match: A0A0R3T0J2 (Ig-like domain-containing protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS338 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 5.967e-37
Identity = 112/373 (30.03%), Postives = 187/373 (50.13%), Query Frame = 3
Query:  318 ISKDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDS----LRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYR-YLGEIQEFITLQLDNK--------VGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQNFTLKIN 1397
            +++ A A++GC V  + P  L ++ +C    S +  IP+ LP+    L ITQQ+I  + + + + ++ L  L L    LE++  N F+ L+ L IL L  N + L+++ +      +L  L+ L L+ NPL  IP   F P++  + LL     +      L++ + AF GL +L+ LD+    +ET++    S F  M+ LR L LG NPW CDC LRWL   YL +    +TL  D K        V P CK P  ++  +I A   RN  +  EFVC  +       ++V+    +L+LTC+ + + +K V W K+   +      + +  S + +F + L I +++  D G W C +++   +    IN
Sbjct:   20 LARTANAVRGCTVIAIQPDLLWKKAVCDSDTSLLTKIPSDLPETLISLRITQQSIRRLDDGELRKLVYLEELYLDSCELEQVEANVFEGLNRLRILSLRNNSIRLDENGILPVSFYHLPTLEVLDLSENPLGQIPPNLF-PIALGKSLLELRISYTKGELPLKLEAAAFTGLLNLQVLDMSFCRLETLSSEFRSIFHRMEKLRELQLGGNPWHCDCSLRWLREWYLSDTLPSMTLSFDKKTKFGATDIVTPTCKSPYVVKRRQIFAPSGRNAIEPAEFVCK-QWIDSKEKHIVVALGTTLSLTCQGYFESMKTVQWFKDNVPLVIPSPNYFVSQSNSLDFVANLTIMNVRREDKGIWECGLDNGSASQKASIN 390          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. TrEMBL
Match: A0A3P7NYU0 (Ig-like domain-containing protein (Fragment) OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS6577 PE=4 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 9.503e-37
Identity = 120/380 (31.58%), Postives = 178/380 (46.84%), Query Frame = 3
Query:  330 AVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFF-----KPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLY-RYLGEIQEFITLQLDNK--------VGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRV-EDVFQ-----NFTLKINPNSI 1409
             VA++GC V  + P    ++ +C    S +  +P  LP+    L ITQQNI  + +   K ++ L  L +  S LE++  NAF+ L+ L IL L  N L +++ +L S    +L +L+ L L+ NPL  IP  FF     K L  LR  L +  G  +L I   AF  L  L  LDL  +G  ++     S F  M+ LR L LG NPW+CDC LRWL   YL +    +      K        V P C +P  +   +I         K  EF+C    S      V +  + +++L C  +SD    V W KN   + +   ++  F   +  F +TLHI ++   D+G W C + ED  Q     N T+K+   S+
Sbjct:   22 VVAVRGCTVIAIQPDLRWKKAICDSTTSLLTSLPLDLPEMLINLRITQQNIRQLNDNVLKKLIYLEELCVESSGLEQVDVNAFRGLTRLKILSLRNNSLRIDEGNLLSATFHHLPSLEILDLSYNPLGFIPPNFFPASVGKTLKELR--LEHTNGDGALNIDVSAFFFLEQLRVLDLSFAGFRSLPVDFRSVFARMENLRELQLGGNPWVCDCTLRWLKDWYLTDAPPSMRFSYTRKTLQETHVNVAPTCSEPYSVHGKQIFGSSGPKTIKLEEFLCKQWISS-KVKTVSVPEQSNVSLKCHGYSDTPVNVQWFKNKNILTKLPRRYSRFQINSPEFQATLHISNVAKEDAGFWECALGEDGGQQRASINLTVKLADGSL 398          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. TrEMBL
Match: A0A564YF30 (Ig-like domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS5803 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 6.283e-36
Identity = 116/375 (30.93%), Postives = 185/375 (49.33%), Query Frame = 3
Query:  321 SKDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLL-----NDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYR-YLGEIQEFITLQLD--------NKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKC-SRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVED--VFQNFTLKI 1394
            +K   A++GC V  + P  L ++ +C    S +  IP+ LP+    L I+QQ+I  + + + + ++ L  L L   +LE++  N F+ L+ L IL L  N + L++         +L  L+ L L+ NPL  IP  FF   S+L K LL     +  G   L+I +    GL +L+ LD+    +ET++    S F  M+ LR L LG NPW CDC+LRWL   YL +    + L  D        N V P CK P  ++  +I     R   +  EF+C     S+    N VL S  +L+ TC+ + + +K V W KN   +      + I  S + +F + L I +++  D+G W C ++D  V Q  ++ +
Sbjct:   17 AKTVNAVRGCTVIAIQPDLLWKKAVCDSDTSLLTKIPSDLPETLVSLRISQQSIRRLDDGELRTLVYLEELYLDSCDLEQVDINVFEGLNRLRILSLRNNSIRLDEKGFLPATFYHLPTLEILDLSENPLGRIPSNFFP--SALGKSLLELRISHIKGESPLKIEAATIAGLRNLQVLDMSFCRLETLSSEFRSVFHRMEKLRELQLGGNPWHCDCNLRWLREWYLADTLPSMVLSYDQTTKFGTTNIVTPTCKSPYVVKRRQIFIPSGRGAIEPAEFICKQWIDSKEKHINAVLGS--NLSFTCQGYFESMKAVQWFKNHLPLVTPSPNYIISQSNSLDFVANLTITNVRYEDAGIWECGLDDGSVLQKASINV 387          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. TrEMBL
Match: A0A0R3SWV5 (Ig-like domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS10185 PE=4 SV=1)

HSP 1 Score: 158.688 bits (400), Expect = 7.603e-36
Identity = 116/375 (30.93%), Postives = 185/375 (49.33%), Query Frame = 3
Query:  321 SKDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLL-----NDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYR-YLGEIQEFITLQLD--------NKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKC-SRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVED--VFQNFTLKI 1394
            +K   A++GC V  + P  L ++ +C    S +  IP+ LP+    L I+QQ+I  + + + + ++ L  L L   +LE++  N F+ L+ L IL L  N + L++         +L  L+ L L+ NPL  IP  FF   S+L K LL     +  G   L+I +    GL +L+ LD+    +ET++    S F  M+ LR L LG NPW CDC+LRWL   YL +    + L  D        N V P CK P  ++  +I     R   +  EF+C     S+    N VL S  +L+ TC+ + + +K V W KN   +      + I  S + +F + L I +++  D+G W C ++D  V Q  ++ +
Sbjct:   21 AKTVNAVRGCTVIAIQPDLLWKKAVCDSDTSLLTKIPSDLPETLVSLRISQQSIRRLDDGELRTLVYLEELYLDSCDLEQVDINVFEGLNRLRILSLRNNSIRLDEKGFLPATFYHLPTLEILDLSENPLGRIPSNFFP--SALGKSLLELRISHIKGESPLKIEAATIAGLRNLQVLDMSFCRLETLSSEFRSVFHRMEKLRELQLGGNPWHCDCNLRWLREWYLADTLPSMVLSYDQTTKFGTTNIVTPTCKSPYVVKRRQIFIPSGRGAIEPAEFICKQWIDSKEKHINAVLGS--NLSFTCQGYFESMKAVQWFKNHLPLVTPSPNYIISQSNSLDFVANLTITNVRYEDAGIWECGLDDGSVLQKASINV 391          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Cavefish
Match: lrrc4.2 (leucine rich repeat containing 4.2 [Source:ZFIN;Acc:ZDB-GENE-030131-7997])

HSP 1 Score: 87.8113 bits (216), Expect = 2.148e-17
Identity = 96/406 (23.65%), Postives = 165/406 (40.64%), Query Frame = 3
Query:  387 RVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLND-------------------------------------CGFDSLRISSR--------AFHGLNSLEELDLRNSGIETINKTMESDFREM------------------KPLRVLL---LGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTC------KCFSDPIKPVIW-TKNGYKVEETVN--KFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQN 1379
            +V+C   +  +  +P+ +P  T  L + + +I +I+ + F+++  L  L L  +++ +I   AF  L+ L  L+L  N+L +    +PS     L  L+ L L NNP++ IP + F  + SL +L L +                                      G + L +S          +F GL SL++L + NS I T+ +    D   +                   PL  L+   L  NPW CDC + WL  +L   +E+I    ++    RC  P  L   R +  +D+            +CS       +LD+ + LN++       KC + P+  V W   NG  +    N  +  + N G  NF + L      + D+G ++C V ++  N
Sbjct:   52 KVVCT--RRSLVRVPSGIPANTRHLNLMENSIEIIQADTFRHLHHLEVLQLGRNSIRKIEVGAFNGLTNLNTLELFDNRLTV----IPSGAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLMRLDLGELKKLEYISEGAFEGLYNLKYLNLGMCNLREMPVLSPLVGLEELEMSENYFPEIKPGSFRGLKSLKKLWIMNSRITTMERNAFDDVTALVELNLAHNNLSSLPHDLFAPLSYLVELHLHHNPWRCDCDVVWLAWWL---REYI--PTNSTCCGRCHTPAHLRG-RYLVEVDQTT---------FQCS----APFILDAPRDLNISAERVAELKCRTAPMSSVRWLLPNGTVLTHGSNHPRIYVLNDGTLNFSNVL------ASDTGVYTCMVTNMAGN 426          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Cavefish
Match: lrig1 (leucine rich repeats and immunoglobulin like domains 1 [Source:NCBI gene;Acc:103023104])

HSP 1 Score: 86.6557 bits (213), Expect = 6.438e-17
Identity = 88/338 (26.04%), Postives = 143/338 (42.31%), Query Frame = 3
Query:  453 EMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNK-------------------LILNDDS-LPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVC---PIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFN--------SGNENFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            E+L + + NI  + +  F  +  + TL L +++L+ ++  +   L  L  L LS N                    L+ N+ S L       LVNL+ L+L++N +  I +  F+ LSSLR L L      S  ++ RAF GL  LE L+L  + I +I   +   F +MK LR L +  + ++CDC L W   ++      +   L  +V   C  P+ L+   I       Q     FVC   P     V P        K + LTC   S    P+ +T    K +E + + ++ N         G   + + LH+R +     G + C + + F
Sbjct:  233 EVLKLQRNNISKLTDGAFWGLARMRTLHLDYNSLKEVNSGSLYGLESLLYLHLSNNSISSFNPEGWGFCERLRELHLVHNNLSKLTEGSFAKLVNLQTLRLSHNTISHIAEGAFRGLSSLRLLTLFGNRIKS--VAKRAFLGLEGLEHLNLGENSIRSI---LPEAFSKMKNLRSLEILSDSFLCDCQLHWFPEWV------VNRGLQAEVQATCAHPESLKGTSIF------QVPAQSFVCDDLPKPQITVHPVQTAGVVGKDVRLTCTAASSSSSPMTFTWR--KDQEPLRQAEVENFAHVRSSDGGVMEYTTVLHLRDITFDHEGRYQCVISNHF 551          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Cavefish
Match: lrig1 (leucine rich repeats and immunoglobulin like domains 1 [Source:NCBI gene;Acc:103023104])

HSP 1 Score: 86.2705 bits (212), Expect = 9.351e-17
Identity = 92/363 (25.34%), Postives = 148/363 (40.77%), Query Frame = 3
Query:  453 EMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNK-------------------LILNDDS-LPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLND--------------CGFDSLR-----------ISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVC---PIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFN--------SGNENFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            E+L + + NI  + +  F  +  + TL L +++L+ ++  +   L  L  L LS N                    L+ N+ S L       LVNL+ L+L++N +  I +  F+ LSSLR L L+                G DSLR           ++ RAF GL  LE L+L  + I +I   +   F +MK LR L +  + ++CDC L W   ++      +   L  +V   C  P+ L+   I       Q     FVC   P     V P        K + LTC   S    P+ +T    K +E + + ++ N         G   + + LH+R +     G + C + + F
Sbjct:  233 EVLKLQRNNISKLTDGAFWGLARMRTLHLDYNSLKEVNSGSLYGLESLLYLHLSNNSISSFNPEGWGFCERLRELHLVHNNLSKLTEGSFAKLVNLQTLRLSHNTISHIAEGAFRGLSSLRLLELDHNDISGTIEDTNGAFAGLDSLRKLTLFGNRIKSVAKRAFLGLEGLEHLNLGENSIRSI---LPEAFSKMKNLRSLEILSDSFLCDCQLHWFPEWV------VNRGLQAEVQATCAHPESLKGTSIF------QVPAQSFVCDDLPKPQITVHPVQTAGVVGKDVRLTCTAASSSSSPMTFTWR--KDQEPLRQAEVENFAHVRSSDGGVMEYTTVLHLRDITFDHEGRYQCVISNHF 578          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Cavefish
Match: lrrc4cb (leucine-rich repeat-containing protein 4C-like [Source:NCBI gene;Acc:103034014])

HSP 1 Score: 85.1149 bits (209), Expect = 1.488e-16
Identity = 97/405 (23.95%), Postives = 165/405 (40.74%), Query Frame = 3
Query:  387 RVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLN---------DCGFDSLR------------------------------------ISSRAFHGLNSLEELDLRNSGIETINKTMESDFREM------------------KPLRVLL---LGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIW-TKNGYKVEETVNKFQIF--NSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQNFTLKI 1394
            +V+C   +  +  +P+ +   T  L +    I VIK + FK++  L  L L+ +++  I   AF  L+ L  L+L  N+L     ++P+     L  LK L L NNP++ IP + F  L SLR+L L          D  F+ L                                     I   +F GL  L +L + ++ ++ I +    D + +                   PLR L    L  NPW C+C + WL  +L E     T+  +     RC  P  L+  R I  +D++   Y +   P+     SP ++ +    ++ L  KC ++ +  V W T NG  +    +K ++   N G  NF       S+   D G+++C+V ++  N +  +
Sbjct:   60 KVIC--TRRGLREVPDGISTNTRYLNLQDNLIQVIKVDSFKHLRHLEILQLSKNHIRNIEIGAFNGLTNLNTLELFDNRLT----TIPNGAFEYLSKLKELWLRNNPIESIPSYAFNRLPSLRRLDLGELKRLSYVSDGAFEGLGNLRYLNLGMCNLKEVPNIQPLVRLDELEMSGNQLTVIRPGSFKGLVHLHKLWMMHAQVQIIERNSFDDLQSLGELNLAHNNLTFVPHDLFTPLRHLQRVHLHHNPWNCNCDILWLSWWLRE-----TVPTNTSCCARCYSPPSLKG-RYIGELDQS---YFQCYAPVIVE--SPADLNVTEGTAVEL--KCRTNSLTSVSWLTPNGSVLTHGASKGRVTVQNDGTLNF------TSVTMQDMGTYTCKVSNMLGNVSASV 439          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Cavefish
Match: lrit2 (leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 [Source:NCBI gene;Acc:103045557])

HSP 1 Score: 83.9593 bits (206), Expect = 3.251e-16
Identity = 95/363 (26.17%), Postives = 155/363 (42.70%), Query Frame = 3
Query:  321 SKDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLL-LGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKY---VEFVCPIKCSRVSP-GNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQNFTLKI 1394
            S D   + GC  T    +   R +LC +  + +  IP  +P+    + I + ++  I +  F     L  L L F+++  I+  + + L+ LT L L GNKL     S+P     +  +LK L L +N L ++P+   K L  L  L   D  F+ L + S+         ++ L+    + + K+ E   RE  P  V+L L ENPW CDC LR    ++  +   I L               + +Y   +G +    K+   VE    IK    SP  N+ +    ++ LTC   + P +P +W   G K+    ++ Q      E   S L I SL   D G ++C   +   N ++ I
Sbjct:   22 SNDVQCLAGCSCTT---SRQGRSLLCME--TPLSRIPEDIPEDFTKIRIEKSHLTEIPKSAFSRYKSLENLWLNFNDITIINIKSLQGLNNLTELRLEGNKL----SSVPWTAFEDAPSLKILDLKHNRLDVLPEHALKFLPGLTYL---DLSFNQLTVISK---------DVFLKWPLYDRVFKSAE---RETVPTNVVLALHENPWQCDCRLRGFVEFVMSLSPPIIL---------------MNSYLSCSGPEYMAGKFFHEVELKTCIKPVATSPTTNISMPLGANVTLTCFAMARP-EPAVWWTYGLKILRGFHELQT-RVNEETVKSELIIPSLHLADRGVYTCTANNFIGNSSVSI 343          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Sea Lamprey
Match: lrrn1 (leucine rich repeat neuronal 1 [Source:ZFIN;Acc:ZDB-GENE-071126-1])

HSP 1 Score: 81.6481 bits (200), Expect = 2.087e-16
Identity = 75/309 (24.27%), Postives = 134/309 (43.37%), Query Frame = 3
Query:  453 EMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIW-TKNGYKVEETVN-------KFQIFNSGNENFYSTLHIRSLKSVDSGSWSC 1355
            E+L+I +  I  +   +F+ +  L +L L  + L  +   A   L  L  L L  N L    +++P   + +L  LK L L  NP++ I D  F+ + +L++L  N+       +   AF  L  LE L L + G+  +++   +  R ++ LR + L  NP  CDC  RW+         F+  +       RC  P  LE  R+    D   ++  +   P+  +   P  + + S   + L C+  ++P   + W T  G KV    +       K+Q+   G      TL + ++   ++G ++C
Sbjct:  169 EVLMIGENPIVGVAPANFRPLANLRSLVLAGTGLAHVPGEALLGLEKLESLSLYDNLL----EAVPRAALRHLPALKFLDLNKNPVRQIRDGDFRDMLNLKELGTNNPKLAF--VHRDAFDRLPRLESLMLNDDGLGALHR---ATVRSLRSLREISLHGNPLRCDCVNRWMGAGNRGAVRFLEPE-----SMRCAAPPELEGRRV---RDVAFAETADSCLPLIAAGTFPARLNVPSGARVRLACRAIAEPEADIYWVTPRGDKVAPAASRSDAPLVKYQLGPEG------TLEVAAIAVEEAGLYTC 454          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Sea Lamprey
Match: lrig3 (leucine-rich repeats and immunoglobulin-like domains 3 [Source:NCBI gene;Acc:564554])

HSP 1 Score: 77.0258 bits (188), Expect = 8.195e-15
Identity = 80/316 (25.32%), Postives = 128/316 (40.51%), Query Frame = 3
Query:  459 LIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVC---PIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPV--IWTKN------GYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVF 1373
            L ++   +  + E  F  +  L +LSL  + +  I   AF+ LS L ILDL GN++        S+ + ++                    F  LS+L KL L+     S  I+ +AF GL  L +LDL  + I +I     + F  +K L  + L  +  +CDC L+WL  +L E            V   C  P  L+   +++    N      FVC   P     V P         +++  C   S    PV  +W K+      G +VE  + + +    G   F S LH+R++     G + C + + F
Sbjct:  144 LDLSHNGLTRLNEAAFVELGALQSLSLAHNAISHIVEGAFRGLSSLRILDLGGNQI--------SWTVEDMQGA-----------------FTGLSALSKLSLHGNQIKS--IAKKAFVGLERLGQLDLMGNAIVSIQA---NAFNTLKLLHQMKLNTSELLCDCQLKWLPGWLTE------RGFAQSVAVACAHPAWLKGRSVLSVRQEN------FVCDDYPKPHMVVHPETRAAVRGSNVSFMCSAASSSESPVTFLWRKDNAPLAVGAEVER-LERARPAGGGLGEFTSYLHLRTVDFHHEGRYQCVISNSF 416          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000078.1 (pep scaffold:Pmarinus_7.0:GL476403:206014:206980:-1 gene:ENSPMAG00000000071.1 transcript:ENSPMAT00000000078.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.1738 bits (178), Expect = 3.080e-14
Identity = 51/153 (33.33%), Postives = 76/153 (49.67%), Query Frame = 3
Query:  522 LSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYL 980
            L  L L  + + RI    F  L+YL+ L L GN  IL D S+ +   + L +L  L L  N L  +P     P+  L+KL+L D      R+    F+GL  L+ +DL  +G+ +++   +  F  ++ L  L    NPW CDC L WL  +L
Sbjct:  157 LEELRLDDNRISRIPDRIFGQLTYLSRLALDGN--ILGDASISASSFSGLPSLTELSLARNVLTTVPTHL--PMLGLQKLILQDNQIS--RLPPGVFYGLKQLQRIDLSGNGLRSLS---QGSFNGLESLSHLSACNNPWHCDCGLTWLRNWL 300          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Sea Lamprey
Match: islr2 (immunoglobulin superfamily containing leucine-rich repeat 2 [Source:ZFIN;Acc:ZDB-GENE-050320-95])

HSP 1 Score: 72.0182 bits (175), Expect = 4.229e-13
Identity = 79/295 (26.78%), Postives = 127/295 (43.05%), Query Frame = 3
Query:  522 LSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPG--NVVLDSEKSLNLTCKCFSDPIKPVIWT--KNGYKV------------EETVNKFQIFNSGNENFY-STLHIRSLKSVDSGSWSC 1355
            +++LSL+ + L  + R+AF+ +  ++ L LS N+L+    S+    +  LV L++L L+NN L        + L++L+ L LN+     +R+   AF  L  L  L L ++   TI    E  F  +  L  LLL ENP  C C  RWL  +L       ++ + +K    C +P  L+   +       Q   VE V P      SP      L S+ ++ L C+    P   V W   K G ++            E  V    + +     F   TL I  L   + G+++C
Sbjct:   56 ITSLSLSANRLRSLSRDAFEEIPLMSSLWLSHNELV----SIEKGTLAGLVQLRNLDLSNNQLADFSWEDLRNLTALQVLKLNNNNL--VRLPRDAFETLTDLRSLRLHHNLFATIE---EGTFENLHALSHLLLYENPLRCSCKARWLPAWL----NTTSIDIPSKENIACAEPDELKGQAV------QQMPDVECVAPTVRLSSSPDVRETRLYSDFAVVLDCQADGLPAPTVSWKLRKEGGEIDLGVFDEEKVPEEAVVETNDVLDKRVMAFRNGTLVIPQLSESEEGAYTC 331          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000079.1 (pep scaffold:Pmarinus_7.0:GL476403:206014:206980:-1 gene:ENSPMAG00000000071.1 transcript:ENSPMAT00000000079.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 8.964e-13
Identity = 56/191 (29.32%), Postives = 85/191 (44.50%), Query Frame = 3
Query:  414 QIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLER--IHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYL 980
            Q+E  P  LP     L + + NI V+     +    L  L L  +++    I    F     L +L LS N L      LP         L+ L+L +N +  IPD  F  L+ L +L L+D      R+    F+GL  L+ +DL  +G+ +++   +  F  ++ L  L    NPW CDC L WL  +L
Sbjct:   74 QLEEFPAHLPPNLRELHLQENNIEVVPGAVLERTPFLEKLHLNDNSVSSAGIEPATFHGTPRLKLLFLSRNHLSSVPRGLPR-------GLEELRLDDNRISRIPDRIFGQLTYLSRLALDDNQIS--RLPPGVFYGLKQLQRIDLSGNGLRSLS---QGSFNGLESLSHLSACNNPWHCDCGLTWLRNWL 252          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Nematostella
Match: EDO35407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLJ8])

HSP 1 Score: 67.3958 bits (163), Expect = 3.396e-12
Identity = 48/157 (30.57%), Postives = 84/157 (53.50%), Query Frame = 3
Query:  465 ITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGEN 935
            +++  + ++K   F++   L  L L+ +++  I    F+NL YL  L+L  NK+     ++ + +   LV+L+ L L  N LK +P   FKPL SLR+L L+D      RI   AF+GL++L +L +  +G++ I +        ++ L VL +  N
Sbjct:    1 VSRSPLKLLKNTSFQDYQYLKWLDLSNNDISDIQDGTFENLRYLKQLNLGENKI----RTVSASMFKGLVSLEKLDLRFNDLKALPRGVFKPLKSLRELFLHDNRNMGSRIEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLMSLEFLDVLHINNN 153          

HSP 2 Score: 51.2174 bits (121), Expect = 8.330e-7
Identity = 56/208 (26.92%), Postives = 86/208 (41.35%), Query Frame = 3
Query:  453 EMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKL--------LLNDCGFDSLR-----------------ISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFI 1001
            + L + +  I  +    FK ++ L  L L F++L+ + R  FK L  L  L L  N+ +     +       L NL+ L ++   +K I    F  L SL  L         L      +LR                 +SS AF   + L++L L N+ I  I+   E  F ++K LR L L  NP+ CDC L   + +L   Q  +
Sbjct:   45 KQLNLGENKIRTVSASMFKGLVSLEKLDLRFNDLKALPRGVFKPLKSLRELFLHDNRNM--GSRIEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLMSLEFLDVLHINNNSLTTVPLHALRKVKFLKELDLSANLISYVSSTAFANNSKLQKLLLHNNTIRLIH---EDAFSQLKGLRALFLRGNPFQCDCQLNGFHAWLRNNQYLV 247          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Nematostella
Match: EDO47109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNB0])

HSP 1 Score: 59.6918 bits (143), Expect = 3.877e-9
Identity = 78/326 (23.93%), Postives = 128/326 (39.26%), Query Frame = 3
Query:  453 EMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLI---------------------------------------LNDDSLPSYLITNL--VNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSL---NLTCKCFSDPIKPVIWTKNG----YKVEETVNKFQIFNSG 1286
            + L +    + V+  E F+ + +L  LSL  +++  I   AF+  ++L  LD+S N+L                                        L D+ L  + +     ++L+ L+L  N L  IP+ F K    L++L ++  G     I+S     L+++E LDL  +    I+K      R MK LR + L  NP  CDC L WL   L   Q+   L L +     C  P  ++    + G+D        F+C       +    V +SE+     N +C+C ++      W  N         E VN F  + +G
Sbjct:  123 KTLTLNSNRLEVVYAETFRGLRDLRYLSLRHNSIRTIGDGAFRFSAFLICLDISFNRLSEFKTETLRGLSSTLTELRLRSNILRRVAIKRRFNITLLDLGDNLLEVFEVDAFDGLSLRKLRLDGNKLDEIPEAFAKVGHFLQELDMS--GNYLHEITSDQLLDLHAIERLDLNEN---NISKIRIGALRGMKKLRQISLSGNPLSCDCRLVWLKHVLDSRQD--QLHLSSPQSTTCASPASVKGQTFL-GLDARS-----FLC-------TCAQCVAESERCFGRQNTSCRCDTE------WRGNTCTNICARGEIVNTFCAYIAG 422          

HSP 2 Score: 48.9062 bits (115), Expect = 8.368e-6
Identity = 43/149 (28.86%), Postives = 72/149 (48.32%), Query Frame = 3
Query:  411 SQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSL-RISSRAFHGLNS-LEELDLRN 851
            + ++ IP  LP     L +   +I  ++ + F N L L  L L+ + L  I    FK+L  L  L L+ N+L    + + +     L +L++L L +N ++ I D  F+  S+   L+  D  F+ L    +    GL+S L EL LR+
Sbjct:   61 ATLQTIPTSLPRNLGSLFLNTNHIRALQAKAFANYLSLRVLDLSNNELSVIANGTFKSLGKLKTLTLNSNRL----EVVYAETFRGLRDLRYLSLRHNSIRTIGDGAFR-FSAF--LICLDISFNRLSEFKTETLRGLSSTLTELRLRS 202          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Nematostella
Match: EDO27257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9R6])

HSP 1 Score: 54.6842 bits (130), Expect = 1.975e-8
Identity = 49/172 (28.49%), Postives = 86/172 (50.00%), Query Frame = 3
Query:  489 IKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKL-ILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFI 1001
            I+E  F  +  L  L ++ + +++I +  F +L  L  LD+S N++   +++SL    +     L+ L + NN L  +P    + +  L++L L+        +SS AF   + L++L L N+ I  I+   E  F ++K LR L L  NP+ CDC L   + +L   Q  +
Sbjct:    1 IEEGAFNGLDNLRKLHVSATGMKKITQGTFGSLMSLEFLDVSFNEIRHFDEESLACLPL-----LEVLHINNNSLTTVPLHALRKVKFLKELDLSANLIS--YVSSTAFANNSKLQKLLLHNNTIRLIH---EDAFSQLKGLRALFLRGNPFQCDCQLNGFHAWLRNNQYLV 162          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Nematostella
Match: EDO48179 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK32])

HSP 1 Score: 55.0694 bits (131), Expect = 1.572e-7
Identity = 52/195 (26.67%), Postives = 93/195 (47.69%), Query Frame = 3
Query:  480 IPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFF---FKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRL 1055
            I   K  D+++   L  L+L  + L  I    FK+L  L +L+L+ N++      +     ++L +L+ L L+NN +    +     F+ L++L  L L+  G     I++ AF GL +++ L+L  + I +I    E+ F+ M  L+ L L  +  +CDC ++W   +L            + V  RC  P+ L
Sbjct:  334 IITTKFADWRSFPVLRKLNLERNRLSHIQDTTFKHLLALKVLNLANNRIY----HISQGSFSDLRSLEGLDLSNNDISWTVEEMNGPFRGLTNLASLRLD--GNRITAIAATAFLGLENIKYLNLSANIITSI---QENSFQGMDKLQKLWLNTSQLMCDCKIKWFGSWLRSRPS-----TRHTVRARCLHPQTL 514          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Nematostella
Match: EDO43258 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZD5])

HSP 1 Score: 54.299 bits (129), Expect = 2.065e-7
Identity = 33/91 (36.26%), Postives = 52/91 (57.14%), Query Frame = 3
Query:  498 EDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLN 770
            +  K +  L  L+L F+ + ++ RNAF  L  L  L+L GNKL     S+P+  I +L+ L+ L+L  NP+++I D  FK L  L ++ L 
Sbjct:  100 DGLKALSRLQHLNLNFNRISKVPRNAFNKLRLLVELNLRGNKL----KSIPTSAINDLMRLQQLELDGNPIRVIKDHAFKGLFRLTEIALG 186          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Medaka
Match: ENSORLT00000019143.2 (leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 3 [Source:NCBI gene;Acc:101172023])

HSP 1 Score: 88.5817 bits (218), Expect = 1.032e-17
Identity = 78/311 (25.08%), Postives = 145/311 (46.62%), Query Frame = 3
Query:  477 NIPVIKEEDFKNVLELSTLSLT-FSNLERIHRNAFK--NLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCP---IKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYK--VEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQNFT 1385
            +I  +++++F+ +  L  L +  +  LE I   +F+  +L +L+I +        N  S+PS    N+V+L HL L+ NP+  +  + FK L  L++L++   G   + +   A  GL  +  L+  ++ ++T+    ES F  +  L  L + ENP +CDC L W+      +Q   TL  D +V P C  P  ++   + A  D   + +  F C    I+  ++    VV +  ++++  C+   +P   ++W     +    +T  +  +  SG      TL IR  K  D+G++ C   +   N T
Sbjct:  226 SIIALEDQNFRKLYSLRGLEIDHWPYLEYISPLSFQGLDLHWLSITNT-------NITSVPSSSFKNMVHLTHLNLSYNPITTLEPWAFKDLLRLKELIMVSTGL--VTVGPHALGGLRQIRVLNFSSNDLQTLE---ESSFHSVNSLETLRVDENPLLCDCRLLWI------LQRRKTLNFDGRV-PVCAGPVEVQGVSLSAFTD--SALFDHFTCQKPRIRNRKMQ--KVVANEGQAVSFLCRADGEPTPAIVWISPQRRRITSKTPGRITVLPSG------TLEIRFAKLTDTGTYICIASNAGGNDT 507          

HSP 2 Score: 60.077 bits (144), Expect = 9.501e-9
Identity = 46/164 (28.05%), Postives = 80/164 (48.78%), Query Frame = 3
Query:  426 IPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRV 917
            IP  +P  T +L +++  +  ++  D      L  + L+ + +  +  NAF  L  L +L L GN+L L    +P      L NL  L L+ N + ++ D+ F+ L +L+ L + D   D + IS +AF GL  LE+L +    + +I+    S  R +  L +
Sbjct:   65 IPEGIPTETRLLDLSRNRLRWVQAGDLSPYPRLEEVDLSENLIATLEPNAFSALQNLKVLKLRGNQLKL----VPMGAFAKLGNLTSLDLSENKMVILLDYTFQDLRNLKHLEVGDN--DLVYISHKAFSGLLGLEDLTIERCNLTSISGQTLSYLRSLVTLHL 222          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Medaka
Match: ENSORLT00000000072.2 (pep primary_assembly:ASM223467v1:1:1576629:1604541:-1 gene:ENSORLG00000000055.2 transcript:ENSORLT00000000072.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 82.4185 bits (202), Expect = 3.406e-16
Identity = 61/188 (32.45%), Postives = 84/188 (44.68%), Query Frame = 3
Query:  417 IELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYL 980
            I+ +P  +P  TE L +   N+ VI + D   +  L  L L  + +  I R AF  L  L  L L+ N+L      LP  L      L  L L+ N ++ +P   F+  + L+ L L+        +   AF  L SLE L L N+ I +I     S F  M  LR   L  N   CDCHL WL  +L
Sbjct:   63 IQSVPKNIPRGTERLDLNGNNLTVITKSDLSGLRHLRVLHLMENQISNIERGAFDELKELERLRLNRNRL----SQLPELLFQKNEALSRLDLSENRIQAVPRRAFRGAADLKNLQLDKNHISC--VEEGAFRALRSLEVLTLNNNNISSIPV---SSFNHMPKLRTFRLHSNSLRCDCHLAWLSPWL 241          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Medaka
Match: lrrc4ba (leucine rich repeat containing 4B [Source:NCBI gene;Acc:101164310])

HSP 1 Score: 83.9593 bits (206), Expect = 4.171e-16
Identity = 94/402 (23.38%), Postives = 159/402 (39.55%), Query Frame = 3
Query:  387 RVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLND-------------------------CGFDSLR--------------------ISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRV---------------------LLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIW-TKNGYKVEETVNKFQI--FNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQNFT 1385
            RV+C   +  +E +P  +   T  L + + +I VIK + FK++  L  L L+ + + +I   AF  L  L  L+L  N+L      +PSY    L  L+ L L NNP++ +P + F  + SLR+L L +                         CG   +                     I   +F GL +L +L L +S +  I +    D + ++ L +                     + L  NPW+C+C + WL  +L E     T+  +     RC  P  L+  + I  +D++      F C        P ++ +    +  L C+  S     V W T NG  +     + +I   + G  NF + + +R     D+G ++C V +   N T
Sbjct:   52 RVIC--TRQNLEQVPESISVNTRYLNLQENSIQVIKSDTFKHLRHLEILQLSKNQIRQIEVGAFNGLPNLNTLELFDNRLT----QVPSYAFEYLSKLRELWLRNNPIEDLPGYAFNRVPSLRRLDLGELKKLDFISDAAFVGLVNLRYLNLGMCGLKDIPKLTALERLEELELSGNRLEIIRPGSFQGLGALRKLWLMHSQVSVIERNAFDDLKNLEELNLSHNSLHSLPHDLFTPLHQLERVHLNHNPWVCNCDVLWLSWWLKE-----TVPSNTTCCARCHAPPILKG-KYIGELDQSH-----FTCYAPVIVEPPTDLNVTEGMAAELKCRT-STSTTSVNWITPNGTLMTHGSYRVRISVLHDGTLNF-TNVTLR-----DTGQYTCMVTNAAGNTT 429          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Medaka
Match: lrrc4.2 (leucine rich repeat containing 4 [Source:NCBI gene;Acc:101167534])

HSP 1 Score: 83.5741 bits (205), Expect = 4.923e-16
Identity = 95/406 (23.40%), Postives = 160/406 (39.41%), Query Frame = 3
Query:  387 RVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLND-------------------------------------CGFDSLRISSR--------AFHGLNSLEELDLRNSGIETINKTMESDFREM------------------KPLRVLL---LGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTC------KCFSDPIKPVIW-TKNGYKVEETVN--KFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQN 1379
            +V+C   +  I + PN +P  T  L + + +I  I+ + F+++  L  L L  + + +I   AF  L+ L  L+L  N+L +    +PS     L  L+ L L NNP+  IP + F  + SL +L L +                                      G + L IS          AFHGL +L +L + NS I TI +    D   +                   PL+ L+   L  NPW CDC + WL  +L E      +  ++    RC  P  +    +   ++ +Q+ +       +CS       +LD+ + LN++       +C +  +  V W   NG  +       +  + N G  NF + L        D+G ++C V ++  N
Sbjct:   58 KVVCTR-RGLIRVPPN-IPTNTRYLNLMENSIETIEADTFRHLRHLEVLQLGRNAIRQIEVGAFNGLASLNTLELFDNRLTV----IPSGAFEYLSKLRELWLRNNPIDSIPSYAFNRVPSLMRLDLGELRRLEYISEGAFEGLHNLKYLNLGMCNLRELPHLSPLVGLEELEISDNVFPELKPWAFHGLKNLRKLWIMNSAITTIERNAFDDITALVELNLAHNNLSSLPHNLFTPLQYLVELHLHHNPWSCDCDVVWLSAWLRE-----NIPTNSTCCGRCHTPIHIRGRHL---VEIDQTTF-------QCS----APFILDAPRDLNISAARVAELRCRTAAMSSVRWLLPNGTVLTHGSAHPRISVLNDGTLNFSNVL------PSDTGIYTCMVSNMAGN 432          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Medaka
Match: lrrc4cb (leucine rich repeat containing 4C [Source:NCBI gene;Acc:101160634])

HSP 1 Score: 82.4185 bits (202), Expect = 1.071e-15
Identity = 92/402 (22.89%), Postives = 158/402 (39.30%), Query Frame = 3
Query:  387 RVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKL---------LLNDCGFDSLR------------------------------------ISSRAFHGLNSLEELDLRNSGIETINKTMESD---------------------FREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIW-TKNGYKVEETVNKFQ--IFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQNFT 1385
            +V+C   +  +  +P+ +   T  L +    I VIK + FK++  L  L L+ +++  I   AF  L+ L  L+L  N+L     ++P+     L  LK L L NNP++ IP + F  + SLR+L          +++  F  L                                     I   +F GL +L++L + +S ++TI +    D                     F  +  L  + L  NPW C+C + WL  +L E     T+  +     RC  P   +  R I  +D +      F C +      P +  L+  + +    KC ++ +  + W T NG  V     K +  + N G  NF       S+   D+G+++C V +   N +
Sbjct:   60 KVIC--TRRSLRDVPDGISTNTRYLNLQDNLIQVIKVDSFKHLRHLEILQLSKNHIRSIEIGAFNGLASLNTLELFDNRL----TTIPNGAFEYLSKLKELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLSYISELAFKDLSNLRYLNLGMCNLKEIPNIIPLVKLEELEMSGNQLTVIKPSSFTGLANLQKLWMMHSQVQTIERNSFDDLQSLVELNLAHNNLTFLPHDLFTPLHHLERVHLHHNPWNCNCDILWLSWWLKE-----TVPANTSCCARCHTPSVFKG-RYIGELDHSY-----FQCDVPVIVEPPSD--LNVTEGMGAELKCRTNSMTSISWLTPNGSMVTHGAYKVRLSVLNDGTLNF------TSVTMQDTGTYTCMVSNTAGNIS 436          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Planmine SMEST
Match: SMESG000023338.1 (SMESG000023338.1)

HSP 1 Score: 1499.57 bits (3881), Expect = 0.000e+0
Identity = 788/790 (99.75%), Postives = 789/790 (99.87%), Query Frame = 3
Query:  270 MRLAHYXXXXXXXXXXISKDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVEDVFQNFTLKINPNSIFPMAASLNVYXXXXXXXXXXXXXXXXXXXXXXCKRDSLCQYRSQNPMVICGYESQIRKPSGYDGDVQFTYSQQDGRFHSSFYENSIPVNSNFSLYQRANVYNEEPNLDKSRLHEPDSKPSLLINTKNSNNEKMLNIYCGCHNYSIFNSDDEPNLDPMTESFTYNSKSLKQILEPNRKPVNFESTKLERNFQTMPVKSSTEIEKLLPKIRQCPFHGSSATLTRVPGDKPCPVHGSTATLPSRLSSKKIEHRHGCPKHDKDNISVKSLKLDSSGHGKIQAHRSKSVNKISSNPDKVEIVTPPGYRPCPLHGDILAAITENLTDTKTNCQKLNQRKDVLSKKSHSKIVHESNLKIPPNDCDTLNRKPVVEPIKNRCDYFPVTSSSISHNFXXXXXXXXXXXXXXXXDVHGTLV 2639
            MRLAHYSLLFSLLLNFISKDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRV+DVFQNFTLKINPNSIFPMAASLNVYIFVGLGSSLLLISLIVVMMVMFCKRDSLCQYRSQNPMVICGYESQIRKPSGYDGDVQFTYSQQDGRFHSSFYENSIPVNSNFSLYQRANVYNEEPNLDKSRLHEPDSKPSLLINTKNSNNEKMLNIYCGCHNYSIFNSDDEPNLDPMTESFTYNSKSLKQILEPNRKPVNFEST LERNFQTMPVKSSTEIEKLLPKIRQCPFHGSSATLTRVPGDKPCPVHGSTATLPSRLSSKKIEHRHGCPKHDKDNISVKSLKLDSSGHGKIQAHRSKSVNKISSNPDKVEIVTPPGYRPCPLHGDILAAITENLTDTKTNCQKLNQRKDVLSKKSHSKIVHESNLKIPPNDCDTLNRKPVVEPIKNRCDYFPVTSSSISHNFTSPVQSSLSSSPLLTSDVHGTLV
Sbjct:    1 MRLAHYSLLFSLLLNFISKDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRVDDVFQNFTLKINPNSIFPMAASLNVYIFVGLGSSLLLISLIVVMMVMFCKRDSLCQYRSQNPMVICGYESQIRKPSGYDGDVQFTYSQQDGRFHSSFYENSIPVNSNFSLYQRANVYNEEPNLDKSRLHEPDSKPSLLINTKNSNNEKMLNIYCGCHNYSIFNSDDEPNLDPMTESFTYNSKSLKQILEPNRKPVNFESTNLERNFQTMPVKSSTEIEKLLPKIRQCPFHGSSATLTRVPGDKPCPVHGSTATLPSRLSSKKIEHRHGCPKHDKDNISVKSLKLDSSGHGKIQAHRSKSVNKISSNPDKVEIVTPPGYRPCPLHGDILAAITENLTDTKTNCQKLNQRKDVLSKKSHSKIVHESNLKIPPNDCDTLNRKPVVEPIKNRCDYFPVTSSSISHNFTSPVQSSLSSSPLLTSDVHGTLV 790          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Planmine SMEST
Match: SMESG000058478.1 (SMESG000058478.1)

HSP 1 Score: 156.377 bits (394), Expect = 4.361e-39
Identity = 110/383 (28.72%), Postives = 180/383 (47.00%), Query Frame = 3
Query:  324 KDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRY---LGEIQEFITLQLDNK----VGPRCKQPKRLENYRIIA-GIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSC----RVEDVFQNFTLKINPNSIFPMAASLNV 1436
            K + ++ GCV  ++     +++ +C   +++   IP+ LPD  E L +  QNI  +  +    V  L  L+L  + L  I  +AF N+  L  L L  N LIL  +S PS  +  L +LK L L NNPL  +PDFFF+PL  L KL+L+    +   +   +  GL SLE LD+  S +  +++ + S    M+       G N W CDC+L+WL ++     +++ F      N     + P+C  P + + Y I     + +  K  +  CP K        + +D  K+L L C+  +DP   V W+KNG +V+    K +   +    F + L I      D+G W C      +     ++L++ P+  FP    L +
Sbjct:   22 KYSESVVGCVTIMI--AEKRKQCICSRLETKFTRIPHDLPDFVETLEVKNQNIHSLTADQLVKVGWLEDLNLDSNKLSSIEFDAFNNVPKLKTLSLKSNFLILGGNSFPSAALLQLKHLKVLDLDNNPLGFVPDFFFQPLKFLTKLILSRAT-NGFYLEPNSLVGLTSLEYLDISASHLTALDRQIHSALNNMQLTDFYFFG-NQWTCDCNLKWLKKWGLKHKDVRIFKKFSRSNGQSALLQPQCFSPHKFQGYNIFEFSTEYDTIKPEQLNCPPKIF-TKNQQIQIDQGKNLTLMCEFEADPGGTVEWSKNGMRVQRHWKKTKWGQTSGMRFTAWLSITRTDLEDNGLWRCILITDTQSANATYSLRVRPS--FPPHIDLTI 397          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Planmine SMEST
Match: SMESG000006317.1 (SMESG000006317.1)

HSP 1 Score: 149.443 bits (376), Expect = 3.370e-37
Identity = 110/386 (28.50%), Postives = 190/386 (49.22%), Query Frame = 3
Query:  330 AVAIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWL--------YRYLGEIQEFITL---QLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCS-RVSPGNVVLDSEKSLNL--TCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSC----RVEDVFQNFTLK-INPNSIFPMAASL 1430
             ++++GC+  + +  S  +  +C + K+    IP   PD    +II  QN+ VI     KN+  L  L+L  + + ++  NAF ++  L  L LSGN++ L ++S+PS  +  L  L  L L+ NPL  +PD++F+ L  LR L L+        I +   +GL +L+ LDL N+   T+++ +    + M+ L    L  NPW CDC+L+WL         +Y  ++ + IT+   ++   + P+C+ P  L    I +      S  +     +KC+ R+   + V +  K  N+  TC+  ++P   V W+KNG  V+    +     S    F + L +++++  DSG+W C     V  V   F LK I+P +I    + L
Sbjct:   27 GLSVQGCITIMKD--SKYKMSICTNYKANFTRIPERFPDQVAEIIIENQNLSVIDSAQLKNLPNLVNLTLNSNKITKLSPNAFTHVPQLISLRLSGNQIYLGENSMPSSSLIYLKKLHTLDLSENPLGFVPDYYFQLLKQLRILNLSTAN-KGFYIETNGLYGLTNLQVLDLTNNHFTTLSEGLSISLKAMQ-LNEFYLFNNPWNCDCNLQWLKAWFTSHKVKYTKDLSKDITINGGKIIEDLQPKCESPFPLSERNIFSDSTNTDSIGIN---DLKCAPRIFTQDRVYEMTKDHNITFTCEFHANPGGTVTWSKNGMIVQNHWRRVSWNRSQGIKFKAWLTLQNVEENDSGNWRCILTTHVSKVNATFLLKVISPQNIIDFKSIL 405          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Planmine SMEST
Match: SMESG000006503.1 (SMESG000006503.1)

HSP 1 Score: 127.102 bits (318), Expect = 4.767e-30
Identity = 101/325 (31.08%), Postives = 170/325 (52.31%), Query Frame = 3
Query:  456 MLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQE---FITLQLDN---KVGPR-CKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLK-SVDSGSWSCR----VEDVFQNFTLKI 1394
            +L +++ NI ++ E+   +   L  L+L  + + +I  NAFKN S L  L L  N LI+++++  S +   L+ L++L L++NP+ +IP+ FF  L +LR+L L +     +RI   AF  L +L+ L L  +   ++   +E +F+EM+ L  LLL +NPW CDC +RW  R+L  + +   ++   ++N    + P  C+ P  L+  ++    D   SK   F C  K  R+    VV   E ++ L+C+  S P   V W KNG  +++  ++ Q+  S   N+ + L I S K  +D G + C     V     N+TL I
Sbjct:   50 ILDLSKNNIRILYEDALDDFENLINLTLDSNKIWKITNNAFKNKSKLKYLSLRNNALIISNNTFLSSVFRYLIRLEYLDLSSNPIGIIPESFFLDLRNLRELYLEEM-MKEIRIQKGAFSNLFNLKLLSLAKNNFLSLPNYLEYEFQEMQ-LETLLLHDNPWACDCRMRWFKRWLITLNQNNDYLYSTIENILLNIHPMLCETPDYLQRKKL---CDLPLSK---FECKPKTLRLGKTLVVKHLE-NVTLSCQFESFPKSYVKWFKNGILIQDHWDRIQLSQSSGRNYVANLTIFSSKYGIDDGCYVCETTNNVGSARSNYTLII 365          
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Planmine SMEST
Match: SMESG000075643.1 (SMESG000075643.1)

HSP 1 Score: 125.176 bits (313), Expect = 1.698e-29
Identity = 100/350 (28.57%), Postives = 164/350 (46.86%), Query Frame = 3
Query:  336 AIKGCVVTLVNPTSLKRRVLCGDPKSQIELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHRNAFKNLSYLTILDLSGNKLILND-DSLPSYLITNLVNLKHLKLTNNPLKMIPDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETINKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRY-----LGEI-QEFITLQLDNKVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSEKSLNLTCKCFS-DPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIRSLKSVDSGSWSCRV 1361
            A++GC V L +  S  +  +C DP + +E IP  L      L +  QN+  ++  +F ++ +L  L+L    +  I   AF++LS L IL LS N L+++D ++L S +   L+ L  L L+ N ++MIP  FF+ L    K+L+         IS  +   L  LE LD+ ++ +  ++   ES F +M  L+ L+L  NPW CDC +RWL  +     LG    E     L +     C  P+ + N  ++  I      + EF C  KC   +    V + E +++L C   S D    + W+ NG  ++     + +  S  +   S L +       SG W C +
Sbjct:   26 AVRGCTVMLKSDQSNFKVAICNDPSTNLERIPKDLSVNLIRLEMMYQNLTSLEANEFSHIYQLELLTLNSCGVRHISTTAFEHLSQLVILTLSNNSLVIHDINNLQSEIFQPLIGLTLLDLSFNFIQMIPKHFFRYLEKSLKVLIISNSKSPFSISPDSLSDLVRLERLDISHNNLIQLDSGFESVFSKMISLQNLILHGNPWKCDCKIRWLVFWYQHSTLGSFPAESSPSSLSHFQSALCHSPRSMHNAILLRSISIPIKSH-EFPCFPKCLSKNSDFFVGEGE-NVSLPCSFQSLDQYTRIKWSHNGTLLKSNSRNY-VIKSDTKRHRSVLTLIHFTIKLSGLWRCYI 372          
The following BLAST results are available for this feature:
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LRIG25.155e-2029.34leucine rich repeats and immunoglobulin like domai... [more]
SLIT11.934e-1733.16slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGN... [more]
LRIG38.162e-1727.11leucine rich repeats and immunoglobulin like domai... [more]
SLIT18.360e-1733.16slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGN... [more]
SLIT18.648e-1733.16slit guidance ligand 1 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slt-11.441e-1128.04Slit homolog 1 protein [Source:UniProtKB/Swiss-Pr... [more]
pan-11.070e-833.33P-granule-associated novel protein 1 [Source:UniP... [more]
sma-101.719e-826.04Leucine-rich repeats and immunoglobulin-like domai... [more]
sma-101.719e-826.04Leucine-rich repeats and immunoglobulin-like domai... [more]
lron-71.985e-826.61ELRR (Extracellular Leucine-Rich Repeat) ONly [So... [more]
back to top
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kek21.624e-2328.30gene:FBgn0015400 transcript:FBtr0080252[more]
sli9.198e-2030.88gene:FBgn0264089 transcript:FBtr0330734[more]
sli1.077e-1930.88gene:FBgn0264089 transcript:FBtr0330733[more]
sli1.077e-1930.88gene:FBgn0264089 transcript:FBtr0330731[more]
kek62.659e-1926.38gene:FBgn0039862 transcript:FBtr0330107[more]
back to top
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrig22.360e-2027.85leucine-rich repeats and immunoglobulin-like domai... [more]
lrrc4ba7.946e-1722.88leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba9.377e-1723.11leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba9.377e-1723.11leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
lrrc4ba9.750e-1722.88leucine rich repeat containing 4Ba [Source:ZFIN;Ac... [more]
back to top
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc43.168e-1824.38leucine rich repeat containing 4 [Source:NCBI gene... [more]
rorc1.094e-1725.79RAR related orphan receptor C [Source:Xenbase;Acc:... [more]
rorc2.368e-1725.79RAR related orphan receptor C [Source:Xenbase;Acc:... [more]
rorc2.426e-1725.63RAR related orphan receptor C [Source:Xenbase;Acc:... [more]
rorc2.450e-1725.79RAR related orphan receptor C [Source:Xenbase;Acc:... [more]
back to top
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lrig24.972e-1828.80leucine-rich repeats and immunoglobulin-like domai... [more]
Lrig25.483e-1828.80leucine-rich repeats and immunoglobulin-like domai... [more]
Lrrc41.476e-1723.65leucine rich repeat containing 4 [Source:MGI Symbo... [more]
Lrig32.517e-1727.90leucine-rich repeats and immunoglobulin-like domai... [more]
Slit14.483e-1734.20slit guidance ligand 1 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O94898|LRIG2_HUMAN2.476e-1929.34Leucine-rich repeats and immunoglobulin-like domai... [more]
sp|P24014|SLIT_DROME1.079e-1830.88Protein slit OS=Drosophila melanogaster OX=7227 GN... [more]
sp|Q52KR2|LRIG2_MOUSE3.835e-1728.80Leucine-rich repeats and immunoglobulin-like domai... [more]
sp|Q99PH1|LRRC4_MOUSE1.032e-1623.65Leucine-rich repeat-containing protein 4 OS=Mus mu... [more]
sp|Q6P1C6|LRIG3_MOUSE1.761e-1627.90Leucine-rich repeats and immunoglobulin-like domai... [more]
back to top
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S5CDM61.866e-3729.49Ig-like domain-containing protein (Fragment) OS=Pr... [more]
A0A0R3T0J25.967e-3730.03Ig-like domain-containing protein OS=Rodentolepis ... [more]
A0A3P7NYU09.503e-3731.58Ig-like domain-containing protein (Fragment) OS=Di... [more]
A0A564YF306.283e-3630.93Ig-like domain-containing protein OS=Hymenolepis d... [more]
A0A0R3SWV57.603e-3630.93Ig-like domain-containing protein OS=Hymenolepis d... [more]
back to top
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrc4.22.148e-1723.65leucine rich repeat containing 4.2 [Source:ZFIN;Ac... [more]
lrig16.438e-1726.04leucine rich repeats and immunoglobulin like domai... [more]
lrig19.351e-1725.34leucine rich repeats and immunoglobulin like domai... [more]
lrrc4cb1.488e-1623.95leucine-rich repeat-containing protein 4C-like [So... [more]
lrit23.251e-1626.17leucine-rich repeat, immunoglobulin-like domain an... [more]
back to top
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrrn12.087e-1624.27leucine rich repeat neuronal 1 [Source:ZFIN;Acc:ZD... [more]
lrig38.195e-1525.32leucine-rich repeats and immunoglobulin-like domai... [more]
ENSPMAT00000000078.13.080e-1433.33pep scaffold:Pmarinus_7.0:GL476403:206014:206980:-... [more]
islr24.229e-1326.78immunoglobulin superfamily containing leucine-rich... [more]
ENSPMAT00000000079.18.964e-1329.32pep scaffold:Pmarinus_7.0:GL476403:206014:206980:-... [more]
back to top
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354073.396e-1230.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471093.877e-923.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272571.975e-828.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481791.572e-726.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432582.065e-736.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000019143.21.032e-1725.08leucine-rich repeat and immunoglobulin-like domain... [more]
ENSORLT00000000072.23.406e-1632.45pep primary_assembly:ASM223467v1:1:1576629:1604541... [more]
lrrc4ba4.171e-1623.38leucine rich repeat containing 4B [Source:NCBI gen... [more]
lrrc4.24.923e-1623.40leucine rich repeat containing 4 [Source:NCBI gene... [more]
lrrc4cb1.071e-1522.89leucine rich repeat containing 4C [Source:NCBI gen... [more]
back to top
BLAST of Fibronectin leucine rich transmembrane protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023338.10.000e+099.75SMESG000023338.1[more]
SMESG000058478.14.361e-3928.72SMESG000058478.1[more]
SMESG000006317.13.370e-3728.50SMESG000006317.1[more]
SMESG000006503.14.767e-3031.08SMESG000006503.1[more]
SMESG000075643.11.698e-2928.57SMESG000075643.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031665 ID=SMED30031665|Name=Fibronectin leucine rich transmembrane protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2770bp
GCTTGATTCCTATTGGTTGGATTGTCTATGATAGAAATTACACACAACAA
CCAATTCCAGTATGACACTTACAGACTTCTAATATCCTGTCGATTTATCT
CGGTAGAATCTCCTTCAAACTACATCAATTTTAATTAATAATATTTTTGA
AATAAAAACAATAAAAATAGGCATCATCGAAGATGTTCTCTATCTGTAAT
CATTGGAAAAATGGATTCCAAATTTGACAAATCAAAGGTTATTGTAAATT
GTCAGAAAAATGTTCGACAATGCGTCTGGCTCATTATAGCCTACTGTTCT
CTCTCCTATTGAATTTTATTTCCAAAGACGCTGTGGCAATTAAAGGTTGT
GTTGTGACTCTCGTCAATCCAACGAGTTTGAAACGAAGAGTACTCTGTGG
AGATCCCAAATCACAAATTGAATTAATTCCAAACCCATTGCCAGACGCTA
CAGAAATGTTGATAATAACCCAACAAAATATTCCAGTGATTAAAGAAGAG
GATTTCAAAAACGTATTAGAATTATCAACTCTCTCATTGACGTTTTCGAA
TCTCGAAAGAATTCATAGAAATGCTTTCAAAAATCTTTCTTATTTGACAA
TATTAGATCTGAGTGGCAACAAATTAATCTTGAACGACGACTCGTTGCCG
AGTTATTTAATAACGAATTTAGTAAATTTAAAGCATTTGAAATTGACTAA
CAATCCGTTGAAAATGATTCCGGATTTTTTTTTCAAACCTCTCTCAAGTC
TACGCAAACTTCTTCTGAACGATTGTGGATTTGATTCATTGAGAATTTCC
AGTCGAGCATTTCATGGATTAAATTCTTTGGAAGAACTCGATTTACGAAA
TAGTGGAATTGAAACCATCAATAAAACAATGGAATCGGATTTTCGAGAAA
TGAAACCCCTTCGAGTGTTGTTATTGGGTGAAAACCCTTGGATCTGTGAT
TGCCATTTGCGTTGGCTTTATCGATATCTTGGTGAAATCCAAGAGTTTAT
CACTTTGCAATTAGATAATAAAGTCGGCCCACGATGCAAACAACCAAAAC
GTTTGGAAAATTACCGTATAATTGCTGGAATTGACAGAAATCAGTCGAAA
TATGTTGAATTTGTCTGTCCCATTAAATGCTCTCGTGTTTCTCCTGGAAA
TGTTGTATTAGACTCAGAAAAGAGCTTAAATTTAACTTGTAAATGTTTTT
CTGATCCTATAAAGCCGGTAATCTGGACGAAAAATGGATACAAAGTCGAA
GAAACGGTGAACAAATTTCAAATTTTCAATTCGGGAAATGAAAACTTTTA
TTCAACTCTCCATATTCGATCTTTGAAATCGGTGGACAGTGGAAGTTGGA
GTTGTAGAGTTGAAGATGTTTTCCAAAATTTCACCTTAAAAATCAACCCG
AATTCCATATTTCCCATGGCAGCTTCACTGAATGTTTACATTTTTGTTGG
ATTGGGAAGTTCTCTTCTACTGATTTCTTTGATAGTTGTAATGATGGTTA
TGTTCTGTAAGAGAGATTCATTGTGTCAGTATAGAAGCCAAAATCCAATG
GTTATATGTGGCTATGAATCCCAAATCAGAAAACCCTCTGGTTATGATGG
GGACGTCCAATTCACGTACAGTCAACAAGACGGTAGATTCCATAGTAGTT
TTTATGAAAATTCCATTCCTGTTAATTCGAATTTTTCTCTCTACCAAAGA
GCCAATGTATACAACGAAGAACCGAATCTTGACAAATCTAGATTGCACGA
ACCAGATTCCAAACCCTCCTTATTAATTAATACCAAAAATTCAAACAACG
AAAAAATGCTAAACATCTACTGTGGATGTCATAATTATAGTATTTTCAAT
TCCGACGACGAACCGAACCTCGATCCAATGACCGAATCGTTTACATACAA
TTCAAAATCTCTCAAACAAATTTTAGAACCAAATCGAAAACCTGTGAATT
TTGAATCGACAAAACTTGAAAGAAATTTCCAAACGATGCCGGTAAAAAGT
TCAACAGAAATCGAAAAGCTACTCCCAAAAATCCGTCAGTGTCCATTCCA
TGGAAGCTCAGCAACTTTGACTCGAGTTCCAGGCGATAAACCGTGCCCAG
TGCACGGATCAACGGCGACTTTGCCGAGTCGTTTGTCGTCGAAAAAAATC
GAACACCGACATGGCTGTCCAAAACACGACAAAGACAACATCAGTGTAAA
AAGTCTAAAACTCGACAGTTCCGGCCACGGTAAAATTCAAGCTCACCGAT
CCAAATCTGTAAATAAAATCTCATCGAATCCAGACAAAGTCGAAATCGTC
ACTCCGCCCGGTTATCGTCCTTGTCCGTTGCATGGTGATATTTTAGCAGC
AATTACCGAAAATCTTACCGACACCAAAACGAATTGTCAGAAATTGAATC
AACGAAAAGATGTTCTTTCTAAGAAATCTCATTCCAAAATTGTCCATGAA
TCGAATCTGAAAATTCCACCAAACGATTGTGATACACTGAATAGGAAACC
GGTTGTTGAACCGATCAAAAATCGTTGTGATTATTTCCCAGTGACGTCAA
GTAGCATTTCTCATAATTTTACGTCTCCAGTTCAGTCAAGTCTATCAAGT
TCCCCTTTGTTAACATCTGATGTTCATGGTACTCTTGTATAAAATTAATT
AATGAATTTTTTAAGATAAATTTAGGAATTATTTGTACTAATGACGAGTA
ATAATATCGAATTTTAGATATAGAAATTTATATTTTTTTTATAAATTATT
TTGATGGTCTTATGAGAAAC
back to top

protein sequence of SMED30031665-orf-1

>SMED30031665-orf-1 ID=SMED30031665-orf-1|Name=SMED30031665-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=791bp
MRLAHYSLLFSLLLNFISKDAVAIKGCVVTLVNPTSLKRRVLCGDPKSQI
ELIPNPLPDATEMLIITQQNIPVIKEEDFKNVLELSTLSLTFSNLERIHR
NAFKNLSYLTILDLSGNKLILNDDSLPSYLITNLVNLKHLKLTNNPLKMI
PDFFFKPLSSLRKLLLNDCGFDSLRISSRAFHGLNSLEELDLRNSGIETI
NKTMESDFREMKPLRVLLLGENPWICDCHLRWLYRYLGEIQEFITLQLDN
KVGPRCKQPKRLENYRIIAGIDRNQSKYVEFVCPIKCSRVSPGNVVLDSE
KSLNLTCKCFSDPIKPVIWTKNGYKVEETVNKFQIFNSGNENFYSTLHIR
SLKSVDSGSWSCRVEDVFQNFTLKINPNSIFPMAASLNVYIFVGLGSSLL
LISLIVVMMVMFCKRDSLCQYRSQNPMVICGYESQIRKPSGYDGDVQFTY
SQQDGRFHSSFYENSIPVNSNFSLYQRANVYNEEPNLDKSRLHEPDSKPS
LLINTKNSNNEKMLNIYCGCHNYSIFNSDDEPNLDPMTESFTYNSKSLKQ
ILEPNRKPVNFESTKLERNFQTMPVKSSTEIEKLLPKIRQCPFHGSSATL
TRVPGDKPCPVHGSTATLPSRLSSKKIEHRHGCPKHDKDNISVKSLKLDS
SGHGKIQAHRSKSVNKISSNPDKVEIVTPPGYRPCPLHGDILAAITENLT
DTKTNCQKLNQRKDVLSKKSHSKIVHESNLKIPPNDCDTLNRKPVVEPIK
NRCDYFPVTSSSISHNFTSPVQSSLSSSPLLTSDVHGTLV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000103central nervous system
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR003591Leu-rich_rpt_typical-subtyp
IPR000483Cys-rich_flank_reg_C
IPR003599Ig_sub
IPR013783Ig-like_fold
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 692..719
NoneNo IPR availablePFAMPF13927Ig_3coord: 290..364
e-value: 1.4E-7
score: 32.0
NoneNo IPR availablePANTHERPTHR24369FAMILY NOT NAMEDcoord: 119..296
coord: 27..202
NoneNo IPR availablePANTHERPTHR24369:SF102LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4Bcoord: 119..296
NoneNo IPR availablePANTHERPTHR24369:SF102LEUCINE-RICH REPEAT-CONTAINING PROTEIN 4Bcoord: 27..202
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..23
score: 0.801
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 49..244
NoneNo IPR availableTMHMMTMhelixcoord: 390..412
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 292..376
e-value: 0.0028
score: 26.9
IPR000483Cysteine-rich flanking region, C-terminalSMARTSM00082lrrct1coord: 222..284
e-value: 6.3E-5
score: 32.4
IPR003591Leucine-rich repeat, typical subtypeSMARTSM00369LRR_typ_2coord: 184..207
e-value: 66.0
score: 6.6
coord: 134..157
e-value: 0.17
score: 21.0
coord: 158..183
e-value: 52.0
score: 7.4
coord: 106..133
e-value: 80.0
score: 5.9
coord: 82..105
e-value: 30.0
score: 9.3
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 152..283
e-value: 5.8E-21
score: 76.5
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 27..151
e-value: 1.5E-15
score: 58.7
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 290..380
e-value: 2.2E-10
score: 42.4
IPR001611Leucine-rich repeatPFAMPF13855LRR_8coord: 63..119
e-value: 6.1E-8
score: 32.3
coord: 136..195
e-value: 1.6E-7
score: 31.0
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 136..157
score: 7.527
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 108..127
score: 5.902
IPR001611Leucine-rich repeatPROSITEPS51450LRRcoord: 186..207
score: 5.409
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 259..372
score: 8.829
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 287..367