SMED30031646

Overview
NameSMED30031646
Smed IDSMED30031646
Length (bp)388
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30031646 (SMED30031646) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30031646 (SMED30031646) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30031646 (SMED30031646) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30031646 (SMED30031646) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031646

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031646SMESG000010156.1 SmedASXL_018656SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30031646SMESG000010156.1 dd_Smed_v4_105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031646SMESG000010156.1 dd_Smed_v4_105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031646SMESG000010156.1 dd_Smed_v4_105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031646SMESG000010156.1 dd_Smed_v4_105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031646SMESG000010156.1 dd_Smed_v4_105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031646SMESG000010156.1 dd_Smed_v4_105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031646SMESG000010156.1 dd_Smed_v4_105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031646SMESG000010156.1 dd_Smed_v4_105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031646SMESG000010156.1 dd_Smed_v4_105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031646SMESG000010156.1 dd_Smed_v4_105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031646SMESG000010156.1 dd_Smed_v4_105_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031646SMESG000010156.1 Contig46922newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031646SMESG000010156.1 Contig46922uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30031646SMESG000010156.1 dd_Smed_v6_105_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30031646SMESG000010156.1 dd_Smed_v6_105_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30031646 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.015684:9480..9995 -1888
v31.004729:24669..25184 -1888
Homology
BLAST of SMED30031646 vs. Ensembl Human
Match: RPL36 (ribosomal protein L36 [Source:HGNC Symbol;Acc:HGNC:13631])

HSP 1 Score: 103.219 bits (256), Expect = 3.556e-29
Identity = 51/88 (57.95%), Postives = 65/88 (73.86%), Query Frame = -3
Query:   60 IAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 323
            +AVGLNKGH VTK   K + S  +G+ +   KF RD+I+E+ G APYE+R +ELLK+ KDKRALKF K+RVG H RAKR RE +S V+
Sbjct:    7 MAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVL 94          
BLAST of SMED30031646 vs. Ensembl Human
Match: RPL36 (ribosomal protein L36 [Source:HGNC Symbol;Acc:HGNC:13631])

HSP 1 Score: 103.219 bits (256), Expect = 3.556e-29
Identity = 51/88 (57.95%), Postives = 65/88 (73.86%), Query Frame = -3
Query:   60 IAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 323
            +AVGLNKGH VTK   K + S  +G+ +   KF RD+I+E+ G APYE+R +ELLK+ KDKRALKF K+RVG H RAKR RE +S V+
Sbjct:    7 MAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVL 94          
BLAST of SMED30031646 vs. Ensembl Human
Match: RPL36 (ribosomal protein L36 [Source:HGNC Symbol;Acc:HGNC:13631])

HSP 1 Score: 103.219 bits (256), Expect = 3.556e-29
Identity = 51/88 (57.95%), Postives = 65/88 (73.86%), Query Frame = -3
Query:   60 IAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 323
            +AVGLNKGH VTK   K + S  +G+ +   KF RD+I+E+ G APYE+R +ELLK+ KDKRALKF K+RVG H RAKR RE +S V+
Sbjct:    7 MAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVL 94          
BLAST of SMED30031646 vs. Ensembl Human
Match: RPL36 (ribosomal protein L36 [Source:HGNC Symbol;Acc:HGNC:13631])

HSP 1 Score: 103.219 bits (256), Expect = 3.556e-29
Identity = 51/88 (57.95%), Postives = 65/88 (73.86%), Query Frame = -3
Query:   60 IAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 323
            +AVGLNKGH VTK   K + S  +G+ +   KF RD+I+E+ G APYE+R +ELLK+ KDKRALKF K+RVG H RAKR RE +S V+
Sbjct:    7 MAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVL 94          
BLAST of SMED30031646 vs. Ensembl Human
Match: RPL36 (ribosomal protein L36 [Source:HGNC Symbol;Acc:HGNC:13631])

HSP 1 Score: 90.5077 bits (223), Expect = 2.299e-24
Identity = 44/78 (56.41%), Postives = 57/78 (73.08%), Query Frame = -3
Query:   90 IAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAK 323
            +AVGLNKGH VTK   K + S  +G+ +   KF RD+I+E+ G APYE+R +ELLK+ KDKRALKF K+RVGG  R +
Sbjct:    7 MAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGGRCRPR 84          
BLAST of SMED30031646 vs. Ensembl Celegans
Match: rpl-36 (60S ribosomal protein L36 [Source:UniProtKB/Swiss-Prot;Acc:P49181])

HSP 1 Score: 102.449 bits (254), Expect = 2.740e-29
Identity = 50/91 (54.95%), Postives = 65/91 (71.43%), Query Frame = -3
Query:   60 MSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 332
            + G+AVGLNKGHA T+L  K + +  KG  S   K  R+L++EI G APYE+R++E+L+I KDKRALKF KRR+G H RAK  RE +  VI
Sbjct:    6 IEGLAVGLNKGHAATQLPVKQRQNRHKGVASKKTKIVRELVREITGFAPYERRVLEMLRISKDKRALKFLKRRIGTHRRAKGKREELQNVI 96          
BLAST of SMED30031646 vs. Ensembl Celegans
Match: rpl-36 (60S ribosomal protein L36 [Source:UniProtKB/Swiss-Prot;Acc:P49181])

HSP 1 Score: 102.449 bits (254), Expect = 2.740e-29
Identity = 50/91 (54.95%), Postives = 65/91 (71.43%), Query Frame = -3
Query:   60 MSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 332
            + G+AVGLNKGHA T+L  K + +  KG  S   K  R+L++EI G APYE+R++E+L+I KDKRALKF KRR+G H RAK  RE +  VI
Sbjct:    6 IEGLAVGLNKGHAATQLPVKQRQNRHKGVASKKTKIVRELVREITGFAPYERRVLEMLRISKDKRALKFLKRRIGTHRRAKGKREELQNVI 96          
BLAST of SMED30031646 vs. Ensembl Fly
Match: RpL36 (gene:FBgn0002579 transcript:FBtr0070158)

HSP 1 Score: 99.3673 bits (246), Expect = 8.733e-28
Identity = 54/102 (52.94%), Postives = 69/102 (67.65%), Query Frame = -3
Query:   48 IAVGLNKGHAVTKL-------AKKVKPSHG---KGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 323
            +A+GLNKGH  +K+        KKVK   G   K  Q+   KF RDL++E+VG APYEKR +ELLK+ KDKRALKF KRR+G H RAKR RE +S ++  +R
Sbjct:    7 LAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLR 108          
BLAST of SMED30031646 vs. Ensembl Fly
Match: RpL36 (gene:FBgn0002579 transcript:FBtr0070155)

HSP 1 Score: 99.3673 bits (246), Expect = 8.733e-28
Identity = 54/102 (52.94%), Postives = 69/102 (67.65%), Query Frame = -3
Query:   48 IAVGLNKGHAVTKL-------AKKVKPSHG---KGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 323
            +A+GLNKGH  +K+        KKVK   G   K  Q+   KF RDL++E+VG APYEKR +ELLK+ KDKRALKF KRR+G H RAKR RE +S ++  +R
Sbjct:    7 LAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLR 108          
BLAST of SMED30031646 vs. Ensembl Fly
Match: RpL36 (gene:FBgn0002579 transcript:FBtr0070156)

HSP 1 Score: 99.3673 bits (246), Expect = 8.733e-28
Identity = 54/102 (52.94%), Postives = 69/102 (67.65%), Query Frame = -3
Query:   48 IAVGLNKGHAVTKL-------AKKVKPSHG---KGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 323
            +A+GLNKGH  +K+        KKVK   G   K  Q+   KF RDL++E+VG APYEKR +ELLK+ KDKRALKF KRR+G H RAKR RE +S ++  +R
Sbjct:    7 LAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLR 108          
BLAST of SMED30031646 vs. Ensembl Fly
Match: RpL36 (gene:FBgn0002579 transcript:FBtr0070157)

HSP 1 Score: 99.3673 bits (246), Expect = 8.733e-28
Identity = 54/102 (52.94%), Postives = 69/102 (67.65%), Query Frame = -3
Query:   48 IAVGLNKGHAVTKL-------AKKVKPSHG---KGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 323
            +A+GLNKGH  +K+        KKVK   G   K  Q+   KF RDL++E+VG APYEKR +ELLK+ KDKRALKF KRR+G H RAKR RE +S ++  +R
Sbjct:    7 LAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLR 108          
BLAST of SMED30031646 vs. Ensembl Fly
Match: RpL36 (gene:FBgn0002579 transcript:FBtr0345321)

HSP 1 Score: 99.3673 bits (246), Expect = 8.733e-28
Identity = 54/102 (52.94%), Postives = 69/102 (67.65%), Query Frame = -3
Query:   48 IAVGLNKGHAVTKL-------AKKVKPSHG---KGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 323
            +A+GLNKGH  +K+        KKVK   G   K  Q+   KF RDL++E+VG APYEKR +ELLK+ KDKRALKF KRR+G H RAKR RE +S ++  +R
Sbjct:    7 LAIGLNKGHKTSKIRNVKYTGDKKVKGLRGSRLKNIQTRHTKFMRDLVREVVGHAPYEKRTMELLKVSKDKRALKFLKRRLGTHIRAKRKREELSNILTQLR 108          
BLAST of SMED30031646 vs. Ensembl Zebrafish
Match: rpl36 (ribosomal protein L36 [Source:NCBI gene;Acc:405888])

HSP 1 Score: 105.145 bits (261), Expect = 4.259e-30
Identity = 53/88 (60.23%), Postives = 65/88 (73.86%), Query Frame = -3
Query:   60 IAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 323
            +AVGLNKGH VTK   K K S  +G+ +  AKF RDLI+E+ G APYE+R +ELLK+ KDKRALKF K+RVG H RAKR RE +S  +
Sbjct:    7 MAVGLNKGHKVTKNVSKPKHSRRRGRLTKHAKFARDLIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNTL 94          
BLAST of SMED30031646 vs. Ensembl Zebrafish
Match: rpl36 (ribosomal protein L36 [Source:NCBI gene;Acc:405888])

HSP 1 Score: 105.145 bits (261), Expect = 4.259e-30
Identity = 53/88 (60.23%), Postives = 65/88 (73.86%), Query Frame = -3
Query:   60 IAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 323
            +AVGLNKGH VTK   K K S  +G+ +  AKF RDLI+E+ G APYE+R +ELLK+ KDKRALKF K+RVG H RAKR RE +S  +
Sbjct:    7 MAVGLNKGHKVTKNVSKPKHSRRRGRLTKHAKFARDLIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNTL 94          
BLAST of SMED30031646 vs. Ensembl Xenopus
Match: gpatch1 (G-patch domain containing 1 [Source:Xenbase;Acc:XB-GENE-953282])

HSP 1 Score: 100.908 bits (250), Expect = 2.480e-28
Identity = 50/92 (54.35%), Postives = 65/92 (70.65%), Query Frame = -3
Query:   60 IMSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 335
            I   +AVGLNKGH VTK   K +    +G+ +   KF RD+I+E+ G APYE+R +ELLK+ KDKRALKF K+R+G H RAKR RE +S V+
Sbjct:    3 IRYPMAVGLNKGHRVTKNVTKPRHCRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRIGTHIRAKRKREELSNVL 94          
BLAST of SMED30031646 vs. Ensembl Mouse
Match: Rpl36 (ribosomal protein L36 [Source:MGI Symbol;Acc:MGI:1860603])

HSP 1 Score: 103.219 bits (256), Expect = 2.441e-29
Identity = 51/88 (57.95%), Postives = 65/88 (73.86%), Query Frame = -3
Query:   60 IAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 323
            +AVGLNKGH VTK   K + S  +G+ +   KF RD+I+E+ G APYE+R +ELLK+ KDKRALKF K+RVG H RAKR RE +S V+
Sbjct:    7 MAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVL 94          
BLAST of SMED30031646 vs. UniProt/SwissProt
Match: sp|Q9LZ57|RL363_ARATH (60S ribosomal protein L36-3 OS=Arabidopsis thaliana OX=3702 GN=RPL36C PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 5.816e-33
Identity = 58/96 (60.42%), Postives = 71/96 (73.96%), Query Frame = -3
Query:   48 IMSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 335
            + +G+ VGLNKGH VTK  +  +P++ KGK S    F R+LIKE+ G APYEKRI ELLK+ KDKRALK AKR++G H RAKR RE MS V+R MR
Sbjct:    2 VATGLFVGLNKGHVVTKREQPPRPNNRKGKTSKRTIFIRNLIKEVAGQAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMR 97          
BLAST of SMED30031646 vs. UniProt/SwissProt
Match: sp|O80929|RL361_ARATH (60S ribosomal protein L36-1 OS=Arabidopsis thaliana OX=3702 GN=RPL36A PE=3 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 2.759e-31
Identity = 56/96 (58.33%), Postives = 69/96 (71.88%), Query Frame = -3
Query:   48 IMSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 335
            + +G+ VGLNKGH VT+     +P+  KGK S    F R LI+E+ G+APYEKRI ELLK+ KDKRALK AKR++G H RAKR RE MS V+R MR
Sbjct:    6 VKTGLFVGLNKGHVVTRRELAPRPNSRKGKTSKRTIFIRKLIREVAGMAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMR 101          
BLAST of SMED30031646 vs. UniProt/SwissProt
Match: sp|Q9M352|RL362_ARATH (60S ribosomal protein L36-2 OS=Arabidopsis thaliana OX=3702 GN=RPL36B PE=3 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 4.380e-31
Identity = 57/96 (59.38%), Postives = 68/96 (70.83%), Query Frame = -3
Query:   48 IMSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 335
            + +G+ VGLNKGH VT+     +P   KGK S    F R+LIKE+ G APYEKRI ELLK+ KDKRALK AKR++G H RAKR RE MS V+R MR
Sbjct:    6 VKTGLFVGLNKGHVVTRRELAPRPRSRKGKTSKRTIFIRNLIKEVAGQAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMR 101          
BLAST of SMED30031646 vs. UniProt/SwissProt
Match: sp|Q6Q415|RL36_DANRE (60S ribosomal protein L36 OS=Danio rerio OX=7955 GN=rpl36 PE=3 SV=1)

HSP 1 Score: 105.145 bits (261), Expect = 3.215e-29
Identity = 53/88 (60.23%), Postives = 65/88 (73.86%), Query Frame = -3
Query:   60 IAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 323
            +AVGLNKGH VTK   K K S  +G+ +  AKF RDLI+E+ G APYE+R +ELLK+ KDKRALKF K+RVG H RAKR RE +S  +
Sbjct:    7 MAVGLNKGHKVTKNVSKPKHSRRRGRLTKHAKFARDLIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNTL 94          
BLAST of SMED30031646 vs. UniProt/SwissProt
Match: sp|Q5RAZ9|RL36_PONAB (60S ribosomal protein L36 OS=Pongo abelii OX=9601 GN=RPL36 PE=3 SV=3)

HSP 1 Score: 103.219 bits (256), Expect = 1.708e-28
Identity = 51/88 (57.95%), Postives = 65/88 (73.86%), Query Frame = -3
Query:   60 IAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 323
            +AVGLNKGH VTK   K + S  +G+ +   KF RD+I+E+ G APYE+R +ELLK+ KDKRALKF K+RVG H RAKR RE +S V+
Sbjct:    7 MAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNVL 94          
BLAST of SMED30031646 vs. TrEMBL
Match: T1FZ60 (60S ribosomal protein L36 OS=Helobdella robusta OX=6412 GN=20214108 PE=3 SV=1)

HSP 1 Score: 118.627 bits (296), Expect = 4.218e-32
Identity = 59/96 (61.46%), Postives = 73/96 (76.04%), Query Frame = -3
Query:   48 IMSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 335
            I+  +AVGL KGH V+KLAK+ +PS  KG Q+  AKF RDL++++ G APYEKR +ELLK+ KDKRALKF KRR+G H R KR RE MS VI+ MR
Sbjct:    3 IIHDMAVGLKKGHKVSKLAKRKRPSTRKGTQTKHAKFVRDLVRDVCGFAPYEKRSMELLKVGKDKRALKFCKRRLGTHLRGKRKREEMSTVIQKMR 98          
BLAST of SMED30031646 vs. TrEMBL
Match: A0A388KE88 (60S ribosomal protein L36 OS=Chara braunii OX=69332 GN=CBR_g2812 PE=3 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 6.667e-32
Identity = 61/95 (64.21%), Postives = 70/95 (73.68%), Query Frame = -3
Query:   48 MSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 332
            MSGIAVGLNKGH VTK  K  +PS  KG+     KF R LI+E+ G APYEKRI ELLK+ KDKRALK AKR++G H RAKR RE M+ V+R MR
Sbjct:    1 MSGIAVGLNKGHVVTKREKVARPSDRKGRLGKRTKFVRALIREVAGFAPYEKRITELLKVGKDKRALKVAKRKLGTHLRAKRKREEMASVLRKMR 95          
BLAST of SMED30031646 vs. TrEMBL
Match: A0A178UKY0 (60S ribosomal protein L36 OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g01580 PE=3 SV=1)

HSP 1 Score: 114.775 bits (286), Expect = 1.724e-30
Identity = 58/96 (60.42%), Postives = 71/96 (73.96%), Query Frame = -3
Query:   48 IMSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 335
            + +G+ VGLNKGH VTK  +  +P++ KGK S    F R+LIKE+ G APYEKRI ELLK+ KDKRALK AKR++G H RAKR RE MS V+R MR
Sbjct:    2 VATGLFVGLNKGHVVTKREQPPRPNNRKGKTSKRTIFIRNLIKEVAGQAPYEKRITELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSSVLRKMR 97          
BLAST of SMED30031646 vs. TrEMBL
Match: A0A328E1P7 (Uncharacterized protein OS=Cuscuta australis OX=267555 GN=DM860_010922 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 2.358e-30
Identity = 60/94 (63.83%), Postives = 69/94 (73.40%), Query Frame = -3
Query:   48 SGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 329
            SG+ VGLNKGH VTK     +PS  KGK S    F R+LI+E+ G APYEKRI ELLK+ KDKRALK AKR++G H RAKR RE MSKV+R MR
Sbjct:    8 SGLFVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRISELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSKVLRKMR 101          
BLAST of SMED30031646 vs. TrEMBL
Match: A0A484L8K0 (Uncharacterized protein OS=Cuscuta campestris OX=132261 GN=CCAM_LOCUS14478 PE=4 SV=1)

HSP 1 Score: 114.39 bits (285), Expect = 2.358e-30
Identity = 60/94 (63.83%), Postives = 69/94 (73.40%), Query Frame = -3
Query:   48 SGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 329
            SG+ VGLNKGH VTK     +PS  KGK S    F R+LI+E+ G APYEKRI ELLK+ KDKRALK AKR++G H RAKR RE MSKV+R MR
Sbjct:    8 SGLFVGLNKGHVVTKKELAPRPSDRKGKTSKRVHFVRNLIREVAGFAPYEKRISELLKVGKDKRALKVAKRKLGTHKRAKRKREEMSKVLRKMR 101          
BLAST of SMED30031646 vs. Ensembl Cavefish
Match: rpl36 (ribosomal protein L36 [Source:NCBI gene;Acc:103025778])

HSP 1 Score: 103.605 bits (257), Expect = 1.558e-29
Identity = 51/92 (55.43%), Postives = 66/92 (71.74%), Query Frame = -3
Query:   60 IMSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 335
            I   +AVGLNKGH VTK   K + S  +G+ +   KF RD+I+E+ G APYE+R +ELLK+ KDKRALKF K+RVG H RAKR RE +S ++
Sbjct:    3 IRYPMAVGLNKGHPVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNIL 94          
BLAST of SMED30031646 vs. Ensembl Cavefish
Match: rpl36 (ribosomal protein L36 [Source:NCBI gene;Acc:103025778])

HSP 1 Score: 103.605 bits (257), Expect = 8.899e-29
Identity = 52/99 (52.53%), Postives = 70/99 (70.71%), Query Frame = -3
Query:   60 LEYLKV*IMSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 356
            +E  ++ I   +AVGLNKGH VTK   K + S  +G+ +   KF RD+I+E+ G APYE+R +ELLK+ KDKRALKF K+RVG H RAKR RE +S ++
Sbjct:   68 MEMNEMAIRYPMAVGLNKGHPVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRVGTHIRAKRKREELSNIL 166          
BLAST of SMED30031646 vs. Ensembl Yeast
Match: RPL36B (Ribosomal 60S subunit protein L36B; binds to 5.8 S rRNA; homologous to mammalian ribosomal protein L36, no bacterial homolog; RPL36B has a paralog, RPL36A, that arose from the whole genome duplication [Source:SGD;Acc:S000006438])

HSP 1 Score: 86.6557 bits (213), Expect = 6.531e-24
Identity = 43/92 (46.74%), Postives = 64/92 (69.57%), Query Frame = -3
Query:   60 IMSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 335
            + +GIA+GLNKG  VT++    K S+ KG  S+  KF R L++EI GL+PYE+R+I+L++   +KRA K AK+R+G  +RAK   E M+ +I
Sbjct:    3 VKTGIAIGLNKGKKVTQMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNII 94          
BLAST of SMED30031646 vs. Ensembl Yeast
Match: RPL36A (Ribosomal 60S subunit protein L36A; N-terminally acetylated; binds to 5.8 S rRNA; homologous to mammalian ribosomal protein L36, no bacterial homolog; RPL36A has a paralog, RPL36B, that arose from the whole genome duplication [Source:SGD;Acc:S000004807])

HSP 1 Score: 86.2705 bits (212), Expect = 9.876e-24
Identity = 43/92 (46.74%), Postives = 63/92 (68.48%), Query Frame = -3
Query:   60 IMSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 335
            + +GIA+GLNKG  VT +    K S+ KG  S+  KF R L++EI GL+PYE+R+I+L++   +KRA K AK+R+G  +RAK   E M+ +I
Sbjct:    3 VKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNII 94          
BLAST of SMED30031646 vs. Ensembl Nematostella
Match: EDO34606 (60S ribosomal protein L36 [Source:UniProtKB/TrEMBL;Acc:A7SNU0])

HSP 1 Score: 106.686 bits (265), Expect = 3.390e-31
Identity = 53/92 (57.61%), Postives = 67/92 (72.83%), Query Frame = -3
Query:   48 IAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 323
            +AVGL KGH VTK   K KPS  KG  +   KF RD+++E+VG APYEKR++ELL+I KDKRALKF K+R+G H R KR RE ++ V+  MR
Sbjct:    7 MAVGLQKGHKVTKNVTKPKPSRRKGASNKRVKFVRDVVREVVGFAPYEKRVMELLRIGKDKRALKFCKKRLGTHVRGKRKREEITSVLAAMR 98          
BLAST of SMED30031646 vs. Ensembl Medaka
Match: rpl36 (ribosomal protein L36 [Source:NCBI gene;Acc:101158513])

HSP 1 Score: 101.679 bits (252), Expect = 6.905e-29
Identity = 51/92 (55.43%), Postives = 65/92 (70.65%), Query Frame = -3
Query:   60 IMSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVI 335
            I   +AVGLNKGH VTK     K S  +G+ +   KF RD+I+E+ G APYE+R +ELLK+ KDKRALKF K+R+G H RAKR RE +S V+
Sbjct:    3 IRYPMAVGLNKGHPVTKNVAAPKHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRALKFIKKRIGTHIRAKRKREELSNVL 94          
BLAST of SMED30031646 vs. Planmine SMEST
Match: SMESG000010156.1 (SMESG000010156.1)

HSP 1 Score: 188.348 bits (477), Expect = 2.319e-63
Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = -3
Query:   48 MSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 332
            MSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR
Sbjct:    1 MSGIAVGLNKGHAVTKLAKKVKPSHGKGKQSSSAKFCRDLIKEIVGLAPYEKRIIELLKIQKDKRALKFAKRRVGGHSRAKRVRENMSKVIRNMR 95          
The following BLAST results are available for this feature:
BLAST of SMED30031646 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RPL363.556e-2957.95ribosomal protein L36 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL363.556e-2957.95ribosomal protein L36 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL363.556e-2957.95ribosomal protein L36 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL363.556e-2957.95ribosomal protein L36 [Source:HGNC Symbol;Acc:HGNC... [more]
RPL362.299e-2456.41ribosomal protein L36 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of SMED30031646 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl-362.740e-2954.9560S ribosomal protein L36 [Source:UniProtKB/Swiss... [more]
rpl-362.740e-2954.9560S ribosomal protein L36 [Source:UniProtKB/Swiss... [more]
back to top
BLAST of SMED30031646 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RpL368.733e-2852.94gene:FBgn0002579 transcript:FBtr0070158[more]
RpL368.733e-2852.94gene:FBgn0002579 transcript:FBtr0070155[more]
RpL368.733e-2852.94gene:FBgn0002579 transcript:FBtr0070156[more]
RpL368.733e-2852.94gene:FBgn0002579 transcript:FBtr0070157[more]
RpL368.733e-2852.94gene:FBgn0002579 transcript:FBtr0345321[more]
back to top
BLAST of SMED30031646 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl364.259e-3060.23ribosomal protein L36 [Source:NCBI gene;Acc:405888... [more]
rpl364.259e-3060.23ribosomal protein L36 [Source:NCBI gene;Acc:405888... [more]
back to top
BLAST of SMED30031646 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gpatch12.480e-2854.35G-patch domain containing 1 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of SMED30031646 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Rpl362.441e-2957.95ribosomal protein L36 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of SMED30031646 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9LZ57|RL363_ARATH5.816e-3360.4260S ribosomal protein L36-3 OS=Arabidopsis thalian... [more]
sp|O80929|RL361_ARATH2.759e-3158.3360S ribosomal protein L36-1 OS=Arabidopsis thalian... [more]
sp|Q9M352|RL362_ARATH4.380e-3159.3860S ribosomal protein L36-2 OS=Arabidopsis thalian... [more]
sp|Q6Q415|RL36_DANRE3.215e-2960.2360S ribosomal protein L36 OS=Danio rerio OX=7955 G... [more]
sp|Q5RAZ9|RL36_PONAB1.708e-2857.9560S ribosomal protein L36 OS=Pongo abelii OX=9601 ... [more]
back to top
BLAST of SMED30031646 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1FZ604.218e-3261.4660S ribosomal protein L36 OS=Helobdella robusta OX... [more]
A0A388KE886.667e-3264.2160S ribosomal protein L36 OS=Chara braunii OX=6933... [more]
A0A178UKY01.724e-3060.4260S ribosomal protein L36 OS=Arabidopsis thaliana ... [more]
A0A328E1P72.358e-3063.83Uncharacterized protein OS=Cuscuta australis OX=26... [more]
A0A484L8K02.358e-3063.83Uncharacterized protein OS=Cuscuta campestris OX=1... [more]
back to top
BLAST of SMED30031646 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
rpl361.558e-2955.43ribosomal protein L36 [Source:NCBI gene;Acc:103025... [more]
rpl368.899e-2952.53ribosomal protein L36 [Source:NCBI gene;Acc:103025... [more]
back to top
BLAST of SMED30031646 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031646 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
RPL36B6.531e-2446.74Ribosomal 60S subunit protein L36B; binds to 5.8 S... [more]
RPL36A9.876e-2446.74Ribosomal 60S subunit protein L36A; N-terminally a... [more]
back to top
BLAST of SMED30031646 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO346063.390e-3157.6160S ribosomal protein L36 [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of SMED30031646 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rpl366.905e-2955.43ribosomal protein L36 [Source:NCBI gene;Acc:101158... [more]
back to top
BLAST of SMED30031646 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000010156.12.319e-63100.00SMESG000010156.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031646 ID=SMED30031646|Name=SMED30031646|organism=Schmidtea mediterranea sexual|type=transcript|length=388bp
AATATCACAATAATTCCAAAAATTTATTTAAAGAAAATTTATTTCTTTCT
CATATTTCTGATGACCTTTGACATATTTTCTCGTACTCTCTTGGCACGTG
AGTGACCTCCAACTCGTCTTTTTGCAAATTTAAGAGCTCTCTTATCCTTT
TGGATTTTAAGCAATTCGATGATTCTCTTTTCATATGGAGCTAAACCAAC
AATTTCCTTAATAAGATCTCTGCAGAACTTAGCGCTGGATGATTGTTTTC
CTTTGCCATGAGATGGCTTAACTTTCTTGGCCAATTTGGTCACGGCATGA
CCTTTGTTTAATCCAACAGCAATACCTGACATAATTTAAACCTTTAAATA
TTCCAAACAATTACTTATTTAAACAATTTTTAATTTTA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000110pharynx progenitor cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR038097L36e_sf
IPR000509Ribosomal_L36e
Vocabulary: molecular function
TermDefinition
GO:0003735structural constituent of ribosome
Vocabulary: biological process
TermDefinition
GO:0006412translation
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0005840ribosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000509Ribosomal protein L36ePFAMPF01158Ribosomal_L36ecoord: 2..96
e-value: 7.1E-39
score: 132.0
IPR000509Ribosomal protein L36ePANTHERPTHR1011460S RIBOSOMAL PROTEIN L36coord: 1..96
IPR000509Ribosomal protein L36ePROSITEPS01190RIBOSOMAL_L36Ecoord: 49..59
IPR038097Ribosomal protein L36e domain superfamilyGENE3DG3DSA:1.10.10.1760coord: 1..97
e-value: 4.6E-37
score: 128.3