General transcription factor II-I repeat domain-containing 2A-like protein

Overview
NameGeneral transcription factor II-I repeat domain-containing 2A-like protein
Smed IDSMED30031645
Length (bp)3098
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of General transcription factor II-I repeat domain-containing 2A-like protein (SMED30031645) t-SNE clustered cells

Violin plots show distribution of expression levels for General transcription factor II-I repeat domain-containing 2A-like protein (SMED30031645) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of General transcription factor II-I repeat domain-containing 2A-like protein (SMED30031645) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for General transcription factor II-I repeat domain-containing 2A-like protein (SMED30031645) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Human
Match: GTF2IRD2 (GTF2I repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30775])

HSP 1 Score: 149.828 bits (377), Expect = 1.494e-47
Identity = 102/294 (34.69%), Postives = 153/294 (52.04%), Query Frame = 3
Query: 2118 EFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQ---ELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSKNQL-EFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYFQI 2978
            E  S  CIIH ++LCA+ L M+ VM +VVK +N I  + L    F  +   LD QYG+LL + E++WLS+G +L+RF E L +I  F+  R +   +LS++ W+RDLAFL D+T  LN LN+ LQ   + V  M + ++ F  KL L + +L  N+L HFP LK    N S      +Y+P ++ L  EF+KR  DF   +  +     PF            S +  +   +L+ME+I +     L  ++ K  + EF  ++    YP  +    KI  + GST      F I
Sbjct:  647 ELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLASRNESDGL---NYIPKIAELQTEFQKRLSDFKLYESELTLFSSPF------------STKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLW-GSYPKYKHHCAKILSMFGSTYICEQLFSI 924          

HSP 2 Score: 62.003 bits (149), Expect = 1.494e-47
Identity = 34/100 (34.00%), Postives = 58/100 (58.00%), Query Frame = 2
Query: 1769 DSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLD--KLVSITTDGAPAL 2062
            + +A + + +L+  + +   +S+ +DE  D+ +  QLAIF+R V   FDV EELL  + + G   G +I+  V+  +   N C+D  KLVS+ + G PA+
Sbjct:  527 EDLAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFSRVEKSLK--NFCIDWSKLVSVASTGTPAM 624          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Human
Match: GTF2IRD2 (GTF2I repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30775])

HSP 1 Score: 149.058 bits (375), Expect = 2.027e-47
Identity = 102/294 (34.69%), Postives = 153/294 (52.04%), Query Frame = 3
Query: 2118 EFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQ---ELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSKNQL-EFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYFQI 2978
            E  S  CIIH ++LCA+ L M+ VM +VVK +N I  + L    F  +   LD QYG+LL + E++WLS+G +L+RF E L +I  F+  R +   +LS++ W+RDLAFL D+T  LN LN+ LQ   + V  M + ++ F  KL L + +L  N+L HFP LK    N S      +Y+P ++ L  EF+KR  DF   +  +     PF            S +  +   +L+ME+I +     L  ++ K  + EF  ++    YP  +    KI  + GST      F I
Sbjct:  809 ELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLASRNESDGL---NYIPKIAELQTEFQKRLSDFKLYESELTLFSSPF------------STKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLW-GSYPKYKHHCAKILSMFGSTYICEQLFSI 1086          

HSP 2 Score: 62.3882 bits (150), Expect = 2.027e-47
Identity = 34/100 (34.00%), Postives = 58/100 (58.00%), Query Frame = 2
Query: 1769 DSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLD--KLVSITTDGAPAL 2062
            + +A + + +L+  + +   +S+ +DE  D+ +  QLAIF+R V   FDV EELL  + + G   G +I+  V+  +   N C+D  KLVS+ + G PA+
Sbjct:  689 EDLAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFSRVEKSLK--NFCIDWSKLVSVASTGTPAM 786          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Human
Match: GTF2IRD2B (GTF2I repeat domain containing 2B [Source:HGNC Symbol;Acc:HGNC:33125])

HSP 1 Score: 148.673 bits (374), Expect = 1.594e-46
Identity = 102/294 (34.69%), Postives = 153/294 (52.04%), Query Frame = 3
Query: 2118 EFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQ---ELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSKNQL-EFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYFQI 2978
            E  S  CIIH ++LCA+ L M+ VM +VVK +N I  + L    F  +   LD QYG+LL + E++WLS+G +L+RF E L +I  F+  R +   +LS++ W+RDLAFL D+T  LN LN+ LQ   + V  M + ++ F  KL L + +L  N+L HFP LK    N S      +Y+P ++ L  EF+KR  DF   +  +     PF            S +  +   +L+ME+I +     L  ++ K  + EF  ++    YP  +    KI  + GST      F I
Sbjct:  647 ELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLVSRNESDGL---NYIPKIAELKTEFQKRLSDFKLYESELTLFSSPF------------STKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLW-GSYPKYKHHCAKILSMFGSTYICEQLFSI 924          

HSP 2 Score: 59.6918 bits (143), Expect = 1.594e-46
Identity = 31/98 (31.63%), Postives = 56/98 (57.14%), Query Frame = 2
Query: 1769 DSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPAL 2062
            + +A + + +L+  + +   +S+ +DE  D+ +  QLAIF+R V   FDV EELL  + + G   G +I+  V+  + +  I   +LVS+ + G PA+
Sbjct:  527 EDLAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFLRVEKSLKKFCINWSRLVSVASTGTPAM 624          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Human
Match: GTF2IRD2B (GTF2I repeat domain containing 2B [Source:HGNC Symbol;Acc:HGNC:33125])

HSP 1 Score: 148.288 bits (373), Expect = 2.091e-46
Identity = 102/294 (34.69%), Postives = 153/294 (52.04%), Query Frame = 3
Query: 2118 EFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQ---ELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSKNQL-EFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYFQI 2978
            E  S  CIIH ++LCA+ L M+ VM +VVK +N I  + L    F  +   LD QYG+LL + E++WLS+G +L+RF E L +I  F+  R +   +LS++ W+RDLAFL D+T  LN LN+ LQ   + V  M + ++ F  KL L + +L  N+L HFP LK    N S      +Y+P ++ L  EF+KR  DF   +  +     PF            S +  +   +L+ME+I +     L  ++ K  + EF  ++    YP  +    KI  + GST      F I
Sbjct:  814 ELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLVSRNESDGL---NYIPKIAELKTEFQKRLSDFKLYESELTLFSSPF------------STKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLW-GSYPKYKHHCAKILSMFGSTYICEQLFSI 1091          

HSP 2 Score: 59.6918 bits (143), Expect = 2.091e-46
Identity = 31/98 (31.63%), Postives = 56/98 (57.14%), Query Frame = 2
Query: 1769 DSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPAL 2062
            + +A + + +L+  + +   +S+ +DE  D+ +  QLAIF+R V   FDV EELL  + + G   G +I+  V+  + +  I   +LVS+ + G PA+
Sbjct:  694 EDLAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFLRVEKSLKKFCINWSRLVSVASTGTPAM 791          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Human
Match: ZBED9 (zinc finger BED-type containing 9 [Source:HGNC Symbol;Acc:HGNC:13851])

HSP 1 Score: 108.997 bits (271), Expect = 8.881e-33
Identity = 88/289 (30.45%), Postives = 150/289 (51.90%), Query Frame = 3
Query: 2115 PEFISYHCIIHQQALCAKFLN--MNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGR----HQELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVS----SLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMIELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGST 2951
            PE  + HC IH+++L  K ++  +NSV+  +VKI+N I+  +L  RLF  + D ++  +  LLLH E+RWLS+GK+L R  E+  ++ +FL+G+     Q   +V+W   LA+L+DI +  NDLN  +Q K+     M + ++   QKL   K  +  +    F NL   +N             ++S    +L+E FE  F      +    +I  PF++ + + L+  ++ Q   DK  L++   + +++S E + +   F      N YP L ++ALK+  L  ST
Sbjct:  841 PECKTTHCFIHRESLAMKKISAELNSVLNDIVKIVNYIKSNSLNSRLFSLLCDNMEADHKQLLLHAEIRWLSRGKVLSRMFEIRNELLVFLQGKKPMWSQLFKDVNWTARLAYLSDIFSIFNDLNASMQGKNATYFSMADKVEGQKQKLEAWKNRISTDCYDMFHNLTTIINEVGNDLDIAHLRKVISEHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLS-SKDNLNLTVTLQ---DKL-LKLATDEGLKISFENTASLPSFWIKAK-NDYPELAEIALKLLLLFPST 1123          

HSP 2 Score: 53.5286 bits (127), Expect = 8.881e-33
Identity = 34/115 (29.57%), Postives = 60/115 (52.17%), Query Frame = 2
Query: 1760 RSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFI-NENNICLDKLVSITTDGAPALTGMHKDFIALCKK 2101
            R    +A+D   QL   +    YFS+QLDE  D+ +   L ++VR   +  D++EE     +L   T   ++Y+ VK++I N+  +     V + +DGA ++TG H + +   K+
Sbjct:  725 RRIQELANDMEDQLIEQIKLAKYFSLQLDECRDIANMIILLVYVRFEHDD-DIKEEFFFSASLPTNTTSSELYEAVKNYIVNKCGLEFKFCVGVCSDGAASMTGKHSEVVTQIKE 838          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Zebrafish
Match: CR392001.3 (pep chromosome:GRCz11:8:38963323:38965260:-1 gene:ENSDARG00000117159.1 transcript:ENSDART00000181495.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR392001.3)

HSP 1 Score: 138.658 bits (348), Expect = 9.561e-51
Identity = 83/240 (34.58%), Postives = 131/240 (54.58%), Query Frame = 3
Query: 2121 FISYHCIIHQQALCAKFLNMNS--VMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGR---HQELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLP-IVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMEL 2822
             +++HCI+HQ+ALCA+        VM LV++++N I  KAL  R F+ + D +D +Y +LLLH +VRWLSK ++LRRF   L  +  FL+ +   + +L +  WL  L F+ D+T+ LN LN  LQ +    + M+ A+  F +KL +   ++    L HFP+L+E   +         YL   +  +   FE RF +F K K  + F + P     +E    ++S   G  +A LEME+
Sbjct:  274 LLAFHCILHQEALCAQTFPSECMVVMNLVIEMVNKIIAKALNHRQFRALLDEVDSEYSDLLLHNKVRWLSKDEVLRRFVACLEHVKTFLKSKDLIYPQLEDTEWLEKLHFMVDMTSHLNKLNESLQVRGNTALQMLEAVLSFERKLTVFARDVQRGTLSHFPSLREFKESHQDHTINGDYLHNAIVDMQTAFESRFCEFRKEKMTLSFPVTP-----LEIDPSLLSTFPGIIQADLEMEM 508          

HSP 2 Score: 65.0846 bits (157), Expect = 9.561e-51
Identity = 37/109 (33.94%), Postives = 63/109 (57.80%), Query Frame = 2
Query: 1775 MASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKK 2101
            MA +   Q   ++++   +S+  DES D       A+  R V N+   +EE++K++ L+G T G+DI + V   +NEN I  + L+S+ TDGAP++ G  + F+ L +K
Sbjct:  167 MAGNITEQQIKDINSAPAYSIACDESCDT------ALLCRYV-NSDGPQEEIIKLIPLKGQTRGEDICEAVLKCLNENGINTNHLISVATDGAPSMRGSKRGFVTLLQK 268          

HSP 3 Score: 39.2762 bits (90), Expect = 9.561e-51
Identity = 27/103 (26.21%), Postives = 51/103 (49.51%), Query Frame = 3
Query: 1443 CIICYSSVAMYKRENLERHFNTKHENENTRFPLNSEIRKKKVEDXXXXXXXXXXXXXXXXXXXXXXX*HPFASAKF*LLK-KTFEDGEYLKQAFLEVGSYSFT 1748
            C++C   ++  K+ N+ERHF  +H      +P+ SE RK  +  L +     K   K  +A         F + +  + + K F DG+Y+K++F+ +  + F+
Sbjct:   37 CLLCSEKLSNNKKSNVERHFQGRHATFAAEYPVGSE-RKSAIALLVEKLEERKNKFKKWIASPNSTTAASFVATREIIKRGKPFTDGDYMKESFINISEHLFS 138          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 167.933 bits (424), Expect = 8.990e-44
Identity = 109/303 (35.97%), Postives = 163/303 (53.80%), Query Frame = 3
Query: 2082 LLHYVKKIKNYPEFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQY-GNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQE---LSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNL------KEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMIE---LS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGST 2951
            L+   K    +P F ++HCIIHQ+   +K LN++ +MK V++I+N +R  AL  R FK + D LD     +LL H  VRWLS+G +L RF ELL  + LFL  +H+E   L +  W+ DLAFL D+   LN LNVDLQ K K +  ++ ++  F  KL L K +L + D  HFP L      K EV   ST      Y  ++ +L + FE+RF +  + +  + F++ PF        SG +      D+A  ++E+I++ E   L     +  +EF   V    YP ++  ALK+  + GST
Sbjct:  269 LVGLCKADDRFPAFWTFHCIIHQEHWVSKKLNLDHIMKPVLEIVNFVRTHALNHRQFKNLIDELDEDLPSDLLFHCAVRWLSRGHVLSRFFELLNPVKLFLAEKHKEYPELHDPQWISDLAFLVDVLHYLNGLNVDLQGKLKMLPDLVQSVFAFVNKLKLFKTHLQKRDYTHFPTLLKASGQKAEVVKGSTA----RYATLLENLEQSFEERFSNLQQKRQQITFLINPFT-----AESGCLKAPLVEDEAASQLEMIELSEDDRLKSVLREGTVEFWKIVPVERYPNVKQAALKLLSMFGST 562          

HSP 2 Score: 30.8018 bits (68), Expect = 8.990e-44
Identity = 15/44 (34.09%), Postives = 29/44 (65.91%), Query Frame = 2
Query: 2954 LCESVFSNMKFMKN*YXXXXXXXXXDNCLRLAVTNYSPGMQKYI 3085
            +CE +FS +K +K+ + + LT+ ++   LR+A T Y P ++K +
Sbjct:  564 VCELLFSTLKLVKSKHRSVLTDTHVKELLRVATTEYEPDLKKIV 607          

HSP 3 Score: 90.5077 bits (223), Expect = 3.992e-18
Identity = 52/127 (40.94%), Postives = 72/127 (56.69%), Query Frame = 2
Query: 1733 QL*LHCNYQRSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKKNKKL 2113
            QL  H   QR  D + +     L ++L  C YFS+ LDES DV DK Q AIFVR V     +REELL I+ L+  T G D+ + +   + + N+ L KL +I TDGAPA+ G  +  + LCK + + 
Sbjct:  154 QLSRHTVEQRISD-IDNSVETHLLSDLQKCQYFSIALDESCDVQDKPQFAIFVRFVSEDCTIREELLDIVPLKDRTRGIDLKETLMTVVEKANLQLSKLTAIVTDGAPAMLGSERGLVGLCKADDRF 279          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 55.0694 bits (131), Expect = 5.326e-7
Identity = 37/125 (29.60%), Postives = 70/125 (56.00%), Query Frame = 2
Query: 1709 KTSILRSWQL*LHCNYQRSEDSMASDTFV--QLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHK 2077
            K + ++  Q+ L  N  +++  M+  TF+  +++N +     FS+ LDE+ DV  K Q++  VR V +  +V+E  L++ TLE  T G+++  +V   + +N + L  +     DGA  ++GM+K
Sbjct:  363 KQASMKKPQVSLLSNRSQNDIIMSLGTFIRSKIQNEIKEAQIFSILLDETTDVSHKEQVSFVVRYVRD-MEVKERFLQVCTLES-TTGKELENVVISLLQDNGLDLKNIRGQGYDGAANMSGMYK 485          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.384 bits (407), Expect = 6.242e-56
Identity = 103/292 (35.27%), Postives = 154/292 (52.74%), Query Frame = 3
Query: 2130 YHCIIHQQALCAKFLNMNSVMKLVVKIINSIRG--KALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRH------QELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPN---LKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMIELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYF 2972
            +HCI+HQ+ LC   L M  +M +V K+ N IRG  ++L  R FK   + LD  YG+LLLH  VRWLS GK L RF  L  +I L+L          + L++VS+L  LAFLTDIT  LN LN++LQ +D+NV  + + +  F  KL LLK  L +NDL HF +   L +E+  +    +   ++P +  LI EF  RF DF  ++   K    P +N +I            + K  +E+  ++  +     S+  + F   ++   YP LRD  ++++ + GST      F
Sbjct:  285 FHCIVHQEVLCGTSLKMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFESCCELFQEMKGNGVILNFSQFVPKMDILIHEFNTRFQDFEGMEASFKLFNNP-INTDIAA---------QDTKYHMELCELQGDQFLHSCSEKGVAFFKLLSQEQYPILRDFGMRMASMFGSTYICEKAF 566          

HSP 2 Score: 74.7146 bits (182), Expect = 6.242e-56
Identity = 42/102 (41.18%), Postives = 57/102 (55.88%), Query Frame = 2
Query: 1796 QLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKK 2101
            +L+N L +  YFS+ LDES D+ D  QL IFVR V   F + EELL+I+ L G T G+DIY  VK  + +          I TDGA A+ G ++      +K
Sbjct:  177 KLQNILRSAPYFSIALDESTDITDTCQLVIFVRSVDQEFHISEELLEIVPLHGSTKGEDIYNAVKATVTKYG-GFSSCTCIVTDGARAMVGRNQGLAGRLRK 277          

HSP 3 Score: 25.0238 bits (53), Expect = 6.242e-56
Identity = 12/38 (31.58%), Postives = 22/38 (57.89%), Query Frame = 2
Query: 2954 LCESVFSNMKFMKN*YXXXXXXXXXDNCLRLAVTNYSP 3067
            +CE  FS+M F+K+ Y   + +  L   +R++ T+ S 
Sbjct:  561 ICEKAFSDMGFIKSKYRNSICDSTLQQIIRISTTSISA 598          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 151.369 bits (381), Expect = 8.486e-52
Identity = 100/292 (34.25%), Postives = 144/292 (49.32%), Query Frame = 3
Query: 2130 YHCIIHQQALCAKFLNMNSVMKLVVKIINSIRG--KALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRH------QELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPN---LKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMIELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYF 2972
            +HCI+HQ+ LC   L M  +M +V K+ N IRG  ++L  R FK   + LD  YG+LLLH  VRWLS GK L RF  L  +I L+L          + L++VS+L  LAFLTDIT  LN LN++LQ +D+NV  + + +  F  KL LLK  L +NDL HF +   L +E+  +    +   ++P +  LI EF  RF DF                       G   NQF +  ++  +   K++                 +   YP LRD  ++++ + GST      F
Sbjct:  285 FHCIVHQEVLCGTSLKMADIMDVVTKVTNLIRGGNRSLTHRRFKNFLEELDAAYGDLLLHTNVRWLSAGKCLVRFFALRKEIHLYLSDIKCDSYLLEHLTDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFESCCELFQEMKGNGVILNFSQFVPKMDILIHEFNTRFQDF----------------------EGNGGNQFLHSCSEKGVAFFKLL-----------------SQEQYPILRDFGMRMASMFGSTYICEKAF 537          

HSP 2 Score: 75.0998 bits (183), Expect = 8.486e-52
Identity = 42/102 (41.18%), Postives = 57/102 (55.88%), Query Frame = 2
Query: 1796 QLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKK 2101
            +L+N L +  YFS+ LDES D+ D  QL IFVR V   F + EELL+I+ L G T G+DIY  VK  + +          I TDGA A+ G ++      +K
Sbjct:  177 KLQNILRSAPYFSIALDESTDITDTCQLVIFVRSVDQEFHISEELLEIVPLHGSTKGEDIYNAVKATVTKYG-GFSSCTCIVTDGARAMVGRNQGLAGRLRK 277          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Xenopus
Match: ENSXETT00000028445.1 (general transcription factor II-I repeat domain-containing protein 2-like [Source:NCBI gene;Acc:101734469])

HSP 1 Score: 102.449 bits (254), Expect = 2.051e-30
Identity = 93/290 (32.07%), Postives = 142/290 (48.97%), Query Frame = 3
Query: 2133 HCIIHQQALCAKFLNMNSVMKLVVKIINSI---RG--KALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRH------QELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKE---EVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMIELS*EFSKNQ---LEFCSHVTPNHYPFLRDVALKISCLIGST 2951
            HCI+H++ L    L M+ VM++VVKI N I   RG   A+ ++ FK   D L   YG+   H    W S G+ L RF  L  +I LFL+  +      + L N  +L  LAFLTD+T  L+ L  +++ KD+ +  +   +  F  KL+LLK+NLI NDL +F +  E   E    +       ++  +  LIE F  RF DF K+    K    P         + +IS     ++ +  MEL  + +    F+  +   + F   +    Y  LRD+ALK++ + GST
Sbjct:  275 HCIMHEEMLIGTLLKMSDVMEVVVKISNFILEKRGFITAVTKKKFKTFLDELSAAYGDFDSHKNAYWSSAGQCLFRFFSLRKEIYLFLKDTNYDPILTESLCNEDFLSSLAFLTDLTHYLHSLKKNIEAKDQLITQLYTHVSVFSNKLMLLKLNLISNDLTYFESCNELYREYEECNIFLDFSKFVEKIEVLIENFNLRFQDFSKINSCFKLYNNPLT-------TDIIS-----ERMEYHMELCDL-QADLFFATREELGVPFFRLLPKEKYRNLRDLALKMTSMFGST 551          

HSP 2 Score: 49.2914 bits (116), Expect = 2.051e-30
Identity = 33/114 (28.95%), Postives = 55/114 (48.25%), Query Frame = 2
Query: 1760 RSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKK 2101
            R   +M      +L   L  C YFS+ LDE+ D      L IF+R + + F++ E++LK ++L      +D+    K  + E     DK  S+ T+G+ ++T       AL +K
Sbjct:  154 RRVSAMHQQITQKLHAILKNCCYFSLALDETTDSCGTDLLVIFIRAIDDGFNISEDILKCVSLPKTAKEEDLLNEAKSSLLEYG-GFDKCTSVMTNGSKSMTAKSLGLSALLRK 266          

HSP 3 Score: 22.7126 bits (47), Expect = 2.051e-30
Identity = 12/35 (34.29%), Postives = 21/35 (60.00%), Query Frame = 2
Query: 2954 LCESVFSNMKFMKN*YXXXXXXXXXDNCLRLAVTN 3058
            +CE  FS +  +K+ Y   ++N+ L   L L++TN
Sbjct:  553 ICERAFSELNHLKSNYRNSISNRTLQEILHLSITN 587          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Xenopus
Match: ENSXETT00000010836.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:63865670:63866962:-1 gene:ENSXETG00000001503.1 transcript:ENSXETT00000010836.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 4.739e-10
Identity = 35/73 (47.95%), Postives = 47/73 (64.38%), Query Frame = 3
Query: 2343 RFRELLPKISLFLEGR---HQELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILL 2552
            RF  LLP+IS F E +   + EL +  WL DLAFLTD T+KLN+LN++LQ +DK   +  + +   GQK  LL
Sbjct:  121 RFHYLLPEISQFSEEKDELYSELYDYQWLADLAFLTDKTSKLNNLNLELQGQDKTTCIFKHKL---GQKSFLL 190          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Mouse
Match: Gtf2ird2 (GTF2I repeat domain containing 2 [Source:MGI Symbol;Acc:MGI:2149780])

HSP 1 Score: 135.576 bits (340), Expect = 1.078e-43
Identity = 83/238 (34.87%), Postives = 123/238 (51.68%), Query Frame = 3
Query: 2127 SYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQ---ELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKM 2831
            S  CIIH + LCA+ L M  VM +VV  +N I  + L    F  +   LD QYG+LL H  ++WL +G +LRRF E L +I  F+  R +   +LS+  W+ DLAFL D+T  LN L+  LQ   + V  M + ++ F  KL L + +L  N+L HFP LK    + S      +Y+P +  L  EF++R  DF   +  +     PF            S    + + +L+ME+I +
Sbjct:  644 SVRCIIHPEWLCAQKLRMGHVMDVVVDSVNWICSRGLNHGDFTTLLYELDSQYGSLLYHTALKWLGRGLVLRRFFESLEEIDSFMSSRGKPVPQLSSRDWILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRAFLAKLCLWETHLARNNLAHFPTLKSVSRSESDGL---NYIPKIVELKAEFQRRLSDFKSCESELTLFSSPF------------STTIDSVREELQMEVIDL 866          

HSP 2 Score: 63.1586 bits (152), Expect = 1.078e-43
Identity = 33/98 (33.67%), Postives = 57/98 (58.16%), Query Frame = 2
Query: 1769 DSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPAL 2062
            + +A   + +L+  + +   +S+ +DE  D+ D  QLAIF+R V + FDV EELL  + + G   G +I+  V+  + + +I   KLVS+ + G PA+
Sbjct:  521 EEVAGSLWEKLRQKIRSFVAYSIAIDEITDINDTTQLAIFIRGVDDNFDVSEELLDTVPMTGAKSGNEIFLRVEKSLKKFSIDWSKLVSVASTGTPAM 618          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 89.7373 bits (221), Expect = 4.942e-28
Identity = 58/168 (34.52%), Postives = 86/168 (51.19%), Query Frame = 3
Query: 2115 PEFISYHCIIHQQALCAKFL--NMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGR-----HQELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNL 2597
            P+ I  HC++H Q L  K L  +   VMK V+  +N ++  +L  RLF  +   LD     LLLH E RWLS+GK+L+R  EL  ++ +F   +         S+ S L+ +A+L DI   LN+LN+ LQ  +   + +   +  F  KL L +  L EN     P L
Sbjct:  426 PKAIGAHCMLHLQTLAMKTLPQDFQEVMKSVLSSVNFVKASSLNSRLFLQLCSDLDEPSKTLLLHTEGRWLSRGKVLKRIFELRDELKMFFNQKAIRQFEALFSDNSALQKVAYLVDIFTILNELNLSLQGPNSTCLDLSEKIHSFQMKLQLWQKKLDENKFYMLPTL 593          

HSP 2 Score: 56.225 bits (134), Expect = 4.942e-28
Identity = 31/87 (35.63%), Postives = 46/87 (52.87%), Query Frame = 2
Query: 1832 SMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIAL 2092
            S+QLDES DV +  QL ++VR + N  D ++E L    LE      D+++ V  F+ ++ I    +  + TDGAPA  G    F  L
Sbjct:  335 SIQLDESTDVANCLQLMVYVRYI-NDGDFKDEFLCCKPLERTATALDVFEAVDSFLRQHEISWKSICGVCTDGAPATLGCQSGFQRL 420          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 82.8037 bits (203), Expect = 6.884e-24
Identity = 59/200 (29.50%), Postives = 100/200 (50.00%), Query Frame = 3
Query: 2133 HCIIHQQALCAKFLN--MNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQELS----NVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKP 2714
            HC IH++ L AK L+  ++ ++    +I++ ++  A   ++   + + +  ++ NL L+ EVRWLS+G+IL R  EL  +I +FL  +H +L+    +  W+  LA+L DI + +N LN  LQ        + N +  F ++L +      END   FP   E +++S       S   I S + E  E     FH   P
Sbjct:  841 HCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHDEEWIAKLAYLADIFSLINKLNSSLQGTMTTFFNLYNKVDVFQKRLKMWLKRAQENDYGMFPLFSEFLDSSDV-----SVKNIASIIFEHLEGLSQIFHACYP 1035          

HSP 2 Score: 49.2914 bits (116), Expect = 6.884e-24
Identity = 22/81 (27.16%), Postives = 48/81 (59.26%), Query Frame = 2
Query: 1826 YFSMQLDESLDVVDKAQLAIFVRMV-FNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALT 2065
            +F++Q+DES +  +   L  +VR + ++  DV+EELL    +  P+   ++++++  +I+  ++  +  V   TDGA ++T
Sbjct:  739 WFALQVDESSEATEVPLLLCYVRFIDYDRGDVKEELLFCTEMPSPSTDLEVFELINKYIDSRSLNWNHCVGFCTDGAASMT 819          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Mouse
Match: Zmym6 (zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI:106505])

HSP 1 Score: 82.8037 bits (203), Expect = 7.526e-24
Identity = 59/200 (29.50%), Postives = 100/200 (50.00%), Query Frame = 3
Query: 2133 HCIIHQQALCAKFLN--MNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQELS----NVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKP 2714
            HC IH++ L AK L+  ++ ++    +I++ ++  A   ++   + + +  ++ NL L+ EVRWLS+G+IL R  EL  +I +FL  +H +L+    +  W+  LA+L DI + +N LN  LQ        + N +  F ++L +      END   FP   E +++S       S   I S + E  E     FH   P
Sbjct:  933 HCFIHREHLAAKKLSPCLHEILLQSSQILSFVKNSASDSQMLTILCEEMGSEHVNLPLNAEVRWLSRGRILTRLFELRHEIEIFLNQKHSDLARYFHDEEWIAKLAYLADIFSLINKLNSSLQGTMTTFFNLYNKVDVFQKRLKMWLKRAQENDYGMFPLFSEFLDSSDV-----SVKNIASIIFEHLEGLSQIFHACYP 1127          

HSP 2 Score: 49.2914 bits (116), Expect = 7.526e-24
Identity = 22/81 (27.16%), Postives = 48/81 (59.26%), Query Frame = 2
Query: 1826 YFSMQLDESLDVVDKAQLAIFVRMV-FNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALT 2065
            +F++Q+DES +  +   L  +VR + ++  DV+EELL    +  P+   ++++++  +I+  ++  +  V   TDGA ++T
Sbjct:  831 WFALQVDESSEATEVPLLLCYVRFIDYDRGDVKEELLFCTEMPSPSTDLEVFELINKYIDSRSLNWNHCVGFCTDGAASMT 911          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Mouse
Match: Epm2aip1 (EPM2A (laforin) interacting protein 1 [Source:MGI Symbol;Acc:MGI:1925031])

HSP 1 Score: 65.4698 bits (158), Expect = 3.110e-13
Identity = 66/297 (22.22%), Postives = 126/297 (42.42%), Query Frame = 3
Query: 2124 ISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVR----WLSKGKILRRFRELLPKISLFL---EGRHQELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFP-------NLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMIELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYF 2972
            I Y   +H + L +  +++N ++  + + +  I+ + ++R  F+ +    + ++G     +  R    WL +GK L+    L  +I  FL          S+  WL D  FL DI   L +++ +LQ            +  F  KL  L+ ++ E +L  FP        LK++       F  + Y  ++S L ++FE+ F D   +K  ++    PF   + +     IS +    K Q   +L     +     K+  +F + ++   YP ++ VA K++ L  S    +  F
Sbjct:  277 IHYSGFLHLELLSSYDVDINQIINTISEWVVMIKTRGVRRPEFQPLLTESESEHGE---RVNGRCLNNWLRRGKTLKLIFSLRKEIEAFLVSVGATTVHFSDKQWLCDFGFLVDIMDYLREISEELQISKVFAAAAFERICTFEGKLSSLQRHMEEVNLTDFPAFSIIVDELKQQFKEDQKIFDPDRYQMVISRLQKDFERHFKDLRFIKKDLELFSNPF---SFKPEYAPISVRVELTKLQANTDLWNEYRV-----KDLGQFYAGLSGEAYPIIKGVAYKVASLFDSNQICDKAF 562          

HSP 2 Score: 30.4166 bits (67), Expect = 3.110e-13
Identity = 24/111 (21.62%), Postives = 50/111 (45.05%), Query Frame = 2
Query: 1772 SMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKKN 2104
            S+ S+   QL N       +S+ LD+   V  +  L +F+R V    +V+E+LL I+ L        +   + + +    + L ++V +TT     + G +   ++  ++ 
Sbjct:  157 SIDSNLRSQLFNRARDFKAYSLALDDQAFVAYENYLLVFIRGVGRDLEVQEDLLTIINLTHHFSVGALMSAILEALQTAGLSLQRMVGLTTTHTLRMIGENSGLVSYMREK 267          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. UniProt/SwissProt
Match: sp|Q86UP8|GTD2A_HUMAN (General transcription factor II-I repeat domain-containing protein 2A OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=3)

HSP 1 Score: 149.828 bits (377), Expect = 6.639e-47
Identity = 102/294 (34.69%), Postives = 153/294 (52.04%), Query Frame = 3
Query: 2118 EFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQ---ELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSKNQL-EFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYFQI 2978
            E  S  CIIH ++LCA+ L M+ VM +VVK +N I  + L    F  +   LD QYG+LL + E++WLS+G +L+RF E L +I  F+  R +   +LS++ W+RDLAFL D+T  LN LN+ LQ   + V  M + ++ F  KL L + +L  N+L HFP LK    N S      +Y+P ++ L  EF+KR  DF   +  +     PF            S +  +   +L+ME+I +     L  ++ K  + EF  ++    YP  +    KI  + GST      F I
Sbjct:  647 ELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLASRNESDGL---NYIPKIAELQTEFQKRLSDFKLYESELTLFSSPF------------STKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLW-GSYPKYKHHCAKILSMFGSTYICEQLFSI 924          

HSP 2 Score: 62.003 bits (149), Expect = 6.639e-47
Identity = 34/100 (34.00%), Postives = 58/100 (58.00%), Query Frame = 2
Query: 1769 DSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLD--KLVSITTDGAPAL 2062
            + +A + + +L+  + +   +S+ +DE  D+ +  QLAIF+R V   FDV EELL  + + G   G +I+  V+  +   N C+D  KLVS+ + G PA+
Sbjct:  527 EDLAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFSRVEKSLK--NFCIDWSKLVSVASTGTPAM 624          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. UniProt/SwissProt
Match: sp|A4IFA3|GT2D2_BOVIN (General transcription factor II-I repeat domain-containing protein 2 OS=Bos taurus OX=9913 GN=GTF2IRD2 PE=2 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 8.724e-47
Identity = 100/288 (34.72%), Postives = 152/288 (52.78%), Query Frame = 3
Query: 2136 CIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQ---ELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSKNQL-EFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYFQI 2978
            CIIH ++LCA+ L M+ +M +VV  +N I  + L    F  +   LDCQYG+LL + E++WLS+G +L+RF E L +I  F+  R +   +LS+  W++DLAFL D+T  LN LN+ LQ   + V  M + ++ F  KL L + +L  N+L HFP LK    N S      +Y+P +  L  EF+KR  DF   +  +     PF ++ IE++           +  L+ME+I +     L  ++ K  + EF  H+    YP  +    KI  + GST      F I
Sbjct:  654 CIIHPESLCAQKLKMDHIMSVVVNAVNWICSRGLNHSEFTTLLYELDCQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSQDWIKDLAFLVDMTMHLNTLNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLARNNLAHFPTLKSVSRNESDGL---NYIPKIVELKTEFQKRLSDFKLYESELTLFSSPF-SMKIESV-----------QEALQMEVIDLQCNTVLKTKYDKVGIPEFYKHLW-GSYPKYKIHCAKILSMFGSTYICEQLFSI 925          

HSP 2 Score: 63.1586 bits (152), Expect = 8.724e-47
Identity = 33/98 (33.67%), Postives = 57/98 (58.16%), Query Frame = 2
Query: 1769 DSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPAL 2062
            + +A + + +L+  + +   +S+ +DE  D+ +  QLAIF+R V   FDV EELL  + + G   G +I+  V+  + + NI   KLVS+ + G PA+
Sbjct:  528 EDVAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFLRVEKSLKKFNIDWSKLVSVASTGTPAM 625          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. UniProt/SwissProt
Match: sp|Q6EKJ0|GTD2B_HUMAN (General transcription factor II-I repeat domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1)

HSP 1 Score: 148.673 bits (374), Expect = 7.081e-46
Identity = 102/294 (34.69%), Postives = 153/294 (52.04%), Query Frame = 3
Query: 2118 EFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQ---ELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSKNQL-EFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYFQI 2978
            E  S  CIIH ++LCA+ L M+ VM +VVK +N I  + L    F  +   LD QYG+LL + E++WLS+G +L+RF E L +I  F+  R +   +LS++ W+RDLAFL D+T  LN LN+ LQ   + V  M + ++ F  KL L + +L  N+L HFP LK    N S      +Y+P ++ L  EF+KR  DF   +  +     PF            S +  +   +L+ME+I +     L  ++ K  + EF  ++    YP  +    KI  + GST      F I
Sbjct:  647 ELKSICCIIHPESLCAQKLKMDHVMDVVVKSVNWICSRGLNHSEFTTLLYELDSQYGSLLYYTEIKWLSRGLVLKRFFESLEEIDSFMSSRGKPLPQLSSIDWIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTLKLVSRNESDGL---NYIPKIAELKTEFQKRLSDFKLYESELTLFSSPF------------STKIDSVHEELQMEVIDLQCNTVLKTKYDKVGIPEFYKYLW-GSYPKYKHHCAKILSMFGSTYICEQLFSI 924          

HSP 2 Score: 59.6918 bits (143), Expect = 7.081e-46
Identity = 31/98 (31.63%), Postives = 56/98 (57.14%), Query Frame = 2
Query: 1769 DSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPAL 2062
            + +A + + +L+  + +   +S+ +DE  D+ +  QLAIF+R V   FDV EELL  + + G   G +I+  V+  + +  I   +LVS+ + G PA+
Sbjct:  527 EDLAGNLWEKLREKIRSFVAYSIAIDEITDINNTTQLAIFIRGVDENFDVSEELLDTVPMTGTKSGNEIFLRVEKSLKKFCINWSRLVSVASTGTPAM 624          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. UniProt/SwissProt
Match: sp|Q99NI3|GT2D2_MOUSE (General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 6.578e-43
Identity = 83/238 (34.87%), Postives = 123/238 (51.68%), Query Frame = 3
Query: 2127 SYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQ---ELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKM 2831
            S  CIIH + LCA+ L M  VM +VV  +N I  + L    F  +   LD QYG+LL H  ++WL +G +LRRF E L +I  F+  R +   +LS+  W+ DLAFL D+T  LN L+  LQ   + V  M + ++ F  KL L + +L  N+L HFP LK    + S      +Y+P +  L  EF++R  DF   +  +     PF            S    + + +L+ME+I +
Sbjct:  644 SVRCIIHPEWLCAQKLRMGHVMDVVVDSVNWICSRGLNHGDFTTLLYELDSQYGSLLYHTALKWLGRGLVLRRFFESLEEIDSFMSSRGKPVPQLSSRDWILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRAFLAKLCLWETHLARNNLAHFPTLKSVSRSESDGL---NYIPKIVELKAEFQRRLSDFKSCESELTLFSSPF------------STTIDSVREELQMEVIDL 866          

HSP 2 Score: 63.1586 bits (152), Expect = 6.578e-43
Identity = 33/98 (33.67%), Postives = 57/98 (58.16%), Query Frame = 2
Query: 1769 DSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPAL 2062
            + +A   + +L+  + +   +S+ +DE  D+ D  QLAIF+R V + FDV EELL  + + G   G +I+  V+  + + +I   KLVS+ + G PA+
Sbjct:  521 EEVAGSLWEKLRQKIRSFVAYSIAIDEITDINDTTQLAIFIRGVDDNFDVSEELLDTVPMTGAKSGNEIFLRVEKSLKKFSIDWSKLVSVASTGTPAM 618          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. UniProt/SwissProt
Match: sp|Q6R2W3|SCND3_HUMAN (SCAN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZBED9 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 5.173e-32
Identity = 88/289 (30.45%), Postives = 150/289 (51.90%), Query Frame = 3
Query: 2115 PEFISYHCIIHQQALCAKFLN--MNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGR----HQELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVS----SLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMIELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGST 2951
            PE  + HC IH+++L  K ++  +NSV+  +VKI+N I+  +L  RLF  + D ++  +  LLLH E+RWLS+GK+L R  E+  ++ +FL+G+     Q   +V+W   LA+L+DI +  NDLN  +Q K+     M + ++   QKL   K  +  +    F NL   +N             ++S    +L+E FE  F      +    +I  PF++ + + L+  ++ Q   DK  L++   + +++S E + +   F      N YP L ++ALK+  L  ST
Sbjct:  992 PECKTTHCFIHRESLAMKKISAELNSVLNDIVKIVNYIKSNSLNSRLFSLLCDNMEADHKQLLLHAEIRWLSRGKVLSRMFEIRNELLVFLQGKKPMWSQLFKDVNWTARLAYLSDIFSIFNDLNASMQGKNATYFSMADKVEGQKQKLEAWKNRISTDCYDMFHNLTTIINEVGNDLDIAHLRKVISEHLTNLLECFEFYFPSKEDPRIGNLWIQNPFLS-SKDNLNLTVTLQ---DKL-LKLATDEGLKISFENTASLPSFWIKAK-NDYPELAEIALKLLLLFPST 1274          

HSP 2 Score: 53.5286 bits (127), Expect = 5.173e-32
Identity = 34/115 (29.57%), Postives = 60/115 (52.17%), Query Frame = 2
Query: 1760 RSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFI-NENNICLDKLVSITTDGAPALTGMHKDFIALCKK 2101
            R    +A+D   QL   +    YFS+QLDE  D+ +   L ++VR   +  D++EE     +L   T   ++Y+ VK++I N+  +     V + +DGA ++TG H + +   K+
Sbjct:  876 RRIQELANDMEDQLIEQIKLAKYFSLQLDECRDIANMIILLVYVRFEHDD-DIKEEFFFSASLPTNTTSSELYEAVKNYIVNKCGLEFKFCVGVCSDGAASMTGKHSEVVTQIKE 989          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. TrEMBL
Match: A0A3Q2R058 (Uncharacterized protein OS=Fundulus heteroclitus OX=8078 PE=4 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.427e-100
Identity = 116/287 (40.42%), Postives = 173/287 (60.28%), Query Frame = 3
Query: 2109 NYPEFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRH---QELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSS--TPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMI-ELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGST 2951
            ++P+F++YHC+IHQQAL  K +N+N VM +VV++INSIR KALQ RLFK + D L    G+LLLH +VRWLS+GK+L+RF +LLP+I  F+E R+   +ELS+  WL DL FLTD+TAK+N LN +LQ KD+++  MI+A+  F  KL +    L    L HF NL++     S    F  E Y   +  +  EF  RF +   ++ +  FI+ PF+  ++E ++      F      ++ME++  I ++  +       F   V+   +P L   AL++S  IGST
Sbjct:  301 DFPDFVNYHCVIHQQALVGKVVNLNHVMTVVVRLINSIRAKALQHRLFKALLDELHAACGDLLLHADVRWLSRGKVLQRFVDLLPEIKTFMETRNEECEELSDDQWLLDLGFLTDLTAKMNALNNELQGKDRHLPHMISAVNAFKAKLGVWNTQLKNGRLTHFSNLEKMSQGISDKDAFHPEDYCGHLDKVAAEFSHRFGELDAMEDVAAFILNPFLTTDVEQVAAKFQQVFALPNG-VDMEMLDSINDIELKGRSGDGNFWGIVSREKFPLLTSCALRVSAYIGST 586          

HSP 2 Score: 132.494 bits (332), Expect = 1.427e-100
Identity = 79/195 (40.51%), Postives = 115/195 (58.97%), Query Frame = 2
Query: 1583 SLNYQQTFFKKQAGKNEVATLASFRVCKVLT-IKKNI*RW*IFKTSI--------------------LRSWQL*LHCNYQRSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKKN 2104
            SL  QQ+ F K A +++ AT ASFR+  +L   KK      IFK ++                    LRS QL L+   +R E+ M++D   Q+  +L  C YFS+Q DESLDV+D AQL +FVRM F     +E+LL +L L+  T G+DIY+  K ++ +N+I +DKLV++TTDG PA+ G+   F+ALC+ +
Sbjct:  106 SLKTQQSLFTKPAAQHKAATEASFRISHLLAKHKKPFTDGDIFKEAMAITADTIFNSFSNKDDIKTALRSIQLGLNTVARRVEE-MSADVDRQVLADLSHCEYFSLQFDESLDVMDTAQLVVFVRMAFPDATTKEDLLTLLHLKERTRGEDIYKAFKTYVCDNDIPIDKLVAVTTDGVPAMRGVRSGFVALCRND 299          

HSP 3 Score: 57.3806 bits (137), Expect = 1.427e-100
Identity = 33/75 (44.00%), Postives = 41/75 (54.67%), Query Frame = 3
Query: 1371 AVTMAKKRKNYHFHEE-----FFIYVND--ICIICYSSVAMYKRENLERHFNTKHENENTRFPLNSEIRKKKVED 1574
            A    KK K YHFHEE      F  + D  IC++C+ ++A+ KR NLERH NT H      FP  S IR  KV +
Sbjct:   28 AAAPRKKSKTYHFHEEWEEEFVFTMLKDKCICMLCHQTLALSKRGNLERHHNTNHVKFKDSFPAKSAIRAGKVAE 102          

HSP 4 Score: 36.965 bits (84), Expect = 1.427e-100
Identity = 19/38 (50.00%), Postives = 29/38 (76.32%), Query Frame = 2
Query: 2954 LCESVFSNMKFMKN*YXXXXXXXXXDNCLRLAVTNYSP 3067
            LCE  FS MK +K+ Y ++L++K+L +CLRLA ++Y P
Sbjct:  588 LCEMAFSQMKIIKSKYRSRLSDKHLTDCLRLAASSYEP 625          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. TrEMBL
Match: A0A3P9D7F1 (Uncharacterized protein OS=Maylandia zebra OX=106582 PE=4 SV=1)

HSP 1 Score: 221.476 bits (563), Expect = 2.483e-85
Identity = 119/298 (39.93%), Postives = 180/298 (60.40%), Query Frame = 3
Query: 2112 YPEFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFL----EGRHQELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTP---FSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFV-NINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYF 2972
            +P+F++YHCIIHQQALCAK LNM  +M +  KI  SIR ++LQRRLF+   +  DC +  LLLH +VRWLS+GK L+RFREL P+I  F     +  + +L++  WL DLAFLTD+T  LNDLN+ LQ KDK V+ MI+++  F +K+  L + L  +DL +F NL  E+              Y   + + + EF+KRF DF  ++P+  F+ YPF  + ++++L+  I+  F  + + +E E++ +   IEL    S++  +F + +T   YP +R  A  ++ L GST      F
Sbjct:  156 FPDFLNYHCIIHQQALCAKMLNMKEIMNVATKIACSIRARSLQRRLFRAHLEKADCDHSELLLHTDVRWLSRGKFLQRFRELCPEIKEFFRVAGQAEYMQLNDGQWLLDLAFLTDLTNMLNDLNLQLQGKDKTVINMISSVNAFKRKMQHLSLKLQRHDLINFQNLASELEMQGMACLQLDSARYTEQIDNCLSEFDKRFQDFSLLEPVATFMCYPFREDADVDSLASKIAKLFHLNSSAVEDEILTLQADIELK---SRDHGQFWNLLTEVKYPNMRKCAASLTALFGSTYLCESSF 450          

HSP 2 Score: 108.612 bits (270), Expect = 2.483e-85
Identity = 60/131 (45.80%), Postives = 84/131 (64.12%), Query Frame = 2
Query: 1712 TSILRSWQL*LHCNYQRSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKKN 2104
            TS +++ QL      +R E +MA D   QL  ++  C  FS+QLDES DV D AQ+ IF+RMVF     +EELL +L ++  T G+DI+Q  K+FI +  + + KLVSITTDGAPA+ G    FIA C+++
Sbjct:   24 TSSIKALQLSRSTVTRRCE-AMAEDLTQQLWKDIGDCQCFSLQLDESTDVSDTAQVCIFIRMVFTDITAKEELLTVLPMKEQTRGEDIFQSFKNFIEKTQLPVYKLVSITTDGAPAMVGRLNGFIAKCRQD 153          

HSP 3 Score: 39.6614 bits (91), Expect = 2.483e-85
Identity = 20/38 (52.63%), Postives = 31/38 (81.58%), Query Frame = 2
Query: 2954 LCESVFSNMKFMKN*YXXXXXXXXXDNCLRLAVTNYSP 3067
            LCES FS+M  +K+ Y + +T+++L+ CLRLAV++YSP
Sbjct:  445 LCESSFSHMNIIKSKYRSTMTDEHLEVCLRLAVSSYSP 482          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. TrEMBL
Match: A0A3B3HZV5 (Uncharacterized protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 216.468 bits (550), Expect = 3.009e-84
Identity = 116/306 (37.91%), Postives = 183/306 (59.80%), Query Frame = 3
Query: 2091 YVKKIKN---YPEFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQELS---NVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSC-----ESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMI-ELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYF 2972
            ++ + KN   +P+F+ YHCIIHQQA+CAK    + VM  VVKIINSIR KA Q R+FK + D L  +YG+LLLH E+RWLS+G+IL+RF  LL +I  F++ + ++ S   +  W+ DLAFLTD+T  LN LN +LQ KDK V   I+A+  F  KL +    L +  + HFP+++  +N++ +  +      + Y  +++ L +EFE RF DF +++P V F+  PF+ +++ + +  +S  F  +   +EME++ +  +L  +  ++   F   V    Y  +   A+KI+C  GST      F
Sbjct:  263 FIAQCKNDPDFPKFLHYHCIIHQQAICAKVTGFDHVMTPVVKIINSIRSKAKQHRMFKMLMDELSAEYGDLLLHTEIRWLSRGRILQRFLSLLGEIKEFMKSKGEDTSLLEDPEWVLDLAFLTDLTGNLNHLNRELQGKDKTVAHTISAVNAFRAKLSIFSTQLQKKKMLHFPSVQAALNDNVSASAALNEAVKKYSQVINRLGQEFEDRFCDFEQLEPCVSFVTNPFMQVDVTSTAEQLSALFTLNAGDVEMEILTLQNDLLLKAHQSAPNFWCLVDQEKYSGVCTAAMKIACFFGSTYLCESAF 568          

HSP 2 Score: 107.457 bits (267), Expect = 3.009e-84
Identity = 80/203 (39.41%), Postives = 106/203 (52.22%), Query Frame = 2
Query: 1553 QKEEG*GSEKSLNYQQTFFKKQAGKNEVATLASFRVCKVLTIKKN-------------I*RW*IFK--------TSILRSWQL*LHCNYQRSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCK 2098
            + E+  G + +L+ Q+TFF + A K+  AT ASFR    L   K              +    IFK         S L   QL       R   S++ +   +L  +L  C +FS+Q DES+D    AQL IF+RMVF  F  +EELL +L L+  T G DIY  VK+F  E  + + KLVS+TTDGAPA+TG H  FIA CK
Sbjct:   67 RTEKARGLKAALDMQRTFFTRPAKKSHNATEASFRAAHFLIKNKKPFSDGEVLKEAMMLVANTIFKDEKYAPDVISTLSDVQL-GASTIARRVTSLSENLTEKLDRDLAACRWFSVQCDESVDSASTAQLMIFIRMVFEDFSTKEELLTLLPLKTTTRGVDIYTTVKNFFVEKKVPVQKLVSVTTDGAPAMTGRHVGFIAQCK 268          

HSP 3 Score: 42.3578 bits (98), Expect = 3.009e-84
Identity = 23/38 (60.53%), Postives = 30/38 (78.95%), Query Frame = 2
Query: 2954 LCESVFSNMKFMKN*YXXXXXXXXXDNCLRLAVTNYSP 3067
            LCES FSNM F+KN + T LT+ +L + LR+AV+NYSP
Sbjct:  563 LCESAFSNMNFIKNKHRTCLTDAHLQDSLRIAVSNYSP 600          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. TrEMBL
Match: A0A498MQH6 (General transcription factor II-I repeat domain-containing 2A-like protein OS=Labeo rohita OX=84645 GN=ROHU_023746 PE=4 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 3.780e-83
Identity = 122/298 (40.94%), Postives = 175/298 (58.72%), Query Frame = 3
Query: 2112 YPEFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLE-GRHQELSN---VSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEV---NNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFV-NINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYF 2972
            +P+F++YHCIIHQQALCAK LNM  +M +  KI  SIR ++LQRRLF+   +  DC +  LLLH +VRWLS+GK L+RFREL P+I  FL   +H E S      WL DLAFLTD+T  LNDLN++LQ KDK V  MI+++  F +K+      L  +DL +F NL  E+     S        Y   + + + EF+KRF DF  ++PI  F+ YPF  +  + +L+  I+  F  + + +E E++ +   I+L    S+   +F + +T   YP +R  A  ++ L GST      F
Sbjct:  251 FPDFLNYHCIIHQQALCAKMLNMKEIMDVATKIACSIRARSLQRRLFRAHLENADCDHSELLLHTDVRWLSRGKFLQRFRELCPEIKEFLRVAKHAEYSQLNDNLWLLDLAFLTDLTNMLNDLNLELQGKDKTVTNMISSVNAFKRKMQHFSSKLQRHDLANFQNLVSELEMQGKSCVQLDNARYKEQIDNCLSEFDKRFQDFALLEPIATFMCYPFQEDAEVVSLASKIATLFHLNSSGVEDEILTLQADIQLK---SRAHGQFWNLLTEEKYPNMRKCATSLTALFGSTYLCESAF 545          

HSP 2 Score: 117.472 bits (293), Expect = 3.780e-83
Identity = 77/194 (39.69%), Postives = 108/194 (55.67%), Query Frame = 2
Query: 1586 LNYQQTFFKKQAGKNEVATLASFRVCKVLTIKKNI*R----------------W*IFKT-----SILRSWQL*LHCNYQRSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKKN 2104
            L+ QQ+FF +   K   AT ASFRV  ++   K   +                +  FK      S +++ QL      +RSE +MA D   QL  ++  C  FS+QLDES DV D AQL IF+RMVFN    +EELL +L ++  T G+DI+Q  K+F+ +  + + KLVSITTDGAPA+ G    FIA C+++
Sbjct:   56 LSGQQSFFSQLTSKARAATEASFRVSHLIVKNKKSFQDGEMVKEAFVEAADSLFRDFKNKPEILSSIKALQLSRSTVTRRSE-AMAEDLTQQLWKDVTDCECFSLQLDESTDVSDTAQLCIFIRMVFNDMTAKEELLTVLPMKEHTRGEDIFQSFKNFMEKTRLPVCKLVSITTDGAPAMVGRSNGFIAKCRED 248          

HSP 3 Score: 39.6614 bits (91), Expect = 3.780e-83
Identity = 19/38 (50.00%), Postives = 30/38 (78.95%), Query Frame = 2
Query: 2954 LCESVFSNMKFMKN*YXXXXXXXXXDNCLRLAVTNYSP 3067
            LCES FS+MK +K+ Y + +T+ +L+ CLRLA+++Y P
Sbjct:  540 LCESAFSHMKIIKSKYRSTMTDDHLEVCLRLAISSYCP 577          

HSP 4 Score: 63.1586 bits (152), Expect = 2.627e-6
Identity = 38/103 (36.89%), Postives = 60/103 (58.25%), Query Frame = 3
Query: 1440 ICIICYSSVAMYKRENLERHFNTKHENENTRFPLNSEIRKKKVEDXXXXXXXXXXXXXXXXXXXXXXX*HPFASAKF*LL-KKTFEDGEYLKQAFLEVGSYSF 1745
            IC+IC S +A+ K+ N+ERHF T H+N +T FP  SE+RK++V++LK      +       +K +      F  +   +  KK+F+DGE +K+AF+E     F
Sbjct:    7 ICLICQSVIAIPKKGNVERHFRTVHKNYDTDFPPKSELRKRRVKELKSQLSGQQSFFSQLTSKARAATEASFRVSHLIVKNKKSFQDGEMVKEAFVEAADSLF 109          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. TrEMBL
Match: A0A498NXL4 (General transcription factor II-I repeat domain-containing 2A-like protein OS=Labeo rohita OX=84645 GN=ROHU_003188 PE=4 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 1.516e-82
Identity = 121/298 (40.60%), Postives = 174/298 (58.39%), Query Frame = 3
Query: 2112 YPEFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLE-GRHQELSN---VSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEV---NNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFV-NINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYF 2972
            +P+ ++YHCIIHQQALCAK LNM  +M +  KI  SIR ++LQRRLF+   +  DC +  LLLH +VRWLS+GK L+RFREL P+I  FL   +H E S      WL DLAFLTD+T  LNDLN++LQ KDK V  MI+++  F +K+      L  +DL +F NL  E+     S        Y   + + + EF+KRF DF  ++PI  F+ YPF  +  + +L+  I+  F  + + +E E++ +   I+L    S+   +F + +T   YP +R  A  ++ L GST      F
Sbjct:  251 FPDSLNYHCIIHQQALCAKMLNMKEIMDVATKIACSIRARSLQRRLFRAHLENADCDHSELLLHTDVRWLSRGKFLQRFRELCPEIKEFLRVAKHAEYSQLNDNLWLLDLAFLTDLTNMLNDLNLELQGKDKTVTNMISSVNAFKRKMQHFSSKLQRHDLANFQNLVSELEMQGKSCVQLDNARYKEQIDNCLSEFDKRFQDFALLEPIATFMCYPFQEDAEVVSLASKIATLFHLNSSGVEDEILTLQADIQLK---SRAHGQFWNLLTEEKYPNMRKCATSLTALFGSTYLCESAF 545          

HSP 2 Score: 118.242 bits (295), Expect = 1.516e-82
Identity = 78/194 (40.21%), Postives = 109/194 (56.19%), Query Frame = 2
Query: 1586 LNYQQTFFKKQAGKNEVATLASFRVCKVLTIKK------------------NI*RW*IFKTSIL---RSWQL*LHCNYQRSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKKN 2104
            L+ QQ+FF +   K + AT ASFRV  ++   K                  ++ R    K  IL   ++ QL      +RSE +MA D   QL  ++  C  FS+QLDES DV D AQL IF+RMVFN    +EELL +L ++  T G+DI+Q  K+F+ +  + + KLVSITTDGAPA+ G    FIA C+++
Sbjct:   56 LSGQQSFFSQLTSKGKAATEASFRVSHLIVKNKKSFQDGEMVKEAFVEAADSLFRDFKNKPEILSSIKALQLSRSTVTRRSE-AMAEDLTQQLWKDITDCECFSLQLDESTDVSDTAQLCIFIRMVFNDMTAKEELLTVLPMKEHTRGEDIFQSFKNFMEKTRLPVCKLVSITTDGAPAMVGRSNGFIAKCRED 248          

HSP 3 Score: 39.6614 bits (91), Expect = 1.516e-82
Identity = 19/38 (50.00%), Postives = 30/38 (78.95%), Query Frame = 2
Query: 2954 LCESVFSNMKFMKN*YXXXXXXXXXDNCLRLAVTNYSP 3067
            LCES FS+MK +K+ Y + +T+ +L+ CLRLA+++Y P
Sbjct:  540 LCESAFSHMKIIKSKYRSTMTDDHLEVCLRLAISSYCP 577          

HSP 4 Score: 63.1586 bits (152), Expect = 3.174e-6
Identity = 39/103 (37.86%), Postives = 60/103 (58.25%), Query Frame = 3
Query: 1440 ICIICYSSVAMYKRENLERHFNTKHENENTRFPLNSEIRKKKVEDXXXXXXXXXXXXXXXXXXXXXXX*HPFASAKF*LL-KKTFEDGEYLKQAFLEVGSYSF 1745
            IC+IC S +A+ K+ N+ERHF T H+N +T FP  SE+RK++V++LK      +       +K K      F  +   +  KK+F+DGE +K+AF+E     F
Sbjct:    7 ICLICQSVIAIPKKGNVERHFRTVHKNYDTDFPPKSELRKRRVKELKSQLSGQQSFFSQLTSKGKAATEASFRVSHLIVKNKKSFQDGEMVKEAFVEAADSLF 109          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000039226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000099.1:564912:568121:1 gene:ENSAMXG00000042173.1 transcript:ENSAMXT00000039226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.986 bits (515), Expect = 5.013e-84
Identity = 124/295 (42.03%), Postives = 179/295 (60.68%), Query Frame = 3
Query: 2112 YPEFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGR---HQELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSST--PFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYF 2972
            +P F+SYHC+IHQQAL +K ++ + VM +VVKI+NSIR KALQ RLFK + D LD +YG+L+LH +VRWLS+GK+L+RF  LLP+I  FL+ R   ++EL++ +WL DLAFLTD+T+KLN+LN +LQ KD +V  M++A+  F  KL L    L    L HF N+ + +NN S    F  E++   ++ L EEF KRF + +  K I++ +   F  +  E  +GV            +ME+I +   IE+  +      +F   V+   YP L   ALK+    GST +    F
Sbjct:  271 FPAFVSYHCVIHQQALASKVVDFSHVMTVVVKIVNSIRAKALQHRLFKSLLDELDAEYGDLILHADVRWLSRGKVLQRFINLLPEIISFLKSRKEEYRELADDTWLLDLAFLTDLTSKLNELNCELQGKDCDVPHMVSAVNAFKVKLALWTSQLKCKKLTHFQNVDKMLNNISNKDSFHPENFCIHLNRLEEEFSKRFEELN--KDIIEELSAKFQQV-FELPNGV------------DMEIIDLENDIEM--KARSRDKDFWGLVSRERYPSLSACALKVKAFFGSTYFCEMSF 548          

HSP 2 Score: 113.235 bits (282), Expect = 5.013e-84
Identity = 53/115 (46.09%), Postives = 77/115 (66.96%), Query Frame = 2
Query: 1760 RSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKKN 2104
            R  + ++ D   Q+ ++L  C YFS+Q DES+D+ D AQL +FVRM F+   V+E+ L +L L   T G+DIY+  + +  EN++   KLVSIT DGAPA+ G+H  FIALC+K+
Sbjct:  154 RRVELLSEDISKQVLSDLSRCEYFSLQFDESVDITDTAQLVVFVRMTFSDASVKEDFLTLLPLNERTRGEDIYRAFRTYATENDLPFQKLVSITRDGAPAMCGIHAGFIALCRKD 268          

HSP 3 Score: 35.4242 bits (80), Expect = 5.013e-84
Identity = 19/38 (50.00%), Postives = 27/38 (71.05%), Query Frame = 2
Query: 2954 LCESVFSNMKFMKN*YXXXXXXXXXDNCLRLAVTNYSP 3067
             CE  F  MK +K+ Y T LT+ +L +C+RLAV+NY+P
Sbjct:  543 FCEMSFPQMKIIKSKYRTCLTDAHLTDCVRLAVSNYTP 580          

HSP 4 Score: 24.2534 bits (51), Expect = 5.013e-84
Identity = 10/15 (66.67%), Postives = 11/15 (73.33%), Query Frame = 3
Query: 1680 KKTFEDGEYLKQAFL 1724
            KKTF DGE  K+A L
Sbjct:  108 KKTFTDGELFKEAML 122          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000030525.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:12992682:12994541:1 gene:ENSAMXG00000035573.1 transcript:ENSAMXT00000030525.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 167.548 bits (423), Expect = 5.116e-59
Identity = 109/300 (36.33%), Postives = 161/300 (53.67%), Query Frame = 3
Query: 2118 EFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQE---LSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSK-----NQLEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYFQI*N 2984
            E I+ HCIIHQQALC+K L  ++VM +VVK IN IR ++L+ R F+ + + ++ +YG++L   EVRWLS+G IL+RF EL  ++  F+E        LS+  WL DLAFL DIT +LN LN  LQ + + V    + ++ F  KL+L K  L + +  HFP  K  + ++ TPFS E Y+  +  L EEF+ RF DF   +   +    PF + +++    V           L+MELI +    EL  +F +     ++L       P  +P L  +  +  CL GST      F   N
Sbjct:  322 EAIALHCIIHQQALCSKCLKFDNVMSVVVKCINQIRSRSLKHRRFRALLEEMESEYGDVLYFTEVRWLSRGNILKRFFELRAEVKAFMEKDGVAVTVLSDPKWLMDLAFLVDITHELNVLNKKLQGQGQLVSAAYDNVRAFSAKLMLWKAQLSQTNFCHFPACK-ALMDAGTPFSGEKYVDAILMLQEEFDHRFADFKTHRATFQIFADPF-SFDVQDAPPV-----------LQMELIDLQCNSELRAKFREVSGKADKLGQFLRELPLSFPELSRMFKRTMCLFGSTYLCEKLFSTLN 608          

HSP 2 Score: 82.0333 bits (201), Expect = 5.116e-59
Identity = 60/176 (34.09%), Postives = 90/176 (51.14%), Query Frame = 2
Query: 1595 QQTFFKKQAGKNEVATLASFRVCKVLT-----------IKKNI*RW*IFKTSILRSWQL*LHCNYQRSEDSMA-------SDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTG 2068
            QQ FFKK   +N+ A  AS+ V +++            +KK I    +   SI+   +     N   S +++A       SD + QL         +S+ LDES D+ D AQLAI+VR V + F+V EELL ++ + G T  Q+I+  + D I    +   + V ITTDGAP++TG
Sbjct:  139 QQDFFKKATKENDAAVEASYVVSEMIAKAGKPFTEGEFVKKCI----LQAASIVCPEKKGQFSNISLSANTVAERISDLSSDIYDQLCEKAKRFSVYSVALDESTDITDTAQLAIYVRGVDDNFEVTEELLTVIPMHGQTTAQEIFHQLCDAIENAGLPWKRFVGITTDGAPSMTG 310          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000052542.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000549.1:35642:40620:1 gene:ENSAMXG00000033785.1 transcript:ENSAMXT00000052542.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 148.288 bits (373), Expect = 9.048e-54
Identity = 81/222 (36.49%), Postives = 124/222 (55.86%), Query Frame = 3
Query: 2115 PEFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQE---LSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSG 2771
             E   YHCIIHQ+ALC K L    +M  VV  +N IR ++L  R F+   + +   YG+++ H EVRWLS+G +L+ F  L  +I LFLE + ++   + N  W+ DLAFLTD+T  LN+LN+ LQ KD+ +  +  A+  F  KL L    L + +L HFP  +E   + +  +S  S   ++  L   F  RF  F   +  ++ +  PF +++ ET+ G
Sbjct:  274 AELKHYHCIIHQEALCGKHLQFKQIMDFVVSAVNFIRARSLNHREFQSFLEDISAAYGDVIYHTEVRWLSRGNVLKIFFALRNEIKLFLEQKGKDTLVMENTDWIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHFPTCQEAFAHKNYNWSRHSC--VLEDLKLAFSARFGQFRNEQATLQLLADPF-SVDTETVPG 492          

HSP 2 Score: 83.5741 bits (205), Expect = 9.048e-54
Identity = 62/205 (30.24%), Postives = 98/205 (47.80%), Query Frame = 2
Query: 1577 EKSLNYQQTFFKKQAGKNEVATLASFRV------------------------CKVLTIK-----KNI*RW*IFKTSILRSWQL*LHCNYQRSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKKN 2104
            +K L  QQ  F+K+  ++E  T+AS+R+                        C V+  +     KNI        S+ R+         QR    ++S+++ QL++ ++   YFS  LDES D  D AQL+IF+R V  T  V +EL  ++ L G T G +I+   K  +   N+   KL ++TTDGAP++ G    FI   K++
Sbjct:   78 KKQLVSQQGVFEKRRKESEACTIASYRIANLVAKSARPFIDGEFVKDCMLEACDVICPEAKDAFKNI--------SLSRT-------TIQRRIVDLSSNSYCQLQSRINDVTYFSAALDESTDNTDTAQLSIFIRGVTGTCQVYQELAALVPLYGRTTGFEIFNAFKTAVENLNLPWSKLSAVTTDGAPSMVGETNGFIGHLKRH 267          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000037725.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29162452:29166863:1 gene:ENSAMXG00000037303.1 transcript:ENSAMXT00000037725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.295 bits (386), Expect = 1.823e-53
Identity = 97/295 (32.88%), Postives = 154/295 (52.20%), Query Frame = 3
Query: 2115 PEFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQE---LSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMIELS*EFSKNQ----LEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYFQI 2978
             E   YHCIIHQ+ALC K L+   +M  VV  +N IR ++L+ R F    + +   YG+++ H EVRWLS+G +L+RF  L  +I LFLE + ++   + N  W+ DLAFLTD+T  LN+LN+ LQ KD+ +  +  A+  F  KL L    L + +L HFP  +E   + +  +S  S   ++  L   F  RF  F   +  ++ +  PF +++ ET+ G           +L+ E+I++   +   +K++    LEF   +    +P L   A K   + GST      F +
Sbjct:  462 AELKHYHCIIHQEALCGKHLHFKEIMDFVVSAVNFIRARSLKHREFPSFLEDISAAYGDVIYHTEVRWLSRGNVLKRFFALRNEIKLFLEQKGKDTLVMENTDWIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHFPTCQEAFAHKNYNWSRHSC--VLEDLKLAFSARFGQFRNEQATLQLLADPF-SVDTETVPG-----------ELQPEIIELKCSTAMRTKHREMPLLEFYQSLDREQFPNLFANAQKWISMFGSTYICEQMFSL 742          

HSP 2 Score: 77.7962 bits (190), Expect = 1.823e-53
Identity = 41/110 (37.27%), Postives = 65/110 (59.09%), Query Frame = 2
Query: 1775 MASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKKN 2104
            ++S+++ QL++ ++   YFS  LDES D  D AQL+IF+R V  T  V +EL  ++ L G T G +I+   K  +   N+   KL ++TTDGA ++ G    FI   K++
Sbjct:  346 LSSNSYCQLQSRINDVTYFSAALDESTDNTDTAQLSIFIRGVTGTCQVYQELAALVPLYGRTTGFEIFNAFKTAVENLNLPWSKLSAVTTDGALSVVGETNGFIGHLKRH 455          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Cavefish
Match: ENSAMXT00000035253.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111191579])

HSP 1 Score: 143.665 bits (361), Expect = 8.388e-52
Identity = 98/311 (31.51%), Postives = 150/311 (48.23%), Query Frame = 3
Query: 2073 IKILLHYVKKIKNYPEFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRH---QELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMIELS*EFSKNQ----LEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYFQI*N 2984
            + ++   ++K+  +   I+YHCIIHQ+ALC K L M++++  V+K +N IR + L  R F+     +D ++G++L H EVRWLS+     RF EL   I+LF++ +     ELS+  WL D A L DIT  L  LN  LQ + + +  M + +  F +KL L      +++L HFP  +         FSC      +S L  EF++RF DF   +        PF            +         L+MELI++   S   +K Q     +F   + P   P LR  A ++  + GST      F I N
Sbjct:  259 VGLMKGKMQKMNCHMPLITYHCIIHQEALCGKVLGMDNIVTTVMKTVNFIRARGLNHRQFQMFLQEIDSEHGDVLYHTEVRWLSRS----RFFELREDIALFMQSKGNPLSELSDPKWLCDFAVLCDITEHLAQLNQKLQGRKQVITQMSDMITAFQRKLDLWMCQAKQDNLAHFPVCQSMSALFPGTFSCAQLTTKLSRLKTEFDRRFSDFRGQQSGFAIFANPF------------TTDVCTAPQHLQMELIELQSDSGLRAKFQDAAIQDFYRLLPPGLMPQLRLHAARVLSMFGSTYLCEQMFSIMN 553          

HSP 2 Score: 81.6481 bits (200), Expect = 8.388e-52
Identity = 63/186 (33.87%), Postives = 89/186 (47.85%), Query Frame = 2
Query: 1586 LNYQQTFFKKQAGKNEVATLASFRVCKVLTIKKNI*RW*IF-KTSILRSW------QL*LHCNYQRSEDSMASDTFVQLKNNLDTCFY--------FSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCK 2098
            L  QQ  F K   KN  A  ASF V + +           F K  +L+        Q+    N   S +++A D   +L  NL T           FS+ +DES D  D AQLAIF+R V +   V E+LL +  + G T GQDI+  V+  +++N +  + LV +TTDGAPA+ G     + L K
Sbjct:   79 LKSQQNLFTKATAKNSAAVKASFIVAEEIARASKYFSGGAFLKQCMLKVCEQVCPDQIQTFKNVSLSRNTIA-DRVKELAENLATQLAEETRSYTAFSLAVDESTDNTDTAQLAIFIRGVKSDLSVTEDLLDVAAMHGTTTGQDIFDAVEKSVSKNALAWENLVGLTTDGAPAMCGEKNGLVGLMK 263          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Medaka
Match: ENSORLT00000033470.1 (pep primary_assembly:ASM223467v1:22:24335229:24337076:1 gene:ENSORLG00000028972.1 transcript:ENSORLT00000033470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.468 bits (550), Expect = 1.927e-87
Identity = 116/306 (37.91%), Postives = 183/306 (59.80%), Query Frame = 3
Query: 2091 YVKKIKN---YPEFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQELS---NVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSC-----ESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMI-ELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYF 2972
            ++ + KN   +P+F+ YHCIIHQQA+CAK    + VM  VVKIINSIR KA Q R+FK + D L  +YG+LLLH E+RWLS+G+IL+RF  LL +I  F++ + ++ S   +  W+ DLAFLTD+T  LN LN +LQ KDK V   I+A+  F  KL +    L +  + HFP+++  +N++ +  +      + Y  +++ L +EFE RF DF +++P V F+  PF+ +++ + +  +S  F  +   +EME++ +  +L  +  ++   F   V    Y  +   A+KI+C  GST      F
Sbjct:  263 FIAQCKNDPDFPKFLHYHCIIHQQAICAKVTGFDHVMTPVVKIINSIRSKAKQHRMFKMLMDELSAEYGDLLLHTEIRWLSRGRILQRFLSLLGEIKEFMKSKGEDTSLLEDPEWVLDLAFLTDLTGNLNHLNRELQGKDKTVAHTISAVNAFRAKLSIFSTQLQKKKMLHFPSVQAALNDNVSASAALNEAVKKYSQVINRLGQEFEDRFCDFEQLEPCVSFVTNPFMQVDVTSTAEQLSALFTLNAGDVEMEILTLQNDLLLKAHQSAPNFWCLVDQEKYSGVCTAAMKIACFFGSTYLCESAF 568          

HSP 2 Score: 107.457 bits (267), Expect = 1.927e-87
Identity = 80/203 (39.41%), Postives = 106/203 (52.22%), Query Frame = 2
Query: 1553 QKEEG*GSEKSLNYQQTFFKKQAGKNEVATLASFRVCKVLTIKKN-------------I*RW*IFK--------TSILRSWQL*LHCNYQRSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCK 2098
            + E+  G + +L+ Q+TFF + A K+  AT ASFR    L   K              +    IFK         S L   QL       R   S++ +   +L  +L  C +FS+Q DES+D    AQL IF+RMVF  F  +EELL +L L+  T G DIY  VK+F  E  + + KLVS+TTDGAPA+TG H  FIA CK
Sbjct:   67 RTEKARGLKAALDMQRTFFTRPAKKSHNATEASFRAAHFLIKNKKPFSDGEVLKEAMMLVANTIFKDEKYAPDVISTLSDVQL-GASTIARRVTSLSENLTEKLDRDLAACRWFSVQCDESVDSASTAQLMIFIRMVFEDFSTKEELLTLLPLKTTTRGVDIYTTVKNFFVEKKVPVQKLVSVTTDGAPAMTGRHVGFIAQCK 268          

HSP 3 Score: 42.3578 bits (98), Expect = 1.927e-87
Identity = 23/38 (60.53%), Postives = 30/38 (78.95%), Query Frame = 2
Query: 2954 LCESVFSNMKFMKN*YXXXXXXXXXDNCLRLAVTNYSP 3067
            LCES FSNM F+KN + T LT+ +L + LR+AV+NYSP
Sbjct:  563 LCESAFSNMNFIKNKHRTCLTDAHLQDSLRIAVSNYSP 600          

HSP 4 Score: 59.6918 bits (143), Expect = 1.244e-8
Identity = 46/131 (35.11%), Postives = 67/131 (51.15%), Query Frame = 3
Query: 1380 MAKKRKN-YHFHE----EFF-IYVND--ICIICYSSVAMYKRENLERHFNTKHENENTRFPLNSEIRKKKVEDXXXXXXXXXXXXXXXXXXXXXXX*HPFASAKF*LL-KKTFEDGEYLKQAFLEVGSYSF 1745
            M +KRK  YHF +    EFF    ND  +C+IC +++A+  R N+ERHF T H+N +  +P  S +R +K   LK    + +        K        F +A F +  KK F DGE LK+A + V +  F
Sbjct:    1 MTEKRKRVYHFQDDWEVEFFSTSFNDKCLCLICGTAIAVPMRHNVERHFKTCHKNFDANYPPGSALRTEKARGLKAALDMQRTFFTRPAKKSHNATEASFRAAHFLIKNKKPFSDGEVLKEAMMLVANTIF 131          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Medaka
Match: ENSORLT00000046355.1 (pep primary_assembly:ASM223467v1:21:4582475:4584322:1 gene:ENSORLG00000025904.1 transcript:ENSORLT00000046355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 213.386 bits (542), Expect = 5.150e-83
Identity = 115/306 (37.58%), Postives = 179/306 (58.50%), Query Frame = 3
Query: 2082 LLHYVKKIKNYPEFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQELS---NVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFS-----CESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMI-ELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYF 2972
             + + K+  ++P+F+ YHCIIHQQALCAK +    VM  VVKIIN+IR KA Q R+FK + + +  +YG+LLLH E+RWLS+G++L RF  LL +I  F++ + +++S   +  W  DLAFL DIT KLN LN  LQ K K V+ MI+A+  F  K+     +L    + HFP+++  + ++++         E Y+ +++ L +EFE RF D H+++P V FI  PF+N +    +  +S  F  D  Q+E+E+I +  +L  +  +    F   V    Y  +   A+K++ L GST      F
Sbjct:  263 FIAHCKRDPDFPKFLHYHCIIHQQALCAKVIGFGHVMTPVVKIINNIRSKAKQHRIFKVLLEEMSAEYGDLLLHTEIRWLSRGRVLHRFLSLLREIKEFMQSKGEDVSLLEDTEWTLDLAFLVDITGKLNLLNCQLQGKGKTVVDMISALNAFKAKMNAFSADLQRKKVLHFPSVQSVLKDNASASETFEKVAEKYIEVINRLGQEFENRFCDLHQLEPCVFFISNPFMNGDTTCFAEQLSATFNLDAGQVEIEIITLQNDLHLKAYQAAPNFWRLVDTEKYSGVCTAAMKVASLFGSTYLCESAF 568          

HSP 2 Score: 103.99 bits (258), Expect = 5.150e-83
Identity = 74/195 (37.95%), Postives = 104/195 (53.33%), Query Frame = 2
Query: 1583 SLNYQQTFFKKQAGKNEVATLASFRVCKVLTIKKN-------------I*RW*IFK--------TSILRSWQL*LHCNYQRSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKKN 2104
            +L  QQ+FF +    ++ A+ ASFR    L  KK              +    +FK         S L   QL       R   +M+S+   QL+ +L  C +FS+Q DES+D    AQL +F+RMVFN F  +EELL +L L+  T G DIY  VK+F  +  + L+KLV++TTDGAPA+ G    FIA CK++
Sbjct:   77 ALGKQQSFFTRPTKNSQKASEASFRATHFLIKKKKAFTDGEVVKEAMLLIANTVFKDEKNGSDLISTLSDVQL-GASTMARRVSAMSSNLVDQLEQDLAKCKWFSLQCDESVDSSSTAQLLVFIRMVFNDFSTKEELLTLLPLKTTTRGVDIYNTVKEFFVQKKVPLEKLVAVTTDGAPAMVGRQTGFIAHCKRD 270          

HSP 3 Score: 33.8834 bits (76), Expect = 5.150e-83
Identity = 19/38 (50.00%), Postives = 30/38 (78.95%), Query Frame = 2
Query: 2954 LCESVFSNMKFMKN*YXXXXXXXXXDNCLRLAVTNYSP 3067
            LCES FS+M F+KN + T+LT+ +L + L +AV++Y+P
Sbjct:  563 LCESAFSDMNFIKNKHRTRLTDAHLRDSLTVAVSSYTP 600          

HSP 4 Score: 64.6994 bits (156), Expect = 3.449e-10
Identity = 45/131 (34.35%), Postives = 68/131 (51.91%), Query Frame = 3
Query: 1380 MAKKRK-NYHFHEE-----FFIYVND--ICIICYSSVAMYKRENLERHFNTKHENENTRFPLNSEIRKKKVEDXXXXXXXXXXXXXXXXXXXXXXX*HPFASAKF*L-LKKTFEDGEYLKQAFLEVGSYSF 1745
            MA+KRK  Y FH E     FF  V +  +C+IC ++VA  KR N+ERHFNT H++ + ++P  S +R +K  +LK      +          +      F +  F +  KK F DGE +K+A L + +  F
Sbjct:    1 MAEKRKKTYLFHSEWEEEFFFTTVKETCVCLICGTTVATAKRHNVERHFNTCHKSYHDKYPPASALRAEKARELKTALGKQQSFFTRPTKNSQKASEASFRATHFLIKKKKAFTDGEVVKEAMLLIANTVF 131          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Medaka
Match: ENSORLT00000027093.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111947639])

HSP 1 Score: 142.124 bits (357), Expect = 5.175e-56
Identity = 97/289 (33.56%), Postives = 150/289 (51.90%), Query Frame = 3
Query: 2133 HCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLF-LEGRHQ--ELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EF-SKNQLEFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYFQI 2978
            HCIIHQ+ LC   L M  V+ +V K +N IR +AL  R F    +  + ++G++  H  VRWLS GK+L+   +L  +I  F ++  H   ELS+  W+ DL F  D+TA +N LNV LQ K   V  M +A++ F +KL  L   + +N+L H P LKE           + Y  ++ +L  EF +RF DF  ++  +  +  PF  I              +  ++++MELI++   + L+  F S + L+F S +   ++P LR  A KI  L GST +    F +
Sbjct:  264 HCIIHQEVLCKTVLKMKHVVDVVTKTVNFIRARALNHRQFVAFLEENEIEHGDIRYHCTVRWLSLGKVLKSVWDLRGQIQDFCVDKGHDVPELSDEDWVADLGFAVDVTALMNQLNVKLQSKGLFVHEMYSAVKAFMRKLQFLSSQVKDNNLTHLPTLKEAKRPEG---HLQKYSTMLEALHAEFSRRFQDFKTLESEMHVVSSPFNCI------------VDDAPSEVQMELIELQSDMLLAERFRSVSLLDFYSSLKKENFPHLRRHAQKILVLFGSTYHCEQAFSV 537          

HSP 2 Score: 73.9442 bits (180), Expect = 5.175e-56
Identity = 43/104 (41.35%), Postives = 64/104 (61.54%), Query Frame = 2
Query: 1757 QRSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTG 2068
            +R ED +A +  +QLK+       FS+ LDES D+ D AQL IF+R +   F + EEL  + +++G T GQD+++ V   ++   +  DKLV +TTDG P LTG
Sbjct:  138 RRIED-IAGNLELQLKSRAADFDCFSLALDESCDIRDTAQLLIFLRGITAEFQITEELAAMRSMKGTTTGQDLFREVNACLDMLELKWDKLVGVTTDGCPNLTG 240          

HSP 3 Score: 40.0466 bits (92), Expect = 5.175e-56
Identity = 36/106 (33.96%), Postives = 51/106 (48.11%), Query Frame = 3
Query: 1419 FFIYVND--ICIICYSSVAMYKRENLERHFNTKHENENTRFPLNSEIRKKKVEDXXXXXXXXXXXXXXXXXXXXXXX*HPFA-SAKF*LLKKTFEDGEYLKQAFLE 1727
            FF  V    +C+IC + VA++K  NL RH+ TKHE E  R  L+ E R K+ E L +     +       A     +   F  S K     K F DGE++K+  L+
Sbjct:   10 FFTEVKGEAVCLICGAKVAVFKDYNLNRHYTTKHE-EKYR-NLSDEERAKESEALLQKLQTQQGLLTKLHAPRNAAVRTSFVISHKIARNSKPFSDGEFVKECLLD 113          

HSP 4 Score: 25.0238 bits (53), Expect = 5.175e-56
Identity = 14/37 (37.84%), Postives = 23/37 (62.16%), Query Frame = 2
Query: 2957 CESVFSNMKFMKN*YXXXXXXXXXDNCLRLAVTNYSP 3067
            CE  FS MKF K+ + + +T+ +L   LR+A ++  P
Sbjct:  531 CEQAFSVMKFNKSKHRSSVTDDHLSAVLRIATSDIQP 567          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Medaka
Match: ENSORLT00000044825.1 (general transcription factor II-I repeat domain-containing protein 2-like [Source:NCBI gene;Acc:111949247])

HSP 1 Score: 162.54 bits (410), Expect = 1.317e-55
Identity = 109/303 (35.97%), Postives = 165/303 (54.46%), Query Frame = 3
Query: 2130 YHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQEL---SNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKE-EVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSKNQL-EFCSHVTPNHYPFLRDVALKISCLIGSTTYVNPYFQI*NS*RINIEQNL 3014
            YHCI+HQ+ LCAK + +  V++ VVKIIN IR KAL  R F+   D +D QY ++L H EVRWLS+G +L+RF EL   I+ FL    ++    ++  W+ D+AF+ DIT  LN+LNV LQ K++ +  + + ++ F  KL LL  +L   +  HFP+L++  V     P     Y  ++S+L +EF  RFVDF K    ++    PF +++ +++              L+MELI+     EL  +F    L +F  HV+   YP +R  A  +  L GST      F + N  +I +   L
Sbjct:  242 YHCILHQEQLCAKTIGLADVVRDVVKIINCIRSKALSHRQFRAFLDEVDAQYKDILYHQEVRWLSRGTVLKRFFELRQLIAEFLSSASRDTQIPTDKRWIFDVAFMVDITDLLNNLNVKLQGKEQIITELFDHIKAFQMKLQLLCRHLSAGNFAHFPSLRDVNVEVDRLP----EYGELLSNLNKEFNLRFVDFKKTAGDMELFSQPF-SVSPDSVP-----------EHLQMELIEFQCDTELRRKFVSLPLRDFYPHVSKQRYPQMRKNAQVMLSLFGSTYICEQTFSLMNLNKIKLRGTL 528          

HSP 2 Score: 75.485 bits (184), Expect = 1.317e-55
Identity = 37/88 (42.05%), Postives = 54/88 (61.36%), Query Frame = 2
Query: 1829 FSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIAL 2092
            FS+  DES D+ D AQL +FVR +    ++ +EL  + TL G T G+D++  V   +++ N+  DK+V ITTDGAPA+ G      AL
Sbjct:  140 FSLACDESTDISDSAQLLVFVRGINADMEITQELAGLETLRGTTKGEDLFAAVSRVLDKYNLSWDKMVGITTDGAPAMIGKKAGLTAL 227          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Medaka
Match: ENSORLT00000033718.1 (general transcription factor II-I repeat domain-containing protein 2 [Source:NCBI gene;Acc:110015985])

HSP 1 Score: 144.436 bits (363), Expect = 4.968e-53
Identity = 82/244 (33.61%), Postives = 129/244 (52.87%), Query Frame = 3
Query: 2118 EFISYHCIIHQQALCAKFL--NMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRH---QELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFV----NINIETLSGVISNQFGNDKAQLEMEL 2822
            + +++HCI+HQ+ALCA+        VM LV++I+N I    L  R F+ + D LD  Y +LLLH +VRWLS+G +L+RF   L ++ +FL  +     EL    W   L F+ D+TA LN LN  LQ K    + M+  +  F +KL +   +L    L HFP L+ E   +    + +    +++++   F KRF +F + K  + F + P       +N+   +GV+S      +  LEMEL
Sbjct:  276 KLLTFHCILHQEALCAQTFPPECTQVMDLVIQIVNKIMANGLNHRQFRSLLDELDSAYSDLLLHNKVRWLSRGVVLKRFAACLEEVKVFLSNKGLTFPELEQPEWQEKLHFMVDMTAHLNTLNTSLQGKGGTALHMLEEVLGFERKLTVFATDLKRGTLYHFPALR-EFQQAGNAINSQYLKSVITAMQTSFGKRFCEFRQEKHTLSFPVTPLTIDPSQLNMTAFAGVVS------QPDLEMEL 512          

HSP 2 Score: 62.3882 bits (150), Expect = 4.968e-53
Identity = 34/111 (30.63%), Postives = 64/111 (57.66%), Query Frame = 2
Query: 1772 SMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKKN 2104
            +MA +   Q   ++++   +++  + S D  D  Q+A+F R V +    +EE+++++ L+G T G+DI + V   +    I    LV + +DGAP++TG  K F+AL +K+
Sbjct:  163 NMAENVTRQQIEDINSALAYAIACNMSKDKNDIEQIALFCRYV-SAAGPQEEMIELIPLKGQTRGEDICEAVLHCLRTKEIKTTHLVPVASDGAPSMTGAQKGFVALLQKS 272          

HSP 3 Score: 43.5134 bits (101), Expect = 4.968e-53
Identity = 32/105 (30.48%), Postives = 54/105 (51.43%), Query Frame = 3
Query: 1440 ICIICYSSVAMYKRENLERHFNTKHENENTRFPLNSEIRKKKVEDXXXXXXXXXXXXXXXXXXXXXXX*HPFASAKF*LLK--KTFEDGEYLKQAFLEVGSYSFT 1748
            +C+IC   +A  K+ N+ RHF  KH     ++P   E RKK V +L +   +++   K  +          F  A+  ++K  K F DGEYLK+ F+++  + F+
Sbjct:   33 VCLICGEILANDKKSNVARHFENKHSAFAKKYPKGEE-RKKAVSELMQKADVSRSHFKKWIKTGNSTTCTSFVVAQE-IVKHGKPFTDGEYLKETFIKISKHLFS 135          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Planmine SMEST
Match: SMESG000062458.1 (SMESG000062458.1)

HSP 1 Score: 429.869 bits (1104), Expect = 4.923e-144
Identity = 224/224 (100.00%), Postives = 224/224 (100.00%), Query Frame = 2
Query:   68 MGWELKRREVKSIFPLDGCLCFDNRMGCFIGALTTAFTSAFSLILIILDVSEWLDRSFKISGGFPADWRQTFWKGFVLCDIAMLIAHPXXXXXXXXXXXXXXXPAKCKIYDLHPQVRSWCIIMFCYIITELGVSFYIFSWYGLAAWRRPYLIFLIMFYILRSISNVAFLIVGYSYKCEIYQELKTPTDAVDNEFDYMSRVTSHKAPSQIFSGSYISPIGSNQVV 739
            MGWELKRREVKSIFPLDGCLCFDNRMGCFIGALTTAFTSAFSLILIILDVSEWLDRSFKISGGFPADWRQTFWKGFVLCDIAMLIAHPIMLVISLILSVSILSPAKCKIYDLHPQVRSWCIIMFCYIITELGVSFYIFSWYGLAAWRRPYLIFLIMFYILRSISNVAFLIVGYSYKCEIYQELKTPTDAVDNEFDYMSRVTSHKAPSQIFSGSYISPIGSNQVV
Sbjct:    1 MGWELKRREVKSIFPLDGCLCFDNRMGCFIGALTTAFTSAFSLILIILDVSEWLDRSFKISGGFPADWRQTFWKGFVLCDIAMLIAHPIMLVISLILSVSILSPAKCKIYDLHPQVRSWCIIMFCYIITELGVSFYIFSWYGLAAWRRPYLIFLIMFYILRSISNVAFLIVGYSYKCEIYQELKTPTDAVDNEFDYMSRVTSHKAPSQIFSGSYISPIGSNQVV 224          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Planmine SMEST
Match: SMESG000037770.1 (SMESG000037770.1)

HSP 1 Score: 84.3445 bits (207), Expect = 4.507e-42
Identity = 65/191 (34.03%), Postives = 97/191 (50.79%), Query Frame = 2
Query: 1580 KSLNYQQTFFKKQAGKNEVATLASFRVC-KVLTIKKNI*RW*IFKTSILRSWQL*LHCNYQRSE-------------DSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKKNKK 2110
            +SL  +QT F K +   E AT AS  +  K++   K        K  +L    +    N ++ E             +S+A D   QL N + T  +FS+ LDES D+ D AQL IF+R + + F   EELL +  L+  T GQD++  +   +++  + LDKL S+TTDGAP+LTG +   I   K + K
Sbjct:  599 RSLKQEQTIFLKPSSIQEAATKASLVIAHKIVKHNKPFSEGEFVKDCVLEIADIICPENKKKFENISLSRRTVVRRIESIAEDLSDQLLNKIKTFQWFSIALDESTDIQDTAQLLIFIRGIDDKFIATEELLSMEHLKDTTTGQDLFDNLIKALDKFELPLDKLASVTTDGAPSLTGKNVGLITKIKDHVK 789          

HSP 2 Score: 83.5741 bits (205), Expect = 4.507e-42
Identity = 57/166 (34.34%), Postives = 82/166 (49.40%), Query Frame = 3
Query: 2091 YVKKIKNYPEFISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRH------QELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIE 2570
            +VK +      I  HCIIHQ++LC   L+ N+++ L            LQ   FK   + L+  + ++L H  VRWLS GK+L+R   L  +I LFLE +        ++    WL D +F  DI  KLN+LNV LQ K      +   ++ F  KL L   +L E
Sbjct:  787 HVKNLHPDHTIIPLHCIIHQESLCKSVLDFNTLLTL------------LQ---FKSFLEDLESDHSDVLYHTNVRWLSLGKVLKRVWNLKDEIVLFLEMKDITVEFTTQMKTSEWLSDFSFAVDILDKLNELNVKLQGKGVFAHELFAEVKSFQVKLQLFSRHLKE 937          

HSP 3 Score: 45.0542 bits (105), Expect = 4.507e-42
Identity = 23/49 (46.94%), Postives = 32/49 (65.31%), Query Frame = 3
Query: 1425 IYVNDICIICYSSVAMYKRENLERHFNTKHENENTRFPLN---SEIRKK 1562
            I  N +C+IC  SVA++K  NL+RHF TKH N    F +N   +E+R+K
Sbjct:  549 IKTNAVCLICRESVAVFKEYNLKRHFQTKHGN----FGINLNETELRRK 593          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Planmine SMEST
Match: SMESG000045419.1 (SMESG000045419.1)

HSP 1 Score: 95.9005 bits (237), Expect = 5.523e-33
Identity = 78/278 (28.06%), Postives = 127/278 (45.68%), Query Frame = 3
Query: 2130 YHCIIHQQALCAKFLN-MNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLFLEGRHQELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTPFSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVISNQFGNDKAQLEMELIKMIE---LS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGST 2951
            +HCIIHQ++LC   L+ M  +M  ++  +N IR   L+ R FK     +D ++ +++ +  VRWLS+G +LRR   L                  + +  LAF+ DIT  LN+LN++LQ K K +  +   +  F  KL LLK ++IE +L HF   K      S P   + +     +        F+DFH     ++  + PF N++I  +             +L+ME++++     L   F    ++      P  Y  L   A K+    GST
Sbjct:  255 FHCIIHQESLCCTILSSMKDIMNTLISTVNYIRRHGLKHRQFKKFLKEIDSEFNDVIYYSAVRWLSRGAVLRRKYYL------------------TAIGSLAFMVDITTYLNELNLNLQGKGKLLADLFCDINAFEAKLCLLKKHMIEENLTHFICCK------SVP--ADGWQTQKGTF-------FMDFHNKSSEIRLFLNPF-NVDINDVPN-----------ELQMEILQLQHNEILKNAFLLENIQHFYRCLPKQYEGLISFAKKMIVAFGST 487          

HSP 2 Score: 65.855 bits (159), Expect = 5.523e-33
Identity = 35/103 (33.98%), Postives = 59/103 (57.28%), Query Frame = 2
Query: 1760 RSEDSMASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVREELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTG 2068
            R  + + ++ F QLK    +   +S+ +DES+D+ D AQL IF+R +   F+V EEL  + +L+    G D++  VK+ +N   +  +KL  +TTDG   + G
Sbjct:  129 RRVEEIGTNLFEQLKCKAKSFDCYSLAMDESIDITDTAQLIIFIRGIDGDFNVHEELTSLCSLKDAITGNDLFIKVKETLNSLELRWEKLKCVTTDGGRNMCG 231          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Planmine SMEST
Match: SMESG000025120.1 (SMESG000025120.1)

HSP 1 Score: 107.071 bits (266), Expect = 4.754e-32
Identity = 70/168 (41.67%), Postives = 97/168 (57.74%), Query Frame = 3
Query: 2121 FISYHCIIHQQALCAKFLNMNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSKGKILRRFRELLPKISLF---LEGRHQELSNVSWLRDLAFLTDITAKLNDLNVDLQEKDKNV------MLMIN-AMQCFGQKLILLKMNLIENDLKHFPN 2594
            F +   I+HQ+ALC K L     +K+V KIINSIR   LQ RLFK + +  + +  +L+LH EV WLSKGKIL RF  L+ +I  F   ++  + EL++   L DL FLTDI  K       +  KDKN+      + ++N A++ F  KL LL  +L  N L HFP+
Sbjct:  402 FQTLRPIMHQEALCCKILPFEHDIKIVTKIINSIRAAPLQHRLFKTLLEDTEDKEHDLILHTEVSWLSKGKILTRFVSLIEEIKTFINDIKENYDELADSHRLIDLRFLTDIMEKFEFFKFGVARKDKNIADKVIAIPILNIAVKSFKAKLDLLISHLHINSLVHFPH 569          

HSP 2 Score: 51.6026 bits (122), Expect = 4.754e-32
Identity = 23/59 (38.98%), Postives = 36/59 (61.02%), Query Frame = 2
Query: 1925 ELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMHKDFIALCKK 2101
            ++L+IL  +G   G+DIY   + +    N+ L KL +ITTDGAPA+ G  KD +   ++
Sbjct:  340 DMLQILPRKGQARGEDIYNTFRIYAKSINMPLHKLFAITTDGAPAMVGKKKDLLTSARR 398          
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Planmine SMEST
Match: SMESG000031560.1 (SMESG000031560.1)

HSP 1 Score: 120.168 bits (300), Expect = 5.110e-32
Identity = 63/77 (81.82%), Postives = 65/77 (84.42%), Query Frame = 3
Query: 2730 MYPFVNINIETLSGVISNQFGNDKAQLEMELIKM---IELS*EFSKNQLEFCSHVTPNHYPFLRDVALKISCLIGST 2951
            M PFVNINIETLS VISNQFG DKAQLEMELI +   IELS E+SKNQLEF SHVTPN YPFLRDVA KISCL GST
Sbjct:    1 MDPFVNINIETLSEVISNQFGYDKAQLEMELISIQNEIELSCEYSKNQLEFWSHVTPNQYPFLRDVASKISCLFGST 77          
The following BLAST results are available for this feature:
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GTF2IRD21.494e-4734.69GTF2I repeat domain containing 2 [Source:HGNC Symb... [more]
GTF2IRD22.027e-4734.69GTF2I repeat domain containing 2 [Source:HGNC Symb... [more]
GTF2IRD2B1.594e-4634.69GTF2I repeat domain containing 2B [Source:HGNC Sym... [more]
GTF2IRD2B2.091e-4634.69GTF2I repeat domain containing 2B [Source:HGNC Sym... [more]
ZBED98.881e-3330.45zinc finger BED-type containing 9 [Source:HGNC Sym... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CR392001.39.561e-5134.58pep chromosome:GRCz11:8:38963323:38965260:-1 gene:... [more]
AL928808.18.990e-4435.97pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
CR762475.15.326e-729.60pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000016563.16.242e-5635.27pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
spag18.486e-5234.25sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
ENSXETT00000028445.12.051e-3032.07general transcription factor II-I repeat domain-co... [more]
ENSXETT00000010836.14.739e-1047.95pep primary_assembly:Xenopus_tropicalis_v9.1:7:638... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gtf2ird21.078e-4334.87GTF2I repeat domain containing 2 [Source:MGI Symbo... [more]
Zbed54.942e-2834.52zinc finger, BED type containing 5 [Source:MGI Sym... [more]
Zmym66.884e-2429.50zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Zmym67.526e-2429.50zinc finger, MYM-type 6 [Source:MGI Symbol;Acc:MGI... [more]
Epm2aip13.110e-1322.22EPM2A (laforin) interacting protein 1 [Source:MGI ... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q86UP8|GTD2A_HUMAN6.639e-4734.69General transcription factor II-I repeat domain-co... [more]
sp|A4IFA3|GT2D2_BOVIN8.724e-4734.72General transcription factor II-I repeat domain-co... [more]
sp|Q6EKJ0|GTD2B_HUMAN7.081e-4634.69General transcription factor II-I repeat domain-co... [more]
sp|Q99NI3|GT2D2_MOUSE6.578e-4334.87General transcription factor II-I repeat domain-co... [more]
sp|Q6R2W3|SCND3_HUMAN5.173e-3230.45SCAN domain-containing protein 3 OS=Homo sapiens O... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q2R0581.427e-10040.42Uncharacterized protein OS=Fundulus heteroclitus O... [more]
A0A3P9D7F12.483e-8539.93Uncharacterized protein OS=Maylandia zebra OX=1065... [more]
A0A3B3HZV53.009e-8437.91Uncharacterized protein OS=Oryzias latipes OX=8090... [more]
A0A498MQH63.780e-8340.94General transcription factor II-I repeat domain-co... [more]
A0A498NXL41.516e-8240.60General transcription factor II-I repeat domain-co... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039226.15.013e-8442.03pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030525.15.116e-5936.33pep primary_assembly:Astyanax_mexicanus-2.0:1:1299... [more]
ENSAMXT00000052542.19.048e-5436.49pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000037725.11.823e-5332.88pep primary_assembly:Astyanax_mexicanus-2.0:14:291... [more]
ENSAMXT00000035253.18.388e-5231.51general transcription factor II-I repeat domain-co... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033470.11.927e-8737.91pep primary_assembly:ASM223467v1:22:24335229:24337... [more]
ENSORLT00000046355.15.150e-8337.58pep primary_assembly:ASM223467v1:21:4582475:458432... [more]
ENSORLT00000027093.15.175e-5633.56general transcription factor II-I repeat domain-co... [more]
ENSORLT00000044825.11.317e-5535.97general transcription factor II-I repeat domain-co... [more]
ENSORLT00000033718.14.968e-5333.61general transcription factor II-I repeat domain-co... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing 2A-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000062458.14.923e-144100.00SMESG000062458.1[more]
SMESG000037770.14.507e-4234.03SMESG000037770.1[more]
SMESG000045419.15.523e-3328.06SMESG000045419.1[more]
SMESG000025120.14.754e-3241.67SMESG000025120.1[more]
SMESG000031560.15.110e-3281.82SMESG000031560.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031645 ID=SMED30031645|Name=General transcription factor II-I repeat domain-containing 2A-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3098bp
AAAACATTTTAAAATTATTTCCTAATTAAAATTATTTTCGATTTCTTATT
AAATATTATACAATAAAATGGGATGGGAACTTAAACGGCGTGAAGTAAAA
TCTATTTTCCCGTTAGATGGATGCTTATGCTTTGATAATAGAATGGGATG
TTTTATAGGTGCACTGACAACTGCTTTTACCAGTGCATTTTCATTAATTT
TAATTATTCTTGACGTTTCTGAGTGGCTTGATAGATCGTTCAAAATAAGT
GGAGGCTTCCCCGCTGACTGGCGTCAAACATTTTGGAAAGGATTTGTTCT
TTGTGATATTGCAATGTTAATTGCGCATCCTATTATGCTCGTTATTTCAT
TAATTTTATCGGTTTCAATTCTCAGTCCAGCTAAATGCAAAATTTATGAT
TTACATCCTCAAGTACGCTCTTGGTGCATCATAATGTTTTGTTATATAAT
AACGGAGCTTGGAGTTAGTTTTTATATATTTTCTTGGTACGGATTGGCCG
CTTGGAGAAGACCATATCTAATATTTTTAATCATGTTTTATATTTTACGA
AGCATTTCTAACGTGGCATTTCTAATTGTCGGCTATTCATATAAATGCGA
AATCTATCAAGAACTAAAGACTCCTACAGATGCAGTTGACAATGAATTTG
ATTACATGAGTAGGGTTACAAGTCATAAAGCTCCTTCACAAATATTTTCT
GGTTCATATATATCCCCAATAGGATCAAATCAAGTTGTTTAAATCTAAAG
ATTGAACTGTGTTATATCTATATCTTTTTCAATGTAATCTTTAATGTTTA
ATTTTAATTCACTCTTTTGGTTTCGCGCTTTAAAATTGTATAAAATAATC
TTGTATTGTTTACAAGATATTTTTTTCCATTAATTACATATCAAACTATC
AAACATCTCCTAAACTTTGTATTGTGCTTTATTTTGATATTTTTGTAGAT
ATTTGATTAATATAAAACACATGGTAATTTTAAGTGTTGTGTGTATTTAT
TTTTATTTAAAATTTAGATATCTGCAGTTAATGGTAAGTATAAAACAGGA
GTCGGCAAATGGTCGATCGCGAACGATTTCGACGTCGATTGCGGAGTACT
TGAAGAATTGGTTTTATGTGTATAAAAATATTTTTTTGTGAATTTAAAAT
TTTTCTTACTAAATATTTTTTTTAAATTCAAATTTTAAAAAAGTTACGTT
CACAATTTTAGATTATAGTAGACTTGTGTTTTTGTTCTTTAAAAAAGTAA
ACAAGATTAAAGTTTTTTTAGTTTTAGTTTGAAATACAATGTTAAAGAGA
GCGTCGAGAATTTAATTTAAAACTAATTTATTATATAAAATTATTAAAAA
AAATTGTGAAAATCAGTGAGGCCGTAACCATGGCGAAAAAAAGAAAAAAC
TATCATTTTCATGAAGAATTTTTTATATATGTTAATGATATTTGCATAAT
ATGCTACTCCAGCGTTGCAATGTATAAAAGAGAAAACCTTGAAAGACATT
TCAATACGAAACATGAAAATGAAAACACGAGGTTTCCTCTTAATAGTGAA
ATCAGAAAGAAGAAGGTTGAGGATCTGAAAAAAGTCTAAATTATCAACAA
ACTTTCTTCAAAAAGCAAGCTGGCAAAAATGAAGTTGCTACTCTAGCATC
CTTTCGCGTCTGCAAAGTTTTGACTATTAAAAAAAACATTTGAAGATGGT
GAATATTTAAAACAAGCATTCTTAGAAGTTGGCAGCTATAGCTTCACTGC
AATTATCAGCGCAGTGAAGACTCGATGGCTTCTGATACATTTGTTCAGTT
AAAAAACAATCTAGATACTTGCTTTTATTTTTCGATGCAACTTGACGAAA
GTTTAGATGTGGTTGATAAAGCTCAGTTGGCCATTTTTGTGCGTATGGTG
TTTAACACTTTTGACGTGAGAGAAGAACTTTTAAAAATATTAACCCTTGA
AGGACCTACATTAGGCCAGGATATTTATCAAATCGTTAAGGATTTCATAA
ATGAAAATAATATATGTTTGGATAAATTGGTAAGTATCACTACTGATGGA
GCTCCAGCGTTAACTGGTATGCATAAAGATTTTATTGCATTATGTAAAAA
AAATAAAAAATTATCCTGAATTCATAAGTTATCACTGTATAATACATCAG
CAAGCCCTTTGTGCTAAATTTTTGAACATGAATTCTGTTATGAAACTTGT
AGTCAAAATTATTAATTCTATAAGAGGAAAAGCACTGCAAAGACGTTTAT
TTAAAGGAGTAACCGACGTGCTCGATTGTCAATATGGTAATCTATTATTA
CATATAGAAGTTCGTTGGCTAAGTAAGGGGAAAATTTTAAGGCGTTTTAG
AGAATTGTTACCAAAAATAAGTTTATTTTTAGAAGGACGTCATCAGGAGC
TAAGCAATGTTTCATGGCTTAGAGATCTTGCATTTCTTACTGATATTACG
GCGAAGTTAAATGACTTGAATGTAGATTTGCAAGAGAAAGATAAAAATGT
AATGCTCATGATAAATGCGATGCAATGTTTTGGCCAAAAATTAATCTTGT
TAAAAATGAACCTAATAGAAAATGATTTAAAACACTTCCCTAATTTAAAA
GAAGAGGTTAATAATAGTTCAACTCCTTTTTCCTGTGAGAGTTATTTACC
AATTGTTAGTAGTTTAATAGAAGAGTTTGAAAAACGCTTCGTAGATTTCC
ACAAGGTCAAACCAATTGTGAAATTTATTATGTATCCTTTCGTAAATATT
AATATTGAAACTCTCTCGGGAGTTATTAGTAACCAATTTGGAAACGATAA
AGCACAGCTAGAAATGGAATTAATTAAAATGATAGAGTTGAGTTGAGAAT
TTTCTAAAAATCAATTGGAATTTTGTAGCCATGTAACACCGAATCACTAT
CCGTTTTTAAGAGATGTTGCATTAAAAATATCTTGCCTCATTGGATCAAC
GACTTATGTGAATCCGTATTTTCAAATATGAAATTCATGAAGAATTAATA
TTGAACAAAACTTACCAATAAAAATCTGGATAATTGTTTAAGATTGGCTG
TTACAAACTATTCTCCCGGTATGCAGAAATATATTGGATGAAAAACAA
back to top

protein sequence of SMED30031645-orf-1

>SMED30031645-orf-1 ID=SMED30031645-orf-1|Name=SMED30031645-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=225bp
MGWELKRREVKSIFPLDGCLCFDNRMGCFIGALTTAFTSAFSLILIILDV
SEWLDRSFKISGGFPADWRQTFWKGFVLCDIAMLIAHPIMLVISLILSVS
ILSPAKCKIYDLHPQVRSWCIIMFCYIITELGVSFYIFSWYGLAAWRRPY
LIFLIMFYILRSISNVAFLIVGYSYKCEIYQELKTPTDAVDNEFDYMSRV
TSHKAPSQIFSGSYISPIGSNQVV*
back to top

protein sequence of SMED30031645-orf-2

>SMED30031645-orf-2 ID=SMED30031645-orf-2|Name=SMED30031645-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=115bp
MASDTFVQLKNNLDTCFYFSMQLDESLDVVDKAQLAIFVRMVFNTFDVRE
ELLKILTLEGPTLGQDIYQIVKDFINENNICLDKLVSITTDGAPALTGMH
KDFIALCKKNKKLS*
back to top

protein sequence of SMED30031645-orf-3

>SMED30031645-orf-3 ID=SMED30031645-orf-3|Name=SMED30031645-orf-3|organism=Schmidtea mediterranea sexual|type=polypeptide|length=223bp
MNSVMKLVVKIINSIRGKALQRRLFKGVTDVLDCQYGNLLLHIEVRWLSK
GKILRRFRELLPKISLFLEGRHQELSNVSWLRDLAFLTDITAKLNDLNVD
LQEKDKNVMLMINAMQCFGQKLILLKMNLIENDLKHFPNLKEEVNNSSTP
FSCESYLPIVSSLIEEFEKRFVDFHKVKPIVKFIMYPFVNINIETLSGVI
SNQFGNDKAQLEMELIKMIELS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000231vitelline gland
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR012337RNaseH-like_sf
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046983protein dimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 81..103
NoneNo IPR availableTMHMMTMhelixcoord: 26..48
NoneNo IPR availableTMHMMTMhelixcoord: 153..175
NoneNo IPR availableTMHMMTMhelixcoord: 116..138