Translation machinery-associated protein 7-like protein
Overview
Neoblast Clusters
Zeng et. al., 2018▻ Overview▻ Neoblast Population▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Overview
Single cell RNA-seq of pluripotent neoblasts and its early progeniesWe isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)Explore this single cell expression dataset with our NB Cluster Shiny App
Neoblast Population
Sub-lethal Irradiated Surviving X1 and X2 Cell Population
Embryonic Expression
Davies et. al., 2017
Hover the mouse over a column in the graph to view average RPKM values per sample. Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult. back to top Anatomical Expression
PAGE et. al., 2020SMED30031644 has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGEPAGE Curations: 4
Homology
BLAST of Translation machinery-associated protein 7-like protein vs. TrEMBL
Match: T1JPN2 (Uncharacterized protein OS=Tetranychus urticae OX=32264 PE=4 SV=1) HSP 1 Score: 54.6842 bits (130), Expect = 2.774e-7 Identity = 30/44 (68.18%), Postives = 38/44 (86.36%), Query Frame = 3 Query: 105 DLDEEDLRLKQKQKDEQKALAEAKVKAASRGPIGQGNKKISGKK 236 D+DE+DL LKQK ++EQKAL EA+ KA+SRGPIG G+KK+ GKK Sbjct: 21 DVDEDDLALKQKLREEQKALKEAQAKASSRGPIGVGSKKL-GKK 63
BLAST of Translation machinery-associated protein 7-like protein vs. TrEMBL
Match: A0A0B6YRK7 (Uncharacterized protein OS=Arion vulgaris OX=1028688 GN=ORF34420 PE=4 SV=1) HSP 1 Score: 53.5286 bits (127), Expect = 8.340e-7 Identity = 28/44 (63.64%), Postives = 34/44 (77.27%), Query Frame = 3 Query: 105 DLDEEDLRLKQKQKDEQKALAEAKVKAASRGPIGQGNKKISGKK 236 D+DE+D KQKQ+DEQKAL +A VKA+SRGP+ G K SGKK Sbjct: 21 DVDEDDAAFKQKQRDEQKALKDAAVKASSRGPLTTGGIKKSGKK 64 The following BLAST results are available for this feature:
BLAST of Translation machinery-associated protein 7-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99) Total hits: 0
BLAST of Translation machinery-associated protein 7-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99) Total hits: 0
BLAST of Translation machinery-associated protein 7-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99) Total hits: 0
BLAST of Translation machinery-associated protein 7-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99) Total hits: 0
BLAST of Translation machinery-associated protein 7-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99) Total hits: 0
BLAST of Translation machinery-associated protein 7-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99) Total hits: 0
BLAST of Translation machinery-associated protein 7-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt) Total hits: 0
BLAST of Translation machinery-associated protein 7-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL) Total hits: 2
BLAST of Translation machinery-associated protein 7-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99) Total hits: 0
BLAST of Translation machinery-associated protein 7-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99) Total hits: 0
BLAST of Translation machinery-associated protein 7-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46) Total hits: 0
BLAST of Translation machinery-associated protein 7-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46) Total hits: 0
BLAST of Translation machinery-associated protein 7-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99) Total hits: 0
BLAST of Translation machinery-associated protein 7-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST) Total hits: 0
Analyses
This transcript is derived from or has results from the following analyses Sequences
The following sequences are available for this feature:
transcript sequence >SMED30031644 ID=SMED30031644|Name=Translation machinery-associated protein 7-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=456bpback to top Annotated Terms
The following terms have been associated with this transcript:
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
|