enkurin isoform X1

Overview
Nameenkurin isoform X1
Smed IDSMED30031633
Length (bp)865
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of enkurin isoform X1 (SMED30031633) t-SNE clustered cells

Violin plots show distribution of expression levels for enkurin isoform X1 (SMED30031633) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of enkurin isoform X1 (SMED30031633) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for enkurin isoform X1 (SMED30031633) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031633

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30031633SMESG000076528.1 SmedASXL_009918SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031633SMESG000076528.1 dd_Smed_v4_2868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031633SMESG000076528.1 dd_Smed_v4_2868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031633SMESG000076528.1 dd_Smed_v4_2868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031633SMESG000076528.1 dd_Smed_v4_2868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
epidermal cellSMED30031633SMESG000076528.1 dd_Smed_v4_2868_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031633SMESG000076528.1 dd_Smed_v6_2868_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30031633SMESG000076528.1 dd_Smed_v4_2868_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30031633SMESG000076528.1 dd_Smed_v4_2868_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30031633SMESG000076528.1 dd_Smed_v4_2868_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30031633SMESG000076528.1 dd_Smed_v4_2868_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of enkurin isoform X1 vs. Ensembl Human
Match: ENKUR (enkurin, TRPC channel interacting protein [Source:HGNC Symbol;Acc:HGNC:28388])

HSP 1 Score: 210.69 bits (535), Expect = 4.946e-67
Identity = 123/256 (48.05%), Postives = 165/256 (64.45%), Query Frame = 3
Query:   51 ENILNLIP-------QPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKK-KEEKPNAEKVPCDFHNEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            E I NLIP       QPP        Y S FK+TVKD+ +K+K   KTMG  +     PKDFLKK  +EK    K   D  N  +KP VP   + P  MGI++ KNFI  N+ D IM V+KKP+   VD R GDK  LE SGL   Y  KKDYG TPEY+ +R EE++K Q++YD Y++E  ++  M RLS+EE + +L GLK NWE +++++QSLSV +D+IPKK RK+ +E EMK+LE DI ++E+++ IY+AN
Sbjct:    8 ECIYNLIPSDLKEPPQPP-------RYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPKDFLKKHSKEKTLPPKKNFD-RNVPKKPAVPLKTDHPV-MGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSGLVPKYINKKDYGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSIPKKIRKQRLEEEMKQLEHDIGIIEKHKIIYIAN 254          
BLAST of enkurin isoform X1 vs. Ensembl Human
Match: ENKUR (enkurin, TRPC channel interacting protein [Source:HGNC Symbol;Acc:HGNC:28388])

HSP 1 Score: 210.69 bits (535), Expect = 4.946e-67
Identity = 123/256 (48.05%), Postives = 165/256 (64.45%), Query Frame = 3
Query:   51 ENILNLIP-------QPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKK-KEEKPNAEKVPCDFHNEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            E I NLIP       QPP        Y S FK+TVKD+ +K+K   KTMG  +     PKDFLKK  +EK    K   D  N  +KP VP   + P  MGI++ KNFI  N+ D IM V+KKP+   VD R GDK  LE SGL   Y  KKDYG TPEY+ +R EE++K Q++YD Y++E  ++  M RLS+EE + +L GLK NWE +++++QSLSV +D+IPKK RK+ +E EMK+LE DI ++E+++ IY+AN
Sbjct:    8 ECIYNLIPSDLKEPPQPP-------RYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPKDFLKKHSKEKTLPPKKNFD-RNVPKKPAVPLKTDHPV-MGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSGLVPKYINKKDYGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSIPKKIRKQRLEEEMKQLEHDIGIIEKHKIIYIAN 254          
BLAST of enkurin isoform X1 vs. Ensembl Human
Match: ENKUR (enkurin, TRPC channel interacting protein [Source:HGNC Symbol;Acc:HGNC:28388])

HSP 1 Score: 210.69 bits (535), Expect = 5.173e-67
Identity = 123/256 (48.05%), Postives = 165/256 (64.45%), Query Frame = 3
Query:   51 ENILNLIP-------QPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKK-KEEKPNAEKVPCDFHNEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            E I NLIP       QPP        Y S FK+TVKD+ +K+K   KTMG  +     PKDFLKK  +EK    K   D  N  +KP VP   + P  MGI++ KNFI  N+ D IM V+KKP+   VD R GDK  LE SGL   Y  KKDYG TPEY+ +R EE++K Q++YD Y++E  ++  M RLS+EE + +L GLK NWE +++++QSLSV +D+IPKK RK+ +E EMK+LE DI ++E+++ IY+AN
Sbjct:    8 ECIYNLIPSDLKEPPQPP-------RYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPKDFLKKHSKEKTLPPKKNFD-RNVPKKPAVPLKTDHPV-MGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSGLVPKYINKKDYGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSIPKKIRKQRLEEEMKQLEHDIGIIEKHKIIYIAN 254          
BLAST of enkurin isoform X1 vs. Ensembl Human
Match: ENKUR (enkurin, TRPC channel interacting protein [Source:HGNC Symbol;Acc:HGNC:28388])

HSP 1 Score: 179.104 bits (453), Expect = 1.931e-55
Identity = 89/175 (50.86%), Postives = 125/175 (71.43%), Query Frame = 3
Query:  270 NEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            N  +KP VP   + P  MGI++ KNFI  N+ D IM V+KKP+   VD R GDK  LE SGL   Y  KKDYG TPEY+ +R EE++K Q++YD Y++E  ++  M RLS+EE + +L GLK NWE +++++QSLSV +D+IPKK RK+ +E EMK+LE DI ++E+++ IY+AN
Sbjct:   19 NVPKKPAVPLKTDHPV-MGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSGLVPKYINKKDYGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSIPKKIRKQRLEEEMKQLEHDIGIIEKHKIIYIAN 192          
BLAST of enkurin isoform X1 vs. Ensembl Human
Match: ENKUR (enkurin, TRPC channel interacting protein [Source:HGNC Symbol;Acc:HGNC:28388])

HSP 1 Score: 135.961 bits (341), Expect = 1.614e-39
Identity = 65/125 (52.00%), Postives = 90/125 (72.00%), Query Frame = 3
Query:  321 MGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTI 695
            MGI++ KNFI  N+ D IM V+KKP+   VD R GDK  LE SGL   Y  KKDYG TPEY+ +R EE++K Q++YD Y++E  ++  M RLS+EE + +L GLK NWE +++++QSLSV +D+I
Sbjct:    1 MGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSGLVPKYINKKDYGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSI 125          
BLAST of enkurin isoform X1 vs. Ensembl Fly
Match: CG16984 (gene:FBgn0062517 transcript:FBtr0072928)

HSP 1 Score: 82.4185 bits (202), Expect = 7.954e-18
Identity = 53/170 (31.18%), Postives = 85/170 (50.00%), Query Frame = 3
Query:  342 NFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEY---DAYVKEMQRRGK-----------------MHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVA 791
            NFI +N +    +V   P    VDT  G +  L  SGL   +  +KD+GK P YL++ K  L  M        A + E+ R  K                 M  + + E  EIL GL+ +   + +QYQS+S+ +D+I K+ RK  +E +++++E+DI ++E    IYV+
Sbjct:  136 NFIKRNKICAGQTVPCPPPPRYVDTPVGARHDLLNSGLVPQFICRKDFGKVPVYLKKTKRMLADMNAVCAKEQARLLELCRGIKGFTRASVQSSGPPPMPGMRVMEQAERNEILEGLRLSLTEMTKQYQSMSLLIDSIAKRQRKSKLESDLRQVEQDILLIETTPIIYVS 305          
BLAST of enkurin isoform X1 vs. Ensembl Zebrafish
Match: enkur (enkurin, TRPC channel interacting protein [Source:ZFIN;Acc:ZDB-GENE-070718-1])

HSP 1 Score: 215.312 bits (547), Expect = 6.170e-69
Identity = 122/251 (48.61%), Postives = 168/251 (66.93%), Query Frame = 3
Query:   51 ENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKKEEKPNA-EKVPCDFHNEKR--KPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            E+I NLIP+      +   Y S+F+  VK E + +K P K+MG  +     P+ +L K  ++P   EK P  + +++   KPPVP   + P  MG+ T KNFI  N+V+NIM+V KKPQ    DT+ GDK  LE SGL   Y  KKDYG+TPEYL QR+EE++K Q+EYD+YVKE  + G M +LS EE  +IL  LK NW++++ QYQ LSV +DT PKK RKE +E EMK+LE+DI+M+ER++TIY++N
Sbjct:    9 ESIYNLIPREEEKTMKAPRYMSKFREQVKLEKQSNKAPNKSMGPAKVDVPLPQKYLLKHSKEPKLPEKKPFKYEDDELHYKPPVPARTDKPL-MGLHTNKNFIKTNAVENIMAVPKKPQPAYTDTKKGDKQPLENSGLVPKYIKKKDYGQTPEYLLQRREEVRKAQEEYDSYVKERMKEGAMKQLSGEERFKILQALKKNWDDLHHQYQGLSVVIDTAPKKYRKERLEQEMKQLERDIDMIERHKTIYISN 258          
BLAST of enkurin isoform X1 vs. Ensembl Zebrafish
Match: ENKD1 (si:ch211-220d9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-180])

HSP 1 Score: 51.2174 bits (121), Expect = 5.892e-7
Identity = 31/101 (30.69%), Postives = 54/101 (53.47%), Query Frame = 3
Query:  486 GKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYV 788
            GK P YLEQRK + +K ++E      +        ++SE E QE L+ LK    ++  +  SL V  DT+  ++R+  ++  + E+E+ I++  R   +YV
Sbjct:  249 GKVPPYLEQRKAQWRKEEEEKKRNTPDPSVPAGHTQMSERERQETLHSLKETHRSLVSELLSLPVKADTLSIRSRRADLDQRLSEVEEAIKIFSR-DKVYV 348          
BLAST of enkurin isoform X1 vs. Ensembl Xenopus
Match: slc15a2 (solute carrier family 15 member 2 [Source:Xenbase;Acc:XB-GENE-486968])

HSP 1 Score: 227.639 bits (579), Expect = 1.700e-73
Identity = 127/258 (49.22%), Postives = 166/258 (64.34%), Query Frame = 3
Query:   51 ENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKK------EEKPNA----EKVPCDFHNEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            E+I NLIPQ      ++  Y S F+ +VK E KK K  +KTMG  +     P DFL+K        +K  +    EKVP     E+R+PPVP H E P  MG+ + K+FI  N  + +M+V KKPQ   VDT+ GDK  LETSGL   Y  KKDYG+TPEY+ +R EE+++ Q+EYDAYVKE  R G M +LS+EE Q +L GLK NW+ ++  YQ LSV +DT PKK  KE +E EMK+LEKDI+ LER++ IY+AN
Sbjct:    8 ESIYNLIPQEEVKASKQPRYVSMFRESVKVETKKDKAAHKTMGPAKVDPPLPGDFLQKHTKELMLAQKSASIDPFEKVPRCLDEERRRPPVPHHTEHPV-MGVHSNKDFIQTNVAEAVMAVPKKPQPIFVDTKKGDKHVLETSGLVPKYLKKKDYGETPEYIVKRNEEVKRAQEEYDAYVKERLRMGAMKQLSDEERQSVLEGLKKNWDKLHHDYQGLSVVIDTPPKKAHKERLEAEMKQLEKDIDRLERHKIIYIAN 264          
BLAST of enkurin isoform X1 vs. Ensembl Mouse
Match: Enkur (enkurin, TRPC channel interacting protein [Source:MGI Symbol;Acc:MGI:1918483])

HSP 1 Score: 209.92 bits (533), Expect = 9.027e-67
Identity = 116/252 (46.03%), Postives = 164/252 (65.08%), Query Frame = 3
Query:   51 ENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKKEEK----PNAEKVPCDFHNEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            E+I NLIP       +   YTS F++T+K++ KK K   KTMG  +     PKDFLKK  ++    P  +   C      +KP VP   + P  MGI++ KNFI  N+ D IM V+KKP+   VD R GDK  LETSGL   Y  KKDYG TPEY+ +R E+++K Q+EYD Y++E  ++  M RLS+EE + +L GLK NWE +++++QSLSV +D++PKK RK+ +E EMK+LE DI ++E+++ IY+AN
Sbjct:    8 ESIYNLIPSDLKEPPQHPRYTSLFRATIKNDMKKFKTAMKTMGPAKVEIPSPKDFLKKHSKEKTLPPKKKFNRC----SPKKPAVPLRTDHPV-MGIQSGKNFINTNAADVIMGVAKKPKPIYVDKRTGDKHDLETSGLFPKYINKKDYGITPEYICKRNEDVKKAQEEYDNYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSVPKKIRKQKLEKEMKQLEHDISVIEKHKIIYIAN 254          
BLAST of enkurin isoform X1 vs. UniProt/SwissProt
Match: sp|Q8TC29|ENKUR_HUMAN (Enkurin OS=Homo sapiens OX=9606 GN=ENKUR PE=1 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 2.375e-66
Identity = 123/256 (48.05%), Postives = 165/256 (64.45%), Query Frame = 3
Query:   51 ENILNLIP-------QPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKK-KEEKPNAEKVPCDFHNEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            E I NLIP       QPP        Y S FK+TVKD+ +K+K   KTMG  +     PKDFLKK  +EK    K   D  N  +KP VP   + P  MGI++ KNFI  N+ D IM V+KKP+   VD R GDK  LE SGL   Y  KKDYG TPEY+ +R EE++K Q++YD Y++E  ++  M RLS+EE + +L GLK NWE +++++QSLSV +D+IPKK RK+ +E EMK+LE DI ++E+++ IY+AN
Sbjct:    8 ECIYNLIPSDLKEPPQPP-------RYISIFKATVKDDMQKAKTAMKTMGPAKVEVPSPKDFLKKHSKEKTLPPKKNFD-RNVPKKPAVPLKTDHPV-MGIQSGKNFINTNAADIIMGVAKKPKPIYVDKRTGDKHDLEPSGLVPKYINKKDYGVTPEYICKRNEEIKKAQEDYDRYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSIPKKIRKQRLEEEMKQLEHDIGIIEKHKIIYIAN 254          
BLAST of enkurin isoform X1 vs. UniProt/SwissProt
Match: sp|Q6SP97|ENKUR_MOUSE (Enkurin OS=Mus musculus OX=10090 GN=Enkur PE=1 SV=1)

HSP 1 Score: 209.92 bits (533), Expect = 6.314e-66
Identity = 116/252 (46.03%), Postives = 164/252 (65.08%), Query Frame = 3
Query:   51 ENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKKEEK----PNAEKVPCDFHNEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            E+I NLIP       +   YTS F++T+K++ KK K   KTMG  +     PKDFLKK  ++    P  +   C      +KP VP   + P  MGI++ KNFI  N+ D IM V+KKP+   VD R GDK  LETSGL   Y  KKDYG TPEY+ +R E+++K Q+EYD Y++E  ++  M RLS+EE + +L GLK NWE +++++QSLSV +D++PKK RK+ +E EMK+LE DI ++E+++ IY+AN
Sbjct:    8 ESIYNLIPSDLKEPPQHPRYTSLFRATIKNDMKKFKTAMKTMGPAKVEIPSPKDFLKKHSKEKTLPPKKKFNRC----SPKKPAVPLRTDHPV-MGIQSGKNFINTNAADVIMGVAKKPKPIYVDKRTGDKHDLETSGLFPKYINKKDYGITPEYICKRNEDVKKAQEEYDNYIQENLKKAAMKRLSDEEREAVLQGLKKNWEEVHKEFQSLSVFIDSVPKKIRKQKLEKEMKQLEHDISVIEKHKIIYIAN 254          
BLAST of enkurin isoform X1 vs. TrEMBL
Match: A0A267FC63 (Enkurin domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006351g3 PE=4 SV=1)

HSP 1 Score: 289.656 bits (740), Expect = 7.267e-95
Identity = 144/253 (56.92%), Postives = 193/253 (76.28%), Query Frame = 3
Query:   51 ENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKK--KEEKPNAEKVPCDFHN---EKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            ENI NLIP+          + S+FKSTVKDEY  ++F +KTMGE +   A P +FLKK  +E KP A  V  + H+   + R+PPVPK NE PP MGIKT KNFIAQN+V+NI+SV+KKP+K +VD+R GDKF L+ SGL+ VY  +KDYG+ PEYL++R +E+++ Q+EYD YVKEM++RG M +L++EE Q I++GLK NWE+++ QYQSLSV  DT+PKKNRKE +E EMK+LE+DIE++ER+Q IY+AN
Sbjct:    6 ENIYNLIPRQEAAAARPPKHQSRFKSTVKDEYAANRFAHKTMGEAQVPTAQPNEFLKKHTRETKPPAVVVDPNEHDRSSQPRRPPVPKANEAPPVMGIKTKKNFIAQNAVENILSVAKKPEKNLVDSRKGDKFSLDPSGLEPVYRNRKDYGEVPEYLKKRADEIRRAQEEYDNYVKEMRQRGAMQQLTDEERQAIVFGLKKNWEDLHHQYQSLSVMTDTVPKKNRKERIESEMKQLERDIELMERHQVIYLAN 258          
BLAST of enkurin isoform X1 vs. TrEMBL
Match: A0A267FGZ2 (Enkurin domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006351g1 PE=4 SV=1)

HSP 1 Score: 288.5 bits (737), Expect = 2.027e-94
Identity = 143/253 (56.52%), Postives = 193/253 (76.28%), Query Frame = 3
Query:   51 ENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKK--KEEKPNAEKVPCDFHN---EKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            ENI NLIP+          + S+FKSTVKD+Y  ++F +KTMGE +   A P +FLKK  +E KP A  V  + H+   + R+PPVPK NE PP MGIKT KNFIAQN+V+NI+SV+KKP+K +VD+R GDKF L+ SGL+ VY  +KDYG+ PEYL++R +E+++ Q+EYD YVKEM++RG M +L++EE Q I++GLK NWE+++ QYQSLSV  DT+PKKNRKE +E EMK+LE+DIE++ER+Q IY+AN
Sbjct:    6 ENIYNLIPRQEAAAARPPKHQSRFKSTVKDQYAANRFAHKTMGEAQVPTAQPNEFLKKHTRETKPPAVVVDPNEHDRSSQPRRPPVPKANEAPPVMGIKTKKNFIAQNAVENILSVAKKPEKNLVDSRKGDKFSLDPSGLEPVYRNRKDYGEVPEYLKKRADEIRRAQEEYDNYVKEMRQRGAMQQLTDEERQAIVFGLKKNWEDLHHQYQSLSVMTDTVPKKNRKERIESEMKQLERDIELMERHQVIYLAN 258          
BLAST of enkurin isoform X1 vs. TrEMBL
Match: A0A1I8J8D4 (Enkurin domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006351g2 PE=4 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 4.750e-94
Identity = 143/253 (56.52%), Postives = 192/253 (75.89%), Query Frame = 3
Query:   51 ENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKK--KEEKPNAEKVPCDFHN---EKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            ENI NLIP+          + S+FKST KDEY  ++F +KTMGE +   A P +FLKK  +E KP A  V  + H+   + R+PPVPK NE PP MGIKT KNFIAQN+V+NI+SV+KKP+K +VD+R GDKF L+ SGL+ VY  +KDYG+ PEYL++R +E+++ Q+EYD YVKEM++RG M +L++EE Q I++GLK NWE+++ QYQSLSV  DT+PKKNRKE +E EMK+LE+DIE++ER+Q IY+AN
Sbjct:    6 ENIYNLIPRQEAAAARPPKHQSRFKSTAKDEYAANRFAHKTMGEAQVPPAQPNEFLKKHTRETKPPAVVVDPNEHDRSSQPRRPPVPKANEAPPVMGIKTKKNFIAQNAVENILSVAKKPEKNLVDSRKGDKFSLDPSGLEPVYRNRKDYGEVPEYLKKRADEIRRAQEEYDNYVKEMRQRGAMQQLTDEERQAIVFGLKKNWEDLHHQYQSLSVMTDTVPKKNRKERIESEMKQLERDIELMERHQVIYLAN 258          
BLAST of enkurin isoform X1 vs. TrEMBL
Match: A0A1I8IGU2 (Enkurin domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 3.279e-86
Identity = 140/248 (56.45%), Postives = 188/248 (75.81%), Query Frame = 3
Query:   51 ENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKK--KEEKPNAEKVPCDFHNEK---RKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQT 779
            ENI NLIP+          + S+FKSTVKDEY  ++F +KTMGE +   A P +FLKK  +E KP A  V  + H+     R+PPVPK NE PP MGIKT KNFIAQN+V+NI+SV+KKP+K +VD+R GDKF L+ SGL+ VY  +KDYG+ PEYL++R +E+++ Q+EYD YVKEM++RG M +L++EE Q I++GLK NWE+++ QYQSLSV  DT+PKKNRKE +E EMK+LE+DIE++ER+Q+
Sbjct:  120 ENIYNLIPRQEAAAARPPKHQSRFKSTVKDEYAANRFAHKTMGEAQVPTAQPNEFLKKHTRETKPPAVVVDPNEHDRSSQPRRPPVPKANEAPPVMGIKTKKNFIAQNAVENILSVAKKPEKNLVDSRKGDKFSLDPSGLEPVYRNRKDYGEVPEYLKKRADEIRRAQEEYDNYVKEMRQRGAMQQLTDEERQAIVFGLKKNWEDLHHQYQSLSVMTDTVPKKNRKERIESEMKQLERDIELMERHQS 367          
BLAST of enkurin isoform X1 vs. TrEMBL
Match: A0A1S3JI99 (enkurin OS=Lingula unguis OX=7574 GN=LOC106173491 PE=4 SV=1)

HSP 1 Score: 236.498 bits (602), Expect = 7.568e-74
Identity = 130/262 (49.62%), Postives = 174/262 (66.41%), Query Frame = 3
Query:   42 MQKENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKKEEKPNAEKVPCDFH-----------NEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            +Q+ENI NLIP+      +   YTS+FK   ++E ++ K  YKTMG+ +       +FLKK  ++P   K+P   H            ++R+PPVP H E  P MG++TTKNFI  N+V NIMSV KKP K  VDTR GDK+ L+ SGL+  +  KKD+G+TP YL +R +E+ + Q+EY+AY+ E  RRG M +LSE E Q IL GLK NWE I+ QYQ LSV  DT+PKKNRKE ME EMK+LE+DIE +E+++ IY+AN
Sbjct:    2 LQEENIYNLIPREEVKPPKPARYTSKFKQMAREERQEGKSGYKTMGQAKVPVPTTDNFLKKHSKEP---KLPPREHVFAGEPFTYPDADRRRPPVP-HKEDKPLMGLRTTKNFITNNAVGNIMSVPKKPDKNFVDTRGGDKWPLDPSGLEPKFIHKKDFGQTPGYLVKRNKEVIRAQEEYEAYIAEHFRRGAMKQLSEAERQVILAGLKANWEEIHHQYQGLSVVTDTVPKKNRKERMEAEMKQLERDIETIEKHKVIYIAN 259          
BLAST of enkurin isoform X1 vs. Ensembl Cavefish
Match: ENSAMXT00000038291.1 (enkurin-like [Source:NCBI gene;Acc:111193921])

HSP 1 Score: 202.986 bits (515), Expect = 3.620e-64
Identity = 125/255 (49.02%), Postives = 169/255 (66.27%), Query Frame = 3
Query:   51 ENILNLIPQPPPTEKERI----SYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKKEEKPNA-EKVPCDFHNE--KRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            E+  NLI +    E+E+I     Y S+F+  VK E + +K   KTMG P+     P  +L K  ++P   EK P  + +E   +KP VP   + PP MG+ T KNF+  N ++NIM+V +KPQ    DTRNGDK  LE SGL + Y  KKDYG+TPEYL+QR+EE ++ Q+EYD YVKE  ++G M +L EEE Q+IL GLK NW+ ++ Q+Q LS+  DT  KKNRKE +E +MK+LEKDIEM+ERY+ IY+AN
Sbjct:    9 ESTYNLISR----EEEKIYKPPRYISKFREQVKHEKQLNKASSKTMGPPKVDVPSPDKYLLKHSKEPRLPEKKPFSYGDEGHSKKPQVPARTDYPP-MGVHTKKNFVKSNVIENIMAVPRKPQPTYTDTRNGDKQLLENSGLVSKYIKKKDYGQTPEYLQQRREETRREQEEYDNYVKERMKQGAMKQLPEEERQQILQGLKKNWDELHHQFQKLSLVTDTASKKNRKEHLEMKMKQLEKDIEMMERYKIIYIAN 258          
BLAST of enkurin isoform X1 vs. Ensembl Cavefish
Match: enkur (enkurin-like [Source:NCBI gene;Acc:111191507])

HSP 1 Score: 197.208 bits (500), Expect = 6.834e-62
Identity = 121/255 (47.45%), Postives = 168/255 (65.88%), Query Frame = 3
Query:   51 ENILNLIPQPPPTEKERI----SYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKKEEKPNA-EKVPCDFHNE--KRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            E+  NLI +    E+E+I     Y S+F+  VK E + +K   KTMG  +     P  +L K  ++P   EK P  +  E   +KPPVP   + PP MG+ T KNF+  N+++NIM+VS+KPQ   +DTRNGDK  LE SGL + Y  KKDYG+TPEYL+QR+EE ++ Q+EY+  VKE  ++G M +L EEE Q+IL GLK NW+ +Y Q+Q L +  DT  K+NRKE +E +MK+LEK+IEM+ERY+ I +AN
Sbjct:    9 ESTYNLISR----EEEKIYKPPRYISRFREQVKHEKQLNKASRKTMGPLKVHVPSPDKYLLKHSKEPRLPEKKPFSYGYEGHSKKPPVPARTDHPP-MGVHTKKNFVKSNAIENIMAVSRKPQPAYIDTRNGDKHLLENSGLVSKYIKKKDYGQTPEYLQQRREETRREQEEYNNCVKERMKQGAMKQLPEEERQQILQGLKKNWDELYHQFQKLPLVTDTASKRNRKEHLEMKMKQLEKEIEMMERYKIICIAN 258          
BLAST of enkurin isoform X1 vs. Ensembl Cavefish
Match: enkur (enkurin-like [Source:NCBI gene;Acc:111191507])

HSP 1 Score: 197.208 bits (500), Expect = 6.834e-62
Identity = 121/255 (47.45%), Postives = 168/255 (65.88%), Query Frame = 3
Query:   51 ENILNLIPQPPPTEKERI----SYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKKEEKPNA-EKVPCDFHNE--KRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            E+  NLI +    E+E+I     Y S+F+  VK E + +K   KTMG  +     P  +L K  ++P   EK P  +  E   +KPPVP   + PP MG+ T KNF+  N+++NIM+VS+KPQ   +DTRNGDK  LE SGL + Y  KKDYG+TPEYL+QR+EE ++ Q+EY+  VKE  ++G M +L EEE Q+IL GLK NW+ +Y Q+Q L +  DT  K+NRKE +E +MK+LEK+IEM+ERY+ I +AN
Sbjct:    9 ESTYNLISR----EEEKIYKPPRYISRFREQVKHEKQLNKASRKTMGPLKVHVPSPDKYLLKHSKEPRLPEKKPFSYGYEGHSKKPPVPARTDHPP-MGVHTKKNFVKSNAIENIMAVSRKPQPAYIDTRNGDKHLLENSGLVSKYIKKKDYGQTPEYLQQRREETRREQEEYNNCVKERMKQGAMKQLPEEERQQILQGLKKNWDELYHQFQKLPLVTDTASKRNRKEHLEMKMKQLEKEIEMMERYKIICIAN 258          
BLAST of enkurin isoform X1 vs. Ensembl Cavefish
Match: si:ch211-220d9.3 (enkurin domain containing 1 [Source:NCBI gene;Acc:103033941])

HSP 1 Score: 49.2914 bits (116), Expect = 2.205e-6
Identity = 28/103 (27.18%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  486 GKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            G+ P+YLE+RKE+ ++  +E      +        ++S+ E +E L  L+ N  ++  +  SL V  DT+  ++R+  ++  + E+E+ I++  R   +YV N
Sbjct:  256 GRVPQYLEERKEQWRREAEERRRNAPDPSAPAGHTQMSDRERRETLNSLRENHRSLVSELLSLPVRADTVSVRSRRAELDQRLSEVEEAIKIFSR-DKVYVKN 357          
BLAST of enkurin isoform X1 vs. Ensembl Cavefish
Match: si:ch211-220d9.3 (enkurin domain containing 1 [Source:NCBI gene;Acc:103033941])

HSP 1 Score: 48.9062 bits (115), Expect = 2.850e-6
Identity = 28/103 (27.18%), Postives = 56/103 (54.37%), Query Frame = 3
Query:  486 GKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            G+ P+YLE+RKE+ ++  +E      +        ++S+ E +E L  L+ N  ++  +  SL V  DT+  ++R+  ++  + E+E+ I++  R   +YV N
Sbjct:  262 GRVPQYLEERKEQWRREAEERRRNAPDPSAPAGHTQMSDRERRETLNSLRENHRSLVSELLSLPVRADTVSVRSRRAELDQRLSEVEEAIKIFSR-DKVYVKN 363          
BLAST of enkurin isoform X1 vs. Ensembl Sea Lamprey
Match: ENKUR (enkurin, TRPC channel interacting protein [Source:HGNC Symbol;Acc:HGNC:28388])

HSP 1 Score: 212.231 bits (539), Expect = 1.499e-68
Identity = 112/252 (44.44%), Postives = 170/252 (67.46%), Query Frame = 3
Query:   45 QKENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKK-KEEKPNAEKVPCDFHNE-KRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            Q+E++ NLIP+   T ++   Y S+F+ +V+ E  + K   +TMG  +     P+ +L K   +    EK P  + +E +R+P VP H+E PP MG+ + K+F+  N+VD I +V ++PQ  +VDT+ GD+  LE SGL   +  KK+YG+ PEY+ +R EE+++ Q+EYDAYV+E  RRG +++LSE E   +L GLK NW+ ++RQYQ LSV  DT PKK+RKE +E EMK+LE+DIE+++R++ IYV N
Sbjct:    7 QEESVYNLIPREEVTPEKPARYMSRFRESVRLEANERKKGQRTMGPAKVEVPSPQGYLHKHSRDAVLPEKRPFHYPDEGRRRPRVPGHDERPP-MGLHSRKDFVNTNAVDVITAVPRRPQPTLVDTKRGDRQPLEPSGLVPKFVHKKEYGQVPEYIVRRNEEMRQAQEEYDAYVRERLRRGALNQLSEHERSSMLQGLKQNWDELHRQYQGLSVVTDTAPKKHRKERLEMEMKQLERDIELIDRHKIIYVTN 257          
BLAST of enkurin isoform X1 vs. Ensembl Nematostella
Match: EDO42950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S040])

HSP 1 Score: 230.335 bits (586), Expect = 2.639e-75
Identity = 130/261 (49.81%), Postives = 173/261 (66.28%), Query Frame = 3
Query:   27 FVNFKMQKENILNLIP---QPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKKEEKPNA-EKVPCDFHNE-KRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            + N   Q+E+I NLIP   + PP E     Y S F  TVK +    +   KTMG P+     P +FLKK  ++P   +K P  + +E KR+P VPKH+E P  MGI++ KNFI  N+V+NIMSV KKP+K   DTR+G    L  SGL   YT KKDYGKTP+YLE+RK E ++ Q +YD+Y++E  R+G M ++S  E Q I+ GLK NWE+++ QYQ LSV  DT PKK RKE ME EMK+LE+DI+M+E++Q IY+AN
Sbjct:    7 YRNNNYQEESIYNLIPKIQERPPKEPR---YRSTFTKTVKQDTSSFRQSNKTMGPPKVVTHQPDEFLKKHSKEPKLPDKKPFRYEDETKRRPAVPKHSEKPL-MGIRSNKNFITTNAVENIMSVPKKPEKKFADTRDGSTHPLTPSGLTPKYTQKKDYGKTPQYLERRKAETERAQADYDSYIQERMRQGAMKQMSYGERQAIIDGLKKNWEDLHHQYQGLSVVTDTAPKKARKERMEAEMKQLERDIDMIEKHQVIYLAN 263          
BLAST of enkurin isoform X1 vs. Ensembl Medaka
Match: enkur (enkurin, TRPC channel interacting protein [Source:NCBI gene;Acc:101169986])

HSP 1 Score: 115.931 bits (289), Expect = 1.597e-30
Identity = 83/239 (34.73%), Postives = 123/239 (51.46%), Query Frame = 3
Query:   93 KERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKK-------EEKPNAEKVPCDFHNEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYV 788
            + R  Y S F   V  E K  K   +TMG  +     P  +LKK        E+   ++ V       +R+PPVP   + PP MG +T   FI        ++   KP    VD+  G K  LETSGL   Y  KKDYG+ P YL++R E   + Q+E+    KE + +  M +L+EEE Q  L  LK  W+ ++ +YQ L + ++T+ KK  K+ +E  M +L+KDI +LE++  IY+
Sbjct:   24 RHRSRYVSSFHPAVVSENKLIKDVMRTMGPAKVELPSPDKYLKKHCKELQLPEQSHGSKGVSRACALTQRRPPVPARTDRPP-MG-QTKGGFI-----KPAVTAPLKPTPVSVDSHKGHKQLLETSGLVPKYVTKKDYGEVPAYLQRRSEAQWRSQEEHARVEKEQEEQEAMQQLTEEERQAALQHLKKKWDALHEEYQRLPLIIETMSKKAFKKSLEDAMNQLDKDICLLEKFPIIYI 255          
BLAST of enkurin isoform X1 vs. Ensembl Medaka
Match: enkur (enkurin, TRPC channel interacting protein [Source:NCBI gene;Acc:101169986])

HSP 1 Score: 76.6406 bits (187), Expect = 1.098e-15
Identity = 72/208 (34.62%), Postives = 100/208 (48.08%), Query Frame = 3
Query:   51 ENILNLIPQPPPTEKERIS----YTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKK-------EEKPNAEKVPCDFHNEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEIL-YGLKT 638
            EN+  LIP+    E+++I     Y S F   V  E K  K   +TMG  +     P  +LKK        E+   ++ V       +R+PPVP   + PP MG +T   FI        ++   KP    VD+  G K  LETSGL   Y  KKDYG+ P YL++R E   + Q+E+    KE + +  M +L+EEE Q  L  GL T
Sbjct:    9 ENVYALIPK----EEQQIQKPPRYVSSFHPAVVSENKLIKDVMRTMGPAKVELPSPDKYLKKHCKELQLPEQSHGSKGVSRACALTQRRPPVPARTDRPP-MG-QTKGGFI-----KPAVTAPLKPTPVSVDSHKGHKQLLETSGLVPKYVTKKDYGEVPAYLQRRSEAQWRSQEEHARVEKEQEEQEAMQQLTEEERQAALQVGLMT 205          
BLAST of enkurin isoform X1 vs. Ensembl Medaka
Match: enkur (enkurin, TRPC channel interacting protein [Source:NCBI gene;Acc:101169986])

HSP 1 Score: 70.0922 bits (170), Expect = 2.449e-13
Identity = 76/231 (32.90%), Postives = 103/231 (44.59%), Query Frame = 3
Query:   51 ENILNLIPQPPPTEKERIS----YTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKKEEK---PNAEKVP--------------CDF---HNEK----------RKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEIL-YGLKT 638
            EN+  LIP+    E+++I     Y S F   V  E K  K   +TMG  +     P  +LKK  ++   P  E +P              C     H  K          R+PPVP   + PP MG +T   FI        ++   KP    VD+  G K  LETSGL   Y  KKDYG+ P YL++R E   + Q+E+    KE + +  M +L+EEE Q  L  GL T
Sbjct:    9 ENVYALIPK----EEQQIQKPPRYVSSFHPAVVSENKLIKDVMRTMGPAKVELPSPDKYLKKHCKELQLPEREFLPSNPASMLRICGPKFCHLSESHGSKGVSRACALTQRRPPVPARTDRPP-MG-QTKGGFI-----KPAVTAPLKPTPVSVDSHKGHKQLLETSGLVPKYVTKKDYGEVPAYLQRRSEAQWRSQEEHARVEKEQEEQEAMQQLTEEERQAALQVGLMT 228          
BLAST of enkurin isoform X1 vs. Planmine SMEST
Match: SMESG000076528.1 (SMESG000076528.1)

HSP 1 Score: 513.072 bits (1320), Expect = 0.000e+0
Identity = 250/251 (99.60%), Postives = 251/251 (100.00%), Query Frame = 3
Query:   42 MQKENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKKEEKPNAEKVPCDFHNEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 794
            MQKENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKKEEKPNAEKVPCDFHNEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAY+KEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN
Sbjct:    1 MQKENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEYRGADPKDFLKKKEEKPNAEKVPCDFHNEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYIKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVAN 251          
BLAST of enkurin isoform X1 vs. Planmine SMEST
Match: SMESG000023565.1 (SMESG000023565.1)

HSP 1 Score: 122.094 bits (305), Expect = 5.721e-33
Identity = 86/263 (32.70%), Postives = 140/263 (53.23%), Query Frame = 3
Query:   45 QKENILNLIPQPPPTEKERISYTSQFKSTVKDEYK----KSKFPYKTMGEPEYRGADPKDFLKK------KEEKPNAE-KVPCDFHNEKRKPPVPKHNETPPPMGIKTTKNFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLET----SGLDTVYTAKKDYGKTPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTNWENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYV 788
            +KE I NLIP+          Y SQ++  VK   K         +KTMG+ +    +P+D+LKK      K +K N +    CD   EK    VP  NE      I  ++N + +N++  IM    KP++ + DTR GDKF+LE     SGL+  +  K  YG+ P+Y+ +R + + K +  Y+ Y+ E       + L+ E+  E++ GLK  W+N  + Y  LS + DT+  +  K+++E EM +LEKDI+++E ++ I++
Sbjct:    9 RKEFICNLIPKERKKGIVEPKYISQYRPAVKHRKKVILDDVLMQHKTMGKAKEEPPNPRDYLKKFAHTFRKLKKSNNKFSYKCDVKKEK----VPTKNEWIALPPICESQNVVNRNAICAIMQPVYKPERIVADTRKGDKFKLENTKTHSGLEKKFIFKDGYGRIPKYIRKRIKAVNKTRDAYEHYLNEKSVNRSNYYLTPEQRSELIDGLKRAWDNFNKDYLKLSHSNDTLKFQKYKKYLESEMTDLEKDIQLVESHKFIFI 267          
The following BLAST results are available for this feature:
BLAST of enkurin isoform X1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENKUR4.946e-6748.05enkurin, TRPC channel interacting protein [Source:... [more]
ENKUR4.946e-6748.05enkurin, TRPC channel interacting protein [Source:... [more]
ENKUR5.173e-6748.05enkurin, TRPC channel interacting protein [Source:... [more]
ENKUR1.931e-5550.86enkurin, TRPC channel interacting protein [Source:... [more]
ENKUR1.614e-3952.00enkurin, TRPC channel interacting protein [Source:... [more]
back to top
BLAST of enkurin isoform X1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of enkurin isoform X1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CG169847.954e-1831.18gene:FBgn0062517 transcript:FBtr0072928[more]
back to top
BLAST of enkurin isoform X1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
enkur6.170e-6948.61enkurin, TRPC channel interacting protein [Source:... [more]
ENKD15.892e-730.69si:ch211-220d9.3 [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
back to top
BLAST of enkurin isoform X1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
slc15a21.700e-7349.22solute carrier family 15 member 2 [Source:Xenbase;... [more]
back to top
BLAST of enkurin isoform X1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Enkur9.027e-6746.03enkurin, TRPC channel interacting protein [Source:... [more]
back to top
BLAST of enkurin isoform X1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8TC29|ENKUR_HUMAN2.375e-6648.05Enkurin OS=Homo sapiens OX=9606 GN=ENKUR PE=1 SV=1[more]
sp|Q6SP97|ENKUR_MOUSE6.314e-6646.03Enkurin OS=Mus musculus OX=10090 GN=Enkur PE=1 SV=... [more]
back to top
BLAST of enkurin isoform X1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FC637.267e-9556.92Enkurin domain-containing protein OS=Macrostomum l... [more]
A0A267FGZ22.027e-9456.52Enkurin domain-containing protein OS=Macrostomum l... [more]
A0A1I8J8D44.750e-9456.52Enkurin domain-containing protein OS=Macrostomum l... [more]
A0A1I8IGU23.279e-8656.45Enkurin domain-containing protein OS=Macrostomum l... [more]
A0A1S3JI997.568e-7449.62enkurin OS=Lingula unguis OX=7574 GN=LOC106173491 ... [more]
back to top
BLAST of enkurin isoform X1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000038291.13.620e-6449.02enkurin-like [Source:NCBI gene;Acc:111193921][more]
enkur6.834e-6247.45enkurin-like [Source:NCBI gene;Acc:111191507][more]
enkur6.834e-6247.45enkurin-like [Source:NCBI gene;Acc:111191507][more]
si:ch211-220d9.32.205e-627.18enkurin domain containing 1 [Source:NCBI gene;Acc:... [more]
si:ch211-220d9.32.850e-627.18enkurin domain containing 1 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of enkurin isoform X1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENKUR1.499e-6844.44enkurin, TRPC channel interacting protein [Source:... [more]
back to top
BLAST of enkurin isoform X1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of enkurin isoform X1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO429502.639e-7549.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of enkurin isoform X1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
enkur1.597e-3034.73enkurin, TRPC channel interacting protein [Source:... [more]
enkur1.098e-1534.62enkurin, TRPC channel interacting protein [Source:... [more]
enkur2.449e-1332.90enkurin, TRPC channel interacting protein [Source:... [more]
back to top
BLAST of enkurin isoform X1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000076528.10.000e+099.60SMESG000076528.1[more]
SMESG000023565.15.721e-3332.70SMESG000023565.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031633 ID=SMED30031633|Name=enkurin isoform X1|organism=Schmidtea mediterranea sexual|type=transcript|length=865bp
CTTTTTAGTTGCCATAGTTCTTATATTTTGTCAATTTTAAAATGCAAAAA
GAAAATATCTTAAATTTAATTCCACAACCTCCACCAACTGAAAAAGAACG
AATATCCTATACCTCGCAATTTAAATCTACGGTTAAAGATGAATACAAGA
AATCTAAATTCCCTTACAAAACGATGGGTGAACCAGAATACAGAGGAGCT
GACCCTAAAGATTTTTTGAAAAAGAAAGAAGAAAAGCCAAATGCAGAGAA
AGTACCGTGTGATTTTCACAACGAAAAGCGAAAACCGCCAGTTCCTAAAC
ATAACGAAACTCCACCTCCAATGGGAATAAAAACGACCAAAAATTTTATC
GCTCAAAACTCCGTTGACAACATAATGTCAGTCAGTAAAAAACCTCAAAA
ATTTATCGTGGACACTCGCAACGGTGATAAATTCCAGTTGGAAACGTCTG
GCCTTGACACAGTTTACACTGCCAAAAAAGACTACGGCAAAACACCGGAA
TATCTCGAACAGCGGAAGGAAGAATTGCAGAAAATGCAGCAGGAATACGA
TGCCTATGTCAAAGAAATGCAACGGAGGGGTAAAATGCACCGGCTATCTG
AGGAGGAAATTCAAGAAATTCTCTACGGATTAAAAACAAATTGGGAGAAC
ATCTATCGGCAGTATCAATCATTGTCGGTAACGGTTGATACGATACCGAA
AAAAAACAGAAAGGAGTGGATGGAGCATGAAATGAAAGAATTAGAGAAAG
ATATTGAAATGCTCGAGAGATATCAAACAATATATGTGGCAAACTAATCC
GACTAATTTTCTTTTAATTGAGATTAGAGTAGAGAATAAATGATTTTATT
TCCTTGAAAAAACAA
back to top

protein sequence of SMED30031633-orf-1

>SMED30031633-orf-1 ID=SMED30031633-orf-1|Name=SMED30031633-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=252bp
MQKENILNLIPQPPPTEKERISYTSQFKSTVKDEYKKSKFPYKTMGEPEY
RGADPKDFLKKKEEKPNAEKVPCDFHNEKRKPPVPKHNETPPPMGIKTTK
NFIAQNSVDNIMSVSKKPQKFIVDTRNGDKFQLETSGLDTVYTAKKDYGK
TPEYLEQRKEELQKMQQEYDAYVKEMQRRGKMHRLSEEEIQEILYGLKTN
WENIYRQYQSLSVTVDTIPKKNRKEWMEHEMKELEKDIEMLERYQTIYVA
N*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026150Enkur
IPR027012Enkurin_dom
Vocabulary: cellular component
TermDefinition
GO:0001669acrosomal vesicle
GO:0005929cilium
GO:0031514motile cilium
GO:0042995cell projection
GO:0097228sperm principal piece
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005516calmodulin binding
GO:0017124SH3 domain binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 224..244
NoneNo IPR availableCOILSCoilCoilcoord: 155..179
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 46..90
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..28
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 46..86
NoneNo IPR availablePANTHERPTHR21490UNCHARACTERIZEDcoord: 1..250
IPR027012Enkurin domainPFAMPF13864Enkurincoord: 149..243
e-value: 1.8E-27
score: 95.6
IPR027012Enkurin domainPROSITEPS51665ENKURINcoord: 157..249
score: 22.714
IPR026150EnkurinPANTHERPTHR21490:SF0ENKURINcoord: 1..250