Intermediate filament 1

Overview
NameIntermediate filament 1
Smed IDSMED30031632
Length (bp)2008
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031632

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30031632SMESG000046938.1 SmedASXL_009724SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parenchymaSMED30031632SMESG000046938.1 dd_Smed_v4_12254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30031632SMESG000046938.1 dd_Smed_v4_12254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymal cellSMED30031632SMESG000046938.1 dd_Smed_v4_12254_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031632SMESG000046938.1 dd_Smed_v6_12254_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30031632SMESG000046938.1 SMESG000023325.1 OX_Smed_1.0.08954ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
glial cellSMED30031632SMESG000046938.1 dd_Smed_v6_12254_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30031632SMESG000046938.1 Contig12980newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30031632SMESG000046938.1 Contig12980uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30031632SMESG000046938.1 Contig39358newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30031632SMESG000046938.1 Contig39358uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
neuropilSMED30031632SMESG000046938.1 dd_Smed_v4_12254_0_1dd_Smed_v4PMID:27612382
Wang et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
neuropilSMED30031632SMESG000046938.1 dd_Smed_v4_12254_0_1dd_Smed_v4PMID:27612382
Wang et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
glial cellSMED30031632SMESG000046938.1 dd_Smed_v4_12254_0_1dd_Smed_v4PMID:27612382
Wang et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
glial cellSMED30031632SMESG000046938.1 dd_Smed_v4_12254_0_1dd_Smed_v4PMID:27612382
Wang et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Intermediate filament 1 vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 115.161 bits (287), Expect = 5.300e-26
Identity = 127/533 (23.83%), Postives = 252/533 (47.28%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQ--KAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-----SALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNS-----IKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIEL-SSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNR--TTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI---PETNWGMGSDIHTILYNAVGEERA 1843
            R ++K D++ LN++LA YI++VR LE +N      ++  ++   ++   +K  Y  E+ + +K L    K R + + +L  +  E +  KA++       +  +   K         E     ++ +KR  + E H  +   ++ KL   +   ++ L ++ ++ ++ E  LQ   +E++F K I+  +L E      + L   D  K  +  +++ L+ A+Q++++ ++D+++  +  +E  Y  ++     +NA+   E NS       +E ++ +    S  +++  L+ ++ + E  L DL  +S   +RD    L + K +E+ E  + + +   + + LLD KL+L +EI AYRKLLEGEE R     S       G  +S+     +Q +    V KK +  +T       ++S+F++   T G V++ E   +G+ + L N     + + +  I R  +    LL +  P K  +   + + IWA G     +   ++    +  WG G+ + T L N+ GEE A
Sbjct:   28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRG--QVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQRE--FESRLADALQELRAQHEDQVEQYKKELEKTYSAKL-----DNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDL-EDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSH----SSQTQGGGSVTKKRKLEST------ESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQ-NGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Intermediate filament 1 vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 114.39 bits (285), Expect = 7.478e-26
Identity = 127/533 (23.83%), Postives = 252/533 (47.28%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQ--KAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-----SALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNS-----IKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIEL-SSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNR--TTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI---PETNWGMGSDIHTILYNAVGEERA 1843
            R ++K D++ LN++LA YI++VR LE +N      ++  ++   ++   +K  Y  E+ + +K L    K R + + +L  +  E +  KA++       +  +   K         E     ++ +KR  + E H  +   ++ KL   +   ++ L ++ ++ ++ E  LQ   +E++F K I+  +L E      + L   D  K  +  +++ L+ A+Q++++ ++D+++  +  +E  Y  ++     +NA+   E NS       +E ++ +    S  +++  L+ ++ + E  L DL  +S   +RD    L + K +E+ E  + + +   + + LLD KL+L +EI AYRKLLEGEE R     S       G  +S+     +Q +    V KK +  +T       ++S+F++   T G V++ E   +G+ + L N     + + +  I R  +    LL +  P K  +   + + IWA G     +   ++    +  WG G+ + T L N+ GEE A
Sbjct:   28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRG--QVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQRE--FESRLADALQELRAQHEDQVEQYKKELEKTYSAKL-----DNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDL-EDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSH----SSQTQGGGSVTKKRKLEST------ESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQ-NGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Intermediate filament 1 vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 113.62 bits (283), Expect = 1.188e-25
Identity = 127/533 (23.83%), Postives = 252/533 (47.28%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQ--KAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-----SALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNS-----IKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIEL-SSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNR--TTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI---PETNWGMGSDIHTILYNAVGEERA 1843
            R ++K D++ LN++LA YI++VR LE +N      ++  ++   ++   +K  Y  E+ + +K L    K R + + +L  +  E +  KA++       +  +   K         E     ++ +KR  + E H  +   ++ KL   +   ++ L ++ ++ ++ E  LQ   +E++F K I+  +L E      + L   D  K  +  +++ L+ A+Q++++ ++D+++  +  +E  Y  ++     +NA+   E NS       +E ++ +    S  +++  L+ ++ + E  L DL  +S   +RD    L + K +E+ E  + + +   + + LLD KL+L +EI AYRKLLEGEE R     S       G  +S+     +Q +    V KK +  +T       ++S+F++   T G V++ E   +G+ + L N     + + +  I R  +    LL +  P K  +   + + IWA G     +   ++    +  WG G+ + T L N+ GEE A
Sbjct:   28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRG--QVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQRE--FESRLADALQELRAQHEDQVEQYKKELEKTYSAKL-----DNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDL-EDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSH----SSQTQGGGSVTKKRKLEST------ESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQ-NGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVA 539          
BLAST of Intermediate filament 1 vs. Ensembl Human
Match: LMNA (lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636])

HSP 1 Score: 112.849 bits (281), Expect = 2.623e-25
Identity = 125/530 (23.58%), Postives = 250/530 (47.17%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQ--KAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-----SALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNS-----IKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIEL-SSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNR--TTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI---PETNWGMGSDIHTILYNAVGE 1834
            R ++K D++ LN++LA YI++VR LE +N      ++  ++   ++   +K  Y  E+ + +K L    K R + + +L  +  E +  KA++       +  +   K         E     ++ +KR  + E H  +   ++ KL   +   ++ L ++ ++ ++ E  LQ   +E++F K I+  +L E      + L   D  K  +  +++ L+ A+Q++++ ++D+++  +  +E  Y  ++     +NA+   E NS       +E ++ +    S  +++  L+ ++ + E  L DL  +S   +RD    L + K +E+ E  + + +   + + LLD KL+L +EI AYRKLLEGEE R     S       G  +S+     +Q +    V KK +  +T       ++S+F++   T G V++ E   +G+ + L N     + + +  I R  +    LL +  P K  +   + + IWA G     +   ++    +  WG G+ + T L N+ GE
Sbjct:   28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRG--QVAKLEAALGEAKKQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQRE--FESRLADALQELRAQHEDQVEQYKKELEKTYSAKL-----DNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDL-EDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSH----SSQTQGGGSVTKKRKLEST------ESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQ-NGDDPLLTYRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGE 536          
BLAST of Intermediate filament 1 vs. Ensembl Human
Match: LMNB1 (lamin B1 [Source:HGNC Symbol;Acc:HGNC:6637])

HSP 1 Score: 107.457 bits (267), Expect = 1.077e-23
Identity = 148/580 (25.52%), Postives = 277/580 (47.76%), Query Frame = 2
Query:  188 TNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDL--INLEHE---LQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSML--KKRL-GKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-----SALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERA----------LVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETR--WTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEIPETN-WGMGSDIHTILYNAVGEERA 1843
            T   VP ++  R+    T + P++ +           R ++K ++R LN++LA YI++VR LE +N     +++  ++  G++   +K  Y  E+ + ++ L +  + R K + +L     EH+   L  AK E     D+    +K  E      S++ AL + L  KK L G LE+ K     +I +L   +   ++ L ++T+  +++E   Q   +++EF K +++ ++NE      + L   D+ +  +  +K  L+ A+ +++  +D ++++ +  +E  Y  ++     ENA+L  E+N+    + R   E   +R RI  L +++ +L++           L DL  + ++N R     L+ K +E+ E    + +     + LLD KL+L +EI+AYRKLLEGEE R   +   S+ V     + + +++T   +       +K+V    + A+  +S   + + T  GNV I E   DG+ I L+N  +  + +    + R I  G   + +    +  +   +T+ IWA   G       DL     N WG G D+  IL N+ GEE A
Sbjct:    3 TATPVPPRMGSRAGGPTTPLSPTRLS-----------RLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLNYAKKE----SDLNGAQIKLREYEAALNSKDAALATALGDKKSLEGDLEDLKD----QIAQLEASLAAAKKQLADETLLKVDLENRCQSLTEDLEFRKSMYEEEINETRRKHETRLVEVDSGRQIEYEYK--LAQALHEMREQHDAQVRLYKEELEQTYHAKL-----ENARLSSEMNTSTVNSAR--EELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRM---LTDKEREMAEIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGK-------RKRVDVEESEASSSVSISHSASAT--GNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKI--GDTSVSYKYTSRYVLKAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVA 540          
BLAST of Intermediate filament 1 vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 282.722 bits (722), Expect = 1.063e-86
Identity = 193/577 (33.45%), Postives = 324/577 (56.15%), Query Frame = 2
Query:  146 VSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGN-----YKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQ-VKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEE-ISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI--PETNWGMGSDIHTILYNAVGEERATY 1849
             S   S R  +  RT   V SQ   R     T +     +     G       +  RE++K +M +LN++LA YIE+VRFLEAQN+K + +L  L+ KWGKDT  ++  Y  E+ + +KL+ E  K R   E  L  ++ EL + + +L  +     +   KI+     LS  EA IS+LK+R+ +LE+   + K E  +L  E+Q  + DL+ +T+  ++ + ++Q  L+E++FL+++H  ++ EL  LA RDTT +N++F+K ELS A++DI+ +YD    + R+ +ES Y +++Q+ +T++A+  ME    K+E KR++ +    R ++ DLE++   LE+ + +L ++ E+++R YE  L+ +  ++ +         ++L+ LLD K +L  EIA YRK+LEGEE R                 + LK  V Q VK   I Q+   ET     GE +++ +F R+ KGNVSI E + DG+ I+L+N  + K+E I +  + R ID  R+ + + +P+   +   KT+KI+A+        D  +   E ++G G+++ TIL+N  GEERAT+
Sbjct:    4 TSTTPSARAPLGGRTTGNVTSQ--DRMLKIVTEMRSGAGSGLSPFGQNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR-----------------AGLKQLVEQVVKTHAITQETDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATH 560          
BLAST of Intermediate filament 1 vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 282.722 bits (722), Expect = 1.063e-86
Identity = 193/577 (33.45%), Postives = 324/577 (56.15%), Query Frame = 2
Query:  146 VSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGN-----YKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQ-VKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEE-ISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI--PETNWGMGSDIHTILYNAVGEERATY 1849
             S   S R  +  RT   V SQ   R     T +     +     G       +  RE++K +M +LN++LA YIE+VRFLEAQN+K + +L  L+ KWGKDT  ++  Y  E+ + +KL+ E  K R   E  L  ++ EL + + +L  +     +   KI+     LS  EA IS+LK+R+ +LE+   + K E  +L  E+Q  + DL+ +T+  ++ + ++Q  L+E++FL+++H  ++ EL  LA RDTT +N++F+K ELS A++DI+ +YD    + R+ +ES Y +++Q+ +T++A+  ME    K+E KR++ +    R ++ DLE++   LE+ + +L ++ E+++R YE  L+ +  ++ +         ++L+ LLD K +L  EIA YRK+LEGEE R                 + LK  V Q VK   I Q+   ET     GE +++ +F R+ KGNVSI E + DG+ I+L+N  + K+E I +  + R ID  R+ + + +P+   +   KT+KI+A+        D  +   E ++G G+++ TIL+N  GEERAT+
Sbjct:    4 TSTTPSARAPLGGRTTGNVTSQ--DRMLKIVTEMRSGAGSGLSPFGQNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR-----------------AGLKQLVEQVVKTHAITQETDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATH 560          
BLAST of Intermediate filament 1 vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 282.722 bits (722), Expect = 1.063e-86
Identity = 193/577 (33.45%), Postives = 324/577 (56.15%), Query Frame = 2
Query:  146 VSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGN-----YKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQ-VKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEE-ISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI--PETNWGMGSDIHTILYNAVGEERATY 1849
             S   S R  +  RT   V SQ   R     T +     +     G       +  RE++K +M +LN++LA YIE+VRFLEAQN+K + +L  L+ KWGKDT  ++  Y  E+ + +KL+ E  K R   E  L  ++ EL + + +L  +     +   KI+     LS  EA IS+LK+R+ +LE+   + K E  +L  E+Q  + DL+ +T+  ++ + ++Q  L+E++FL+++H  ++ EL  LA RDTT +N++F+K ELS A++DI+ +YD    + R+ +ES Y +++Q+ +T++A+  ME    K+E KR++ +    R ++ DLE++   LE+ + +L ++ E+++R YE  L+ +  ++ +         ++L+ LLD K +L  EIA YRK+LEGEE R                 + LK  V Q VK   I Q+   ET     GE +++ +F R+ KGNVSI E + DG+ I+L+N  + K+E I +  + R ID  R+ + + +P+   +   KT+KI+A+        D  +   E ++G G+++ TIL+N  GEERAT+
Sbjct:    4 TSTTPSARAPLGGRTTGNVTSQ--DRMLKIVTEMRSGAGSGLSPFGQNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR-----------------AGLKQLVEQVVKTHAITQETDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATH 560          
BLAST of Intermediate filament 1 vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 283.108 bits (723), Expect = 1.185e-86
Identity = 193/577 (33.45%), Postives = 324/577 (56.15%), Query Frame = 2
Query:  146 VSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGN-----YKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQ-VKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEE-ISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI--PETNWGMGSDIHTILYNAVGEERATY 1849
             S   S R  +  RT   V SQ   R     T +     +     G       +  RE++K +M +LN++LA YIE+VRFLEAQN+K + +L  L+ KWGKDT  ++  Y  E+ + +KL+ E  K R   E  L  ++ EL + + +L  +     +   KI+     LS  EA IS+LK+R+ +LE+   + K E  +L  E+Q  + DL+ +T+  ++ + ++Q  L+E++FL+++H  ++ EL  LA RDTT +N++F+K ELS A++DI+ +YD    + R+ +ES Y +++Q+ +T++A+  ME    K+E KR++ +    R ++ DLE++   LE+ + +L ++ E+++R YE  L+ +  ++ +         ++L+ LLD K +L  EIA YRK+LEGEE R                 + LK  V Q VK   I Q+   ET     GE +++ +F R+ KGNVSI E + DG+ I+L+N  + K+E I +  + R ID  R+ + + +P+   +   KT+KI+A+        D  +   E ++G G+++ TIL+N  GEERAT+
Sbjct:   12 TSTTPSARAPLGGRTTGNVTSQ--DRMLKIVTEMRSGAGSGLSPFGQNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR-----------------AGLKQLVEQVVKTHAITQETDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATH 568          
BLAST of Intermediate filament 1 vs. Ensembl Celegans
Match: ifa-1 (Intermediate filament protein ifa-1 [Source:UniProtKB/Swiss-Prot;Acc:P90901])

HSP 1 Score: 282.722 bits (722), Expect = 1.462e-86
Identity = 193/577 (33.45%), Postives = 324/577 (56.15%), Query Frame = 2
Query:  146 VSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGN-----YKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQ-VKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEE-ISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI--PETNWGMGSDIHTILYNAVGEERATY 1849
             S   S R  +  RT   V SQ   R     T +     +     G       +  RE++K +M +LN++LA YIE+VRFLEAQN+K + +L  L+ KWGKDT  ++  Y  E+ + +KL+ E  K R   E  L  ++ EL + + +L  +     +   KI+     LS  EA IS+LK+R+ +LE+   + K E  +L  E+Q  + DL+ +T+  ++ + ++Q  L+E++FL+++H  ++ EL  LA RDTT +N++F+K ELS A++DI+ +YD    + R+ +ES Y +++Q+ +T++A+  ME    K+E KR++ +    R ++ DLE++   LE+ + +L ++ E+++R YE  L+ +  ++ +         ++L+ LLD K +L  EIA YRK+LEGEE R                 + LK  V Q VK   I Q+   ET     GE +++ +F R+ KGNVSI E + DG+ I+L+N  + K+E I +  + R ID  R+ + + +P+   +   KT+KI+A+        D  +   E ++G G+++ TIL+N  GEERAT+
Sbjct:   12 TSTTPSARAPLGGRTTGNVTSQ--DRMLKIVTEMRSGAGSGLSPFGQNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR-----------------AGLKQLVEQVVKTHAITQETDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATH 568          
BLAST of Intermediate filament 1 vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0346460)

HSP 1 Score: 116.701 bits (291), Expect = 5.749e-27
Identity = 137/538 (25.46%), Postives = 255/538 (47.40%), Query Frame = 2
Query:  266 AYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNE---LSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDL--RHESEENKRDYEIELSSKTKELTEADSIIHETEI--QLK---TLLDDKLSLQLEIAAYRKLLEGEETRW--TDKSSTVVVHE-NGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPV--GTNDLEIPETNWGMGSDIHTILYNAVGE 1834
            A   +   +  R  +K +++NLN++LA YI++VR LE +N + + E+   +D   ++T  +K  +  E+   ++LL +  ++R + E D+  L  E ++ K++L+            + + E + +E     +       KL E   +   E+ +LR + +  +++L  +T+  +++E  +Q   +E+ F  QIH  ++NE   +    Y +        + A+L  ++Q++++ Y++++Q+ R  I+S Y  ++Q  +   A+      +    +K I+ E  STR RI  L   I  LE+A  DL  R    E + D + E   +  +L E + I    E+  QLK    L+D K+SL LEIAAY KLL GEE R   T  ++T  V   + +L ++ +   ++      V++K    + S    + A    + + KGNV I E   +G+ + L N G  +  I    + R I+       +   +   ++ N  I +W+   K      + L +    W    +  TIL N+ GE
Sbjct:   40 ASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAAR------TSNSTHKSIE-ELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSV-ADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQKWVSADNTRTILLNSEGE 569          
BLAST of Intermediate filament 1 vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307059)

HSP 1 Score: 116.701 bits (291), Expect = 5.749e-27
Identity = 137/538 (25.46%), Postives = 255/538 (47.40%), Query Frame = 2
Query:  266 AYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNE---LSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDL--RHESEENKRDYEIELSSKTKELTEADSIIHETEI--QLK---TLLDDKLSLQLEIAAYRKLLEGEETRW--TDKSSTVVVHE-NGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPV--GTNDLEIPETNWGMGSDIHTILYNAVGE 1834
            A   +   +  R  +K +++NLN++LA YI++VR LE +N + + E+   +D   ++T  +K  +  E+   ++LL +  ++R + E D+  L  E ++ K++L+            + + E + +E     +       KL E   +   E+ +LR + +  +++L  +T+  +++E  +Q   +E+ F  QIH  ++NE   +    Y +        + A+L  ++Q++++ Y++++Q+ R  I+S Y  ++Q  +   A+      +    +K I+ E  STR RI  L   I  LE+A  DL  R    E + D + E   +  +L E + I    E+  QLK    L+D K+SL LEIAAY KLL GEE R   T  ++T  V   + +L ++ +   ++      V++K    + S    + A    + + KGNV I E   +G+ + L N G  +  I    + R I+       +   +   ++ N  I +W+   K      + L +    W    +  TIL N+ GE
Sbjct:   40 ASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAAR------TSNSTHKSIE-ELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSV-ADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQKWVSADNTRTILLNSEGE 569          
BLAST of Intermediate filament 1 vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0307058)

HSP 1 Score: 116.701 bits (291), Expect = 5.749e-27
Identity = 137/538 (25.46%), Postives = 255/538 (47.40%), Query Frame = 2
Query:  266 AYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNE---LSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDL--RHESEENKRDYEIELSSKTKELTEADSIIHETEI--QLK---TLLDDKLSLQLEIAAYRKLLEGEETRW--TDKSSTVVVHE-NGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPV--GTNDLEIPETNWGMGSDIHTILYNAVGE 1834
            A   +   +  R  +K +++NLN++LA YI++VR LE +N + + E+   +D   ++T  +K  +  E+   ++LL +  ++R + E D+  L  E ++ K++L+            + + E + +E     +       KL E   +   E+ +LR + +  +++L  +T+  +++E  +Q   +E+ F  QIH  ++NE   +    Y +        + A+L  ++Q++++ Y++++Q+ R  I+S Y  ++Q  +   A+      +    +K I+ E  STR RI  L   I  LE+A  DL  R    E + D + E   +  +L E + I    E+  QLK    L+D K+SL LEIAAY KLL GEE R   T  ++T  V   + +L ++ +   ++      V++K    + S    + A    + + KGNV I E   +G+ + L N G  +  I    + R I+       +   +   ++ N  I +W+   K      + L +    W    +  TIL N+ GE
Sbjct:   40 ASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAAR------TSNSTHKSIE-ELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSV-ADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQKWVSADNTRTILLNSEGE 569          
BLAST of Intermediate filament 1 vs. Ensembl Fly
Match: Lam (gene:FBgn0002525 transcript:FBtr0079100)

HSP 1 Score: 116.701 bits (291), Expect = 5.749e-27
Identity = 137/538 (25.46%), Postives = 255/538 (47.40%), Query Frame = 2
Query:  266 AYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNE---LSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDL--RHESEENKRDYEIELSSKTKELTEADSIIHETEI--QLK---TLLDDKLSLQLEIAAYRKLLEGEETRW--TDKSSTVVVHE-NGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPV--GTNDLEIPETNWGMGSDIHTILYNAVGE 1834
            A   +   +  R  +K +++NLN++LA YI++VR LE +N + + E+   +D   ++T  +K  +  E+   ++LL +  ++R + E D+  L  E ++ K++L+            + + E + +E     +       KL E   +   E+ +LR + +  +++L  +T+  +++E  +Q   +E+ F  QIH  ++NE   +    Y +        + A+L  ++Q++++ Y++++Q+ R  I+S Y  ++Q  +   A+      +    +K I+ E  STR RI  L   I  LE+A  DL  R    E + D + E   +  +L E + I    E+  QLK    L+D K+SL LEIAAY KLL GEE R   T  ++T  V   + +L ++ +   ++      V++K    + S    + A    + + KGNV I E   +G+ + L N G  +  I    + R I+       +   +   ++ N  I +W+   K      + L +    W    +  TIL N+ GE
Sbjct:   40 ASSPLSPTRHSRVAEKVELQNLNDRLATYIDRVRNLETENSRLTIEVQTTRDTVTRETTNIKNIFEAELLETRRLLDDTARDRARAEIDIKRLWEENEELKNKLDKKTKECTTAEGNVRMYESRANELNNKYNQANADRKKLNEDLNEALKELERLRKQFEETRKNLEQETLSRVDLENTIQSLREELSFKDQIHSQEINESRRIKQTEYSEIDGRLSSEYDAKLKQSLQELRAQYEEQMQINRDEIQSLYEDKIQRLQEAAAR------TSNSTHKSIE-ELRSTRVRIDALNANINELEQANADLNARIRDLERQLDNDRERHGQEIDLLEKELIRLREEMTQQLKEYQDLMDIKVSLDLEIAAYDKLLVGEEARLNITPATNTATVQSFSQSLRNSTRATPSRRTPSAAVKRKRAVVDESEDHSV-ADYYVSASAKGNVEIKEIDPEGKFVRLFNKGSEEVAIGGWQLQRLINEKGPSTTYKFHRSVRIEPNGVITVWSADTKASHEPPSSLVMKSQKWVSADNTRTILLNSEGE 569          
BLAST of Intermediate filament 1 vs. Ensembl Fly
Match: LamC (gene:FBgn0010397 transcript:FBtr0087512)

HSP 1 Score: 106.686 bits (265), Expect = 1.140e-23
Identity = 137/566 (24.20%), Postives = 260/566 (45.94%), Query Frame = 2
Query:  254 SKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELN-LSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDF---WKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLE--RALVDLRHESEENKRDYEIE-----LSSKTKELTEA-DSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKS--------------------TFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY 1849
            S+  A       +  R+++K ++++LN++LA YI+++R LE +N + + EL+  +D   ++T  +K  Y  E+   +KLL E  K + K E D+  L  E    K  L+  +++                         L  R  K E+   +  +E  +LR ++ +L++ L  +T+  +++E + Q   +E+ F  Q+H  +L E  +    + ++ +      ++A+L  ++Q+++  Y+ ++++ R  IE  Y   +Q+ K   A    + +++  E  R+       R++I  L  K+ +LE   A ++ R    EN  D E +     ++S   EL    D + H+ + + + L+D K+SL LEIAAY KLL GEE R   +S      ++G ++SN           +   +       SAT  IS  S                    + N   KG++ I+E   +GR I L N G  +  ++   + R    G + L F   + + + G  ++ IW+   G      N+L + +  W + + + ++L NA  E+ A+Y
Sbjct:   28 SRVGATSPTSPTRTSRQQEKEELQHLNDRLACYIDRMRNLENENSRLTQELNLAQDTVNRETSNLKAVYEKELAAARKLLDETAKEKAKLEIDIKRLWEENDDLKPRLDKKTKEATVAENNARLYENRYNEVNGKYNQSLADR-KKFEDQAKELALENERLRRQLDDLRKQLEAETLARVDLENQNQSLREELAFKDQVHTQELTETRSRRQIEISEIDGRLSRQYEAKLQQSLQELRDQYEGQMRINREEIELLYDNEIQNLKAA-ANRAAQGSALATEEVRL------MRTKIDGLNAKLQNLEDTNAGLNARIRELENLLDTERQRHNQYIASLEAELQRMRDEMAHQLQ-EYQGLMDIKVSLDLEIAAYDKLLCGEERRLNIESPGRPTTDSG-ISSNGSHLTASASSRS--GRVTPSGRRSATPGISGSSAVKRRRTVIDESEDRTLSEYSVNAAAKGDLEIIEADVEGRFIKLHNKGTEEINLTGWQLTRIA--GDEELAFKFSRGSKVLGGASVTIWSVDAGTAHDPPNNL-VMKKKWPVANSMRSVLANADKEDVASY 578          
BLAST of Intermediate filament 1 vs. Ensembl Zebrafish
Match: lmnl3 (lamin L3 [Source:ZFIN;Acc:ZDB-GENE-020424-4])

HSP 1 Score: 108.612 bits (270), Expect = 3.319e-24
Identity = 134/565 (23.72%), Postives = 260/565 (46.02%), Query Frame = 2
Query:  200 VPSQIIQRSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLL--TEAEKNRGKTEFDLINLEHELQKAKD-----ELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-----SALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGF--KPVGTNDLEIP-ETNWGMGSDIHTILYNAVGEERATY 1849
            V S  ++RS +   R      A+   V   +  R ++K D+R LN++LA YIE+VR LEA        L   ++   ++   V+  Y  E+ + +K L  T  E+ R + EF  +  +H    A++     EL  + D    L   +   E   +   +    L+  + +L       K ++  L   +Q L+  LN++ ++ ++ E ++Q   ++++F K + + ++ E+     S L   D  +  K+F + +L+ AM+ ++ +++ +I+  +  +E  +  ++++ K    K      S K+E    K    S   +I +L+ +++ LE  +++L+   E  ++  + +LS + +E+      + E   + + LLD KL L +EI AYRK+LEGEE R            N +L+   +T    ++Q    +KK +   T +    + + + + + +G VSI E   DGR I L+N     + +S   + +       ++ F  P    M+    + +WA     +    +DL +    +WG  +D+   L N   EE A Y
Sbjct:    4 VTSTPMERSASAAVRASRRSGASPCTVSPTRLTRLQEKEDLRQLNDRLANYIERVRQLEADKSSMQILLEEKEESSLREVGNVRRLYESELADARKSLDATANERARLQIEFSQLQEDHRKLAARNNKKECELTAAVDRWRNLEVALNAKEADFANLLSTNRRLETEISEL-------KTQVPALEAALQKLKTQLNSEMLRRVDAENQIQTLQEQLDFQKHLGEQEVREMRSRHESRLLELDCGR-QKEF-EGKLAEAMKQLRDEHETQIRQYKDELEKTFNAKLENAKQTAVKNSDFAFSTKEELAGTKLRLESQTQQINNLQKQVVCLEARVLELQQTLEHERQVSQQKLSQQQQEMAALRLQMQEQLEEYENLLDVKLMLDMEINAYRKMLEGEEKRL-----------NQSLSPIQQTLSPIIQQS---RKKRKHDATCSGFSPNYRLSQHSSCRGPVSIEEVDLDGRYIKLKNASDRDQVVSGWQLRKSEAEAPDIV-FCFPSPCVMNAGHMLTVWAAAAVDQCGSASDLLLSTHQSWGSFADVRVSLLNIQNEEMAEY 544          
BLAST of Intermediate filament 1 vs. Ensembl Zebrafish
Match: lmnl3 (lamin L3 [Source:ZFIN;Acc:ZDB-GENE-020424-4])

HSP 1 Score: 107.842 bits (268), Expect = 4.802e-24
Identity = 134/565 (23.72%), Postives = 260/565 (46.02%), Query Frame = 2
Query:  200 VPSQIIQRSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLL--TEAEKNRGKTEFDLINLEHELQKAKD-----ELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-----SALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGF--KPVGTNDLEIP-ETNWGMGSDIHTILYNAVGEERATY 1849
            V S  ++RS +   R      A+   V   +  R ++K D+R LN++LA YIE+VR LEA        L   ++   ++   V+  Y  E+ + +K L  T  E+ R + EF  +  +H    A++     EL  + D    L   +   E   +   +    L+  + +L       K ++  L   +Q L+  LN++ ++ ++ E ++Q   ++++F K + + ++ E+     S L   D  +  K+F + +L+ AM+ ++ +++ +I+  +  +E  +  ++++ K    K      S K+E    K    S   +I +L+ +++ LE  +++L+   E  ++  + +LS + +E+      + E   + + LLD KL L +EI AYRK+LEGEE R            N +L+   +T    ++Q    +KK +   T +    + + + + + +G VSI E   DGR I L+N     + +S   + +       ++ F  P    M+    + +WA     +    +DL +    +WG  +D+   L N   EE A Y
Sbjct:    4 VTSTPMERSASAAVRASRRSGASPCTVSPTRLTRLQEKEDLRQLNDRLANYIERVRQLEADKSSMQILLEEKEESSLREVGNVRRLYESELADARKSLDATANERARLQIEFSQLQEDHRKLAARNNKKECELTAAVDRWRNLEVALNAKEADFANLLSTNRRLETEISEL-------KTQVPALEAALQKLKTQLNSEMLRRVDAENQIQTLQEQLDFQKHLGEQEVREMRSRHESRLLELDCGR-QKEF-EGKLAEAMKQLRDEHETQIRQYKDELEKTFNAKLENAKQTAVKNSDFAFSTKEELAGTKLRLESQTQQINNLQKQVVCLEARVLELQQTLEHERQVSQQKLSQQQQEMAALRLQMQEQLEEYENLLDVKLMLDMEINAYRKMLEGEEKRL-----------NQSLSPIQQTLSPIIQQS---RKKRKHDATCSGFSPNYRLSQHSSCRGPVSIEEVDLDGRYIKLKNASDRDQVVSGWQLRKSEAEAPDIV-FCFPSPCVMNAGHMLTVWAAAAVDQCGSASDLLLSTHQSWGSFADVRVSLLNIQNEEMAEY 544          
BLAST of Intermediate filament 1 vs. Ensembl Zebrafish
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 107.842 bits (268), Expect = 5.319e-24
Identity = 138/560 (24.64%), Postives = 269/560 (48.04%), Query Frame = 2
Query:  251 PSK-SAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQ------KAKD-ELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEH--KAKDKMEILKLRDEIQNLQR-DLNNQTIKYLNVECELQGKL--DEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRI---KNEWGSTRSRIPDLENKIISLERALVDLRHESEE------NKRD-YEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRW---TDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEI-PETNWGMGSDIHTILYNAVGEERA 1843
            PS+ SAA   +   +  R ++K ++R LN++LA YI++VR LE +N +   ++S  ++   ++   +K  Y  E+ + +++L E  + R K + +L  +  EL+      K KD +L  +     +L  +    E  L+   +  + L   L  L+    KA+D   + K + E++ L R DL N+  + L  E E +  +  +E+   ++ H+ ++ E+ +   +D        ++ +LS A+QD++  +++++Q+ +  ++  +  ++     +NAK+  +LN     +K +   + E      RI  L  ++ +L++          E      + RD Y  +L +K +E+ E    + +   + + LLD KL+L +EI AYRKLLEGEE R       SS V V      +++  +  ++ K++ +      E   S+T     + +      G+VSI E   +G+ + L N     + +    + R I  G +++    PK     G +T+ +W+   G      +DL    +++WG G +I T+L N+ GE+ A
Sbjct:    6 PSRASAAQTPLSPARISRLQEKEELRALNDRLAVYIDRVRALELENDRLQFKVSEKEEVTTREVSGIKSLYEAELADARRVLDETARERAKLQIELGKVNSELEEVTRNYKKKDGDLAAALVRIKDLEAQYNKNEAALNTALSENASLSAELADLKAQLAKAEDAHGVAKKQLEVETLMRVDLENR-CQSLTEELEFRKSMFDEEVRETRRRHEKRMVEVDSGMQQD--------YEFKLSQALQDLRKQHEEQVQIYKEELQHTFKAKL-----DNAKVSSDLN-----DKAVLTAREELQEAHVRIEGLSYQLSALQKQASAAEERIRELEGLLSSDRDKYRRQLDAKEREMAEMRECMQQQLNEYQELLDVKLALDMEINAYRKLLEGEEDRLKLSPSPSSRVTVSRTTASSTSASSRSSRAKRKRV------ELEESSTAGPKVQISQQAEASGSVSIEEIDLEGKSVTLRNNSDKDQSLGSWRLKRQIGDGEEIVYKFSPKFVLKAG-QTVTVWSADAGMSHSPPSDLLWKSQSSWGTGENILTLLVNSSGEDVA 539          
BLAST of Intermediate filament 1 vs. Ensembl Zebrafish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 107.842 bits (268), Expect = 7.500e-24
Identity = 125/550 (22.73%), Postives = 262/550 (47.64%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINL-----EHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKD-KMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYR----DTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNS--IKDENKRIKNEWGSTRSRIPDLENKIISLERALV----DLRHESEENKRDYEI---ELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRW-----TDKSSTVVVHE---NGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNR-----TTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI---PETNWGMGSDIHTILYNAVGEERA 1843
            R ++K D+ NLN++LA YI++VR LE +N      ++  + +  ++   +K  Y  E+ + +K L    K R + + +L  +     E + +  K E +L   +      +  +  +  S      ++ +KR  ++E    +D K ++ KL   + + ++ L ++ ++ ++ E  +Q   +E+EF K I+  +L E S   Y     +     +  ++++L+ A+ D+++ +++++++ +  IE  Y     ++K ENA+   E NS  +   ++ ++     TR R+  + +++  L++ L      +R   E   R+ +I    L  K KE+ E    + +   + + LLD KL+L +EI+AYRKLLEGEE R         +  V V     +G+ T  +++  ++    +  ++++ + ++ A+  +    T  R     +  G V++ E   +G+ + L N     + +    + R I  G  ++ +  P K  +   +T+ IWA G     +   ++    + +WG G    T L ++ GEE A
Sbjct:   25 RLQEKEDLSNLNDRLAVYIDKVRSLEVENAGLRMRITESETEISRELSGMKAAYEAELADARKTLDSVAKERARLQLELSKVREDYKELKARNGKKEADLESALARLKDLESLLNSKDASLST---ALGEKRTLEVE---VRDLKAQLAKLEGSLNDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYSEELRE-SKRRYESRVVEIDSGRQQDYESKLADALTDLRNQHEEQLRIYKEEIEKTY-----NSKLENARSSAERNSHLVGAAHEELQQ----TRVRMEGVSSQLSQLQKQLAAREAKIRELEEALSRERDILRRRLEDKEKEMAEMRQRMQQQLDEYQELLDIKLALDMEISAYRKLLEGEEERLRLSPSPPPARGVTVTRSSGSGSHTRVVQSSTSRTSSGSAKKRRLNDNDSDASSVVGGTVTRTRISQQASASGRVTVDEVDLEGKFVRLNNKSDQDQSLGHWQVKRQIGSGTPIV-YKFPPKFNLKAGQTVTIWAAGAGGTHSPPSDLVWKTQNSWGSGDLFQTTLISSSGEEMA 557          
BLAST of Intermediate filament 1 vs. Ensembl Zebrafish
Match: lmna (lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3])

HSP 1 Score: 107.842 bits (268), Expect = 7.500e-24
Identity = 125/550 (22.73%), Postives = 262/550 (47.64%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINL-----EHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKD-KMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYR----DTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNS--IKDENKRIKNEWGSTRSRIPDLENKIISLERALV----DLRHESEENKRDYEI---ELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRW-----TDKSSTVVVHE---NGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNR-----TTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI---PETNWGMGSDIHTILYNAVGEERA 1843
            R ++K D+ NLN++LA YI++VR LE +N      ++  + +  ++   +K  Y  E+ + +K L    K R + + +L  +     E + +  K E +L   +      +  +  +  S      ++ +KR  ++E    +D K ++ KL   + + ++ L ++ ++ ++ E  +Q   +E+EF K I+  +L E S   Y     +     +  ++++L+ A+ D+++ +++++++ +  IE  Y     ++K ENA+   E NS  +   ++ ++     TR R+  + +++  L++ L      +R   E   R+ +I    L  K KE+ E    + +   + + LLD KL+L +EI+AYRKLLEGEE R         +  V V     +G+ T  +++  ++    +  ++++ + ++ A+  +    T  R     +  G V++ E   +G+ + L N     + +    + R I  G  ++ +  P K  +   +T+ IWA G     +   ++    + +WG G    T L ++ GEE A
Sbjct:   25 RLQEKEDLSNLNDRLAVYIDKVRSLEVENAGLRMRITESETEISRELSGMKAAYEAELADARKTLDSVAKERARLQLELSKVREDYKELKARNGKKEADLESALARLKDLESLLNSKDASLST---ALGEKRTLEVE---VRDLKAQLAKLEGSLNDAKKQLQDEMLRRVDAENRIQTLKEELEFQKNIYSEELRE-SKRRYESRVVEIDSGRQQDYESKLADALTDLRNQHEEQLRIYKEEIEKTY-----NSKLENARSSAERNSHLVGAAHEELQQ----TRVRMEGVSSQLSQLQKQLAAREAKIRELEEALSRERDILRRRLEDKEKEMAEMRQRMQQQLDEYQELLDIKLALDMEISAYRKLLEGEEERLRLSPSPPPARGVTVTRSSGSGSHTRVVQSSTSRTSSGSAKKRRLNDNDSDASSVVGGTVTRTRISQQASASGRVTVDEVDLEGKFVRLNNKSDQDQSLGHWQVKRQIGSGTPIV-YKFPPKFNLKAGQTVTIWAAGAGGTHSPPSDLVWKTQNSWGSGDLFQTTLISSSGEEMA 557          
BLAST of Intermediate filament 1 vs. Ensembl Xenopus
Match: lmx1a (LIM homeobox transcription factor 1 alpha [Source:Xenbase;Acc:XB-GENE-481569])

HSP 1 Score: 107.457 bits (267), Expect = 1.077e-23
Identity = 131/559 (23.43%), Postives = 268/559 (47.94%), Query Frame = 2
Query:  239 TRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNR-------GKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTK------DNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKII-------SLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGR-QLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI---PETNWGMGSDIHTILYNAVGEERA 1843
            +R     SAA       +  R ++K D+R+LN++LA YIE+VR LEA       +L   ++   ++   +++ Y  E+ + +KLL +    R       GK   D   L+    K + +L+L++++  +L  K+   E  L+      + L  + G LEE   + + +I  L   +++  + L+++ +  +++E ++Q   ++++F + IH+ ++ E+     R  T+        +  ++++L+ A+Q+++ D++ +I   +  +E  +  ++     ENA+L    NS  D     + E  +T+ R+  L +++        +LE  + +L+   +     +  +++ K +E+TE    +     + + LLD KL+L +EI AYRK+LEGEE R     S          +++  + +++ K     ++K++ET  S T   + K     ++ G VS+ +   +G  + L N  +    +   ++ R   HG    + + +P +  +   + + IWA G   V +   ++      NWG G DI  IL ++ GEE A
Sbjct:    7 SRAREHASAAPSPGSPTRISRMQEKEDLRHLNDRLAAYIERVRSLEADKSLLKIQLEEKEEVTSREVTNLRLLYETELADARKLLDQTANERARLQVELGKVREDYRQLQARNSKKETDLSLAQNLLRDLESKLNTKEADLA------TALSGKRG-LEEQLQEQRAQIAGLESSLRDTTKQLHDEMLWRVDLENKMQTIKEQLDFQRNIHEQEVKEMRK---RHDTRIVEIDSGRRIEFESKLAEALQELRRDHEQQISDYKEQLERNFSAKL-----ENAQLAAAKNS--DYASATREEIMATKLRVDTLSSQLSQYQKQNSALEAKVRELQDMLDRAHDMHRRQMTEKDREVTEIRQTLQAQLEEYEQLLDVKLALDMEINAYRKMLEGEEQRLKLSPSPSQRSTVSRASTSQSSRLSRGK-----KRKLEETGRSVTKR-AYKVVQEASSTGPVSVEDIDPEGNYVRLLNNTEEDHSLHGWVVRR--KHGSLPEIAYKLPCRFVLKSEQRVTIWAAGAGAVHSPPTDLVWKSHKNWGTG-DIKIILLDSSGEECA 539          
BLAST of Intermediate filament 1 vs. Ensembl Xenopus
Match: lmx1a (LIM homeobox transcription factor 1 alpha [Source:Xenbase;Acc:XB-GENE-481569])

HSP 1 Score: 107.071 bits (266), Expect = 1.382e-23
Identity = 131/559 (23.43%), Postives = 268/559 (47.94%), Query Frame = 2
Query:  239 TRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNR-------GKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTK------DNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKII-------SLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGR-QLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI---PETNWGMGSDIHTILYNAVGEERA 1843
            +R     SAA       +  R ++K D+R+LN++LA YIE+VR LEA       +L   ++   ++   +++ Y  E+ + +KLL +    R       GK   D   L+    K + +L+L++++  +L  K+   E  L+      + L  + G LEE   + + +I  L   +++  + L+++ +  +++E ++Q   ++++F + IH+ ++ E+     R  T+        +  ++++L+ A+Q+++ D++ +I   +  +E  +  ++     ENA+L    NS  D     + E  +T+ R+  L +++        +LE  + +L+   +     +  +++ K +E+TE    +     + + LLD KL+L +EI AYRK+LEGEE R     S          +++  + +++ K     ++K++ET  S T   + K     ++ G VS+ +   +G  + L N  +    +   ++ R   HG    + + +P +  +   + + IWA G   V +   ++      NWG G DI  IL ++ GEE A
Sbjct:    7 SRAREHASAAPSPGSPTRISRMQEKEDLRHLNDRLAAYIERVRSLEADKSLLKIQLEEKEEVTSREVTNLRLLYETELADARKLLDQTANERARLQVELGKVREDYRQLQARNSKKETDLSLAQNLLRDLESKLNTKEADLA------TALSGKRG-LEEQLQEQRAQIAGLESSLRDTTKQLHDEMLWRVDLENKMQTIKEQLDFQRNIHEQEVKEMRK---RHDTRIVEIDSGRRIEFESKLAEALQELRRDHEQQISDYKEQLERNFSAKL-----ENAQLAAAKNS--DYASATREEIMATKLRVDTLSSQLSQYQKQNSALEAKVRELQDMLDRAHDMHRRQMTEKDREVTEIRQTLQAQLEEYEQLLDVKLALDMEINAYRKMLEGEEQRLKLSPSPSQRSTVSRASTSQSSRLSRGK-----KRKLEETGRSVTKR-AYKVVQEASSTGPVSVEDIDPEGNYVRLLNNTEEDHSLHGWVVRR--KHGSLPEIAYKLPCRFVLKSEQRVTIWAAGAGAVHSPPTDLVWKSHKNWGTG-DIKIILLDSSGEECA 539          
BLAST of Intermediate filament 1 vs. Ensembl Xenopus
Match: lmx1a (LIM homeobox transcription factor 1 alpha [Source:Xenbase;Acc:XB-GENE-481569])

HSP 1 Score: 106.301 bits (264), Expect = 2.122e-23
Identity = 130/559 (23.26%), Postives = 267/559 (47.76%), Query Frame = 2
Query:  239 TRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNR-------GKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTK------DNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKII-------SLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGR-QLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI---PETNWGMGSDIHTILYNAVGEERA 1843
            +R     SAA       +  R ++K D+R+LN++LA YIE+VR LEA       +L   ++   ++   +++ Y  E+ + +KLL +    R       GK   D   L+    K + +L+L++++  +L  K+   E  L+      + L  + G LEE   + + +I  L   +++  + L+++ +  +++E ++Q   ++++F + IH+ ++ E+     R  T+        +  ++++L+ A+Q+++ D++ +I   +  +E  +  ++     ENA+L    NS  D     + E  +T+ R+  L +++        +LE  + +L+   +     +  +++ K +E+TE    +     + + LLD KL+L +EI AYRK+LEGEE R     S          +++  + +++ K     ++K++ET  S T   + K     ++ G VS+ +   +G  + L N  +    +   ++ R   HG    + + +P +  +   + + IWA G   V +   ++      NWG G DI  IL ++ GE R 
Sbjct:    7 SRAREHASAAPSPGSPTRISRMQEKEDLRHLNDRLAAYIERVRSLEADKSLLKIQLEEKEEVTSREVTNLRLLYETELADARKLLDQTANERARLQVELGKVREDYRQLQARNSKKETDLSLAQNLLRDLESKLNTKEADLA------TALSGKRG-LEEQLQEQRAQIAGLESSLRDTTKQLHDEMLWRVDLENKMQTIKEQLDFQRNIHEQEVKEMRK---RHDTRIVEIDSGRRIEFESKLAEALQELRRDHEQQISDYKEQLERNFSAKL-----ENAQLAAAKNS--DYASATREEIMATKLRVDTLSSQLSQYQKQNSALEAKVRELQDMLDRAHDMHRRQMTEKDREVTEIRQTLQAQLEEYEQLLDVKLALDMEINAYRKMLEGEEQRLKLSPSPSQRSTVSRASTSQSSRLSRGK-----KRKLEETGRSVTKR-AYKVVQEASSTGPVSVEDIDPEGNYVRLLNNTEEDHSLHGWVVRR--KHGSLPEIAYKLPCRFVLKSEQRVTIWAAGAGAVHSPPTDLVWKSHKNWGTG-DIKIILLDSSGEVRC 539          
BLAST of Intermediate filament 1 vs. Ensembl Xenopus
Match: rnasek (ribonuclease K [Source:Xenbase;Acc:XB-GENE-6046202])

HSP 1 Score: 103.605 bits (257), Expect = 1.672e-22
Identity = 132/535 (24.67%), Postives = 257/535 (48.04%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDL--INLEHE-----LQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-----SALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLER-----ALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEIPETN-WGMGSDIHTILYNAVGEERA 1843
            R ++K D++ LN++LA YI++VR LE++N     +++  ++   ++   +K  Y  E+ + ++ L +  + R + + +L  I++EHE       K + EL  ++    E    +      L+  ++    L+   G++E+ KA    EI +L   +   ++ L  + +  +++E   Q  ++E++F K +++ ++ E      + L   D+ K  +  ++ +LS A+ D++  +D ++ + +  +E  Y      +K ENA+L  E+NS    + R   E   +R RI  L +++  L++      L D+  + ++N R     L+ + +E+ +    + +     + LLD KL+L +EI+AYRKLLEGEE R     S         +T +  +    V+     +K++    + A+  +S   + + T  G+VSI E   DG+ I L+N  +    +    + R I  G   + F    +  +   +T+ IWA   G      +DL     N W  G D+  IL N+ GE+ A
Sbjct:   18 RLQEKVDLQELNDRLAVYIDKVRSLESENSLLHVQVTEREEVRSREVSGIKELYETELADARRSLDDTARERARLQLELSKISVEHEDLRASFSKKESELESAQARFRETEALLNSKNAALATTQSENKSLQ---GEVEDLKA----EIGQLESALALAKKQLEEEILIKVDLENRCQSLIEELDFRKNVYEEEIKETRRRHETRLVEVDSGKQIE--YEHKLSQALADMREQHDSQVTLYKEELEHTY-----QSKLENARLSSEMNSSAVNSTR--EELMESRYRIDSLTSQLSELQKEVKISKLEDMLAKEKDNSRKM---LAEREREMADIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSP-----PSRVTVSRASSSRSVRTAKGKRKRIDVEESEASSSVSISHSASAT--GDVSIEEVDVDGKYIRLKNNSEQDHPLGGWELTRTI--GEASVNFKFTSRYVLKAGQTVTIWAADAGVTASPPSDLIWKNQNSWATGEDVKVILKNSQGEDVA 524          
BLAST of Intermediate filament 1 vs. Ensembl Xenopus
Match: rnasek (ribonuclease K [Source:Xenbase;Acc:XB-GENE-6046202])

HSP 1 Score: 102.064 bits (253), Expect = 5.423e-22
Identity = 132/540 (24.44%), Postives = 257/540 (47.59%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDL--INLEHE-----LQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-----SALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERA----------LVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEIPETN-WGMGSDIHTILYNAVGEERA 1843
            R ++K D++ LN++LA YI++VR LE++N     +++  ++   ++   +K  Y  E+ + ++ L +  + R + + +L  I++EHE       K + EL  ++    E    +      L+  ++    L+   G++E+ KA    EI +L   +   ++ L  + +  +++E   Q  ++E++F K +++ ++ E      + L   D+ K  +  ++ +LS A+ D++  +D ++ + +  +E  Y      +K ENA+L  E+NS    + R   E   +R RI  L +++  L++           L D+  + ++N R     L+ + +E+ +    + +     + LLD KL+L +EI+AYRKLLEGEE R     S         +T +  +    V+     +K++    + A+  +S   + + T  G+VSI E   DG+ I L+N  +    +    + R I  G   + F    +  +   +T+ IWA   G      +DL     N W  G D+  IL N+ GE+ A
Sbjct:   37 RLQEKVDLQELNDRLAVYIDKVRSLESENSLLHVQVTEREEVRSREVSGIKELYETELADARRSLDDTARERARLQLELSKISVEHEDLRASFSKKESELESAQARFRETEALLNSKNAALATTQSENKSLQ---GEVEDLKA----EIGQLESALALAKKQLEEEILIKVDLENRCQSLIEELDFRKNVYEEEIKETRRRHETRLVEVDSGKQIE--YEHKLSQALADMREQHDSQVTLYKEELEHTY-----QSKLENARLSSEMNSSAVNSTR--EELMESRYRIDSLTSQLSELQKESRAWHDRMQELEDMLAKEKDNSRKM---LAEREREMADIRDQMQQQLNDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSP-----PSRVTVSRASSSRSVRTAKGKRKRIDVEESEASSSVSISHSASAT--GDVSIEEVDVDGKYIRLKNNSEQDHPLGGWELTRTI--GEASVNFKFTSRYVLKAGQTVTIWAADAGVTASPPSDLIWKNQNSWATGEDVKVILKNSQGEDVA 548          
BLAST of Intermediate filament 1 vs. Ensembl Mouse
Match: Lmnb2 (lamin B2 [Source:MGI Symbol;Acc:MGI:96796])

HSP 1 Score: 125.176 bits (313), Expect = 1.505e-29
Identity = 138/559 (24.69%), Postives = 266/559 (47.58%), Query Frame = 2
Query:  248 IPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKA-KDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSA-----LAYRDTTKDNK-DFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLER---ALVDLRHESEE---NKRD-YEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRW---TDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSAT----GEISAKSTFNRTT--KGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI---PETNWGMGSDIHTILYNAVGEERAT 1846
            +P  +     +   +  R ++K ++R LN++LA YI++VR LE +N +    +S  ++   ++   +K  Y  E+ + +++L E  + R + + ++  ++ EL++A K       ++     +  ++       E  L + L  + G LE   A+ + ++ K  D     ++ L  +T+  +++E   Q   +E+ F K + + ++ E        L   D+++  + DF   +++ A++D++S +D+++++ R  +E  Y       K +NAKLL + N       R   E    R R+  L  +++ L++   A  +  HE EE    +RD +   L +K +E+TE    + +   + + LLD KL+L +EI+AYRKLLEGEE R       SS + +    + +S+       V Q    +++++  +TS +      +S+ S   + T   G V+I E   +GR + L+N     + + +  I R +  G  +     PK     G +T+ +WA G     +    +    +TNWG G    T L +A GEE A 
Sbjct:    4 LPPHAGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELENDRLLLRISEKEEVTTREVSGIKTLYESELADARRVLDETARERARLQIEIGKVQAELEEARKSAKKREGELTVAQGRVKDLESLFHRSEAELATALSDKQG-LETEVAELRAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELAFSKSVFEEEVRETRRRHERRLVEVDSSRQQEYDF---KMAQALEDLRSQHDEQVRLYRVELEQTY-----QAKLDNAKLLSDQNDKAAHAAR--EELKEARMRVESLSYQLLGLQKQASAAENHIHELEEALAGERDKFRKMLDAKEQEMTEVRDAMQQQLAEYQELLDIKLALDMEISAYRKLLEGEEERLKLSPSPSSRITISRATSSSSSSSGVGMSVGQGRGKRRRLETEDTSGSPSRASRVSSGSRLAQQTVATGVVNIDEVDPEGRFVRLKNSSDKDQSLGNWRIKRQVLEGEDIAYKFTPKYVLRAG-QTVTVWAAGAGATHSPPSTLVWKSQTNWGPGESFRTALVSADGEEVAV 550          
BLAST of Intermediate filament 1 vs. Ensembl Mouse
Match: Lmnb2 (lamin B2 [Source:MGI Symbol;Acc:MGI:96796])

HSP 1 Score: 124.79 bits (312), Expect = 1.929e-29
Identity = 138/559 (24.69%), Postives = 266/559 (47.58%), Query Frame = 2
Query:  248 IPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKA-KDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSA-----LAYRDTTKDNK-DFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLER---ALVDLRHESEE---NKRD-YEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRW---TDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSAT----GEISAKSTFNRTT--KGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI---PETNWGMGSDIHTILYNAVGEERAT 1846
            +P  +     +   +  R ++K ++R LN++LA YI++VR LE +N +    +S  ++   ++   +K  Y  E+ + +++L E  + R + + ++  ++ EL++A K       ++     +  ++       E  L + L  + G LE   A+ + ++ K  D     ++ L  +T+  +++E   Q   +E+ F K + + ++ E        L   D+++  + DF   +++ A++D++S +D+++++ R  +E  Y       K +NAKLL + N       R   E    R R+  L  +++ L++   A  +  HE EE    +RD +   L +K +E+TE    + +   + + LLD KL+L +EI+AYRKLLEGEE R       SS + +    + +S+       V Q    +++++  +TS +      +S+ S   + T   G V+I E   +GR + L+N     + + +  I R +  G  +     PK     G +T+ +WA G     +    +    +TNWG G    T L +A GEE A 
Sbjct:   23 LPPHAGPATPLSPTRLSRLQEKEELRELNDRLAHYIDRVRALELENDRLLLRISEKEEVTTREVSGIKTLYESELADARRVLDETARERARLQIEIGKVQAELEEARKSAKKREGELTVAQGRVKDLESLFHRSEAELATALSDKQG-LETEVAELRAQLAKAEDGHAVAKKQLEKETLMRVDLENRCQSLQEELAFSKSVFEEEVRETRRRHERRLVEVDSSRQQEYDF---KMAQALEDLRSQHDEQVRLYRVELEQTY-----QAKLDNAKLLSDQNDKAAHAAR--EELKEARMRVESLSYQLLGLQKQASAAENHIHELEEALAGERDKFRKMLDAKEQEMTEVRDAMQQQLAEYQELLDIKLALDMEISAYRKLLEGEEERLKLSPSPSSRITISRATSSSSSSSGVGMSVGQGRGKRRRLETEDTSGSPSRASRVSSGSRLAQQTVATGVVNIDEVDPEGRFVRLKNSSDKDQSLGNWRIKRQVLEGEDIAYKFTPKYVLRAG-QTVTVWAAGAGATHSPPSTLVWKSQTNWGPGESFRTALVSADGEEVAV 569          
BLAST of Intermediate filament 1 vs. Ensembl Mouse
Match: Lmnb1 (lamin B1 [Source:MGI Symbol;Acc:MGI:96795])

HSP 1 Score: 106.686 bits (265), Expect = 1.402e-23
Identity = 139/554 (25.09%), Postives = 264/554 (47.65%), Query Frame = 2
Query:  260 SAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDL--INLEHE---LQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRL-GKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-----SALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERA----------LVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETR--WTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEIPETN-WGMGSDIHTILYNAVGEERA 1843
            SA    +   +  R ++K ++R LN++LA YI++VR LE +N     +++  ++  G++   +K  Y  E+ + ++ L +  + R K + +L     EH+   L  AK E +LS         +  +  +  +   AL    KK L G LE+ K     +I +L   +   ++ L ++T+  +++E   Q   +++EF K +++ ++NE      + L   D+ +  +  +K  L+ A+ +++  +D ++++ +  +E  Y  ++     ENA+L  E+N+    + R   E   +R RI  L +++ +L++           L D+  +  +N R     LS + +E+ E    + +     + LLD KL+L +EI+AYRKLLEGEE R   +   S+ V     + + +++T   +       +K+V    + A+  +S   + + T  GNV I E   DG+ I L+N  +  + +    + R I  G   + +    +  +   +T+ +WA   G       DL     N WG G D+  IL N+ GEE A
Sbjct:   17 SAPATPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEVRGRELTGLKALYETELADARRALDDTARERAKLQIELGKFKAEHDQLLLNYAKKESDLSGAQIKLREYEAALNSKDAALATALGD--KKSLEGDLEDLKD----QIAQLEASLSAAKKQLADETLLKVDLENRCQSLTEDLEFRKNMYEEEINETRRKHETRLVEVDSGRQIEYEYK--LAQALHEMREQHDAQVRLYKEELEQTYHAKL-----ENARLSSEMNTSTVNSAR--EELMESRMRIESLSSQLSNLQKESRACLERIQELEDMLAKERDNSRRM---LSDREREMAEIRDQMQQQLSDYEQLLDVKLALDMEISAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGK-------RKRVDVEESEASSSVSISHSASAT--GNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKI--GDTSVSYKYTSRYVLKAGQTVTVWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVA 541          
BLAST of Intermediate filament 1 vs. Ensembl Mouse
Match: Lmna (lamin A [Source:MGI Symbol;Acc:MGI:96794])

HSP 1 Score: 106.301 bits (264), Expect = 2.564e-23
Identity = 122/531 (22.98%), Postives = 249/531 (46.89%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQ--KAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-----SALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNS-----IKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIEL-SSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI---PETNWGMGSDIHTILYNAVGEERA 1843
            R ++K D++ LN++LA YI++VR LE +N      ++  ++   ++   +K  Y  E+ + +K L    K R + + +L  +  E +  KA++       +  +   K         E     ++ +KR  + E H  +   ++ KL   +   ++ L ++ ++ ++ E  LQ   +E++F K I+  +L E      + L   D  K  +  +++ L+ A+Q++++ ++D+++  +  +E  Y  ++     +NA+   E NS       +E ++ +    S  +++  L+ ++ + E  L DL  +S   +RD    L + K +E+ E  + + +   + + LLD KL+L +EI AYRKLLEGEE R     S       G   ++  +  +Q       ++K++ + + ++    A+      T G V++ E   +G+ + L N     + + +  I R  +    L+ +  P K  +   + + IWA G     +   ++    +  WG GS + T L N+ GEE A
Sbjct:   28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRG--QVAKLEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQRE--FESRLADALQELRAQHEDQVEQYKKELEKTYSAKL-----DNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDL-EDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRG--RASSHSSQSQGGGSVTKKRKLESSESRSSFSQHAR------TSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIRRQ-NGDDPLMTYRFPPKFTLKAGQVVTIWASGAGATHSPPTDLVWKAQNTWGCGSSLRTALINSTGEEVA 539          
BLAST of Intermediate filament 1 vs. Ensembl Mouse
Match: Lmna (lamin A [Source:MGI Symbol;Acc:MGI:96794])

HSP 1 Score: 105.145 bits (261), Expect = 3.570e-23
Identity = 122/531 (22.98%), Postives = 249/531 (46.89%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQ--KAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-----SALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNS-----IKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIEL-SSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI---PETNWGMGSDIHTILYNAVGEERA 1843
            R ++K D++ LN++LA YI++VR LE +N      ++  ++   ++   +K  Y  E+ + +K L    K R + + +L  +  E +  KA++       +  +   K         E     ++ +KR  + E H  +   ++ KL   +   ++ L ++ ++ ++ E  LQ   +E++F K I+  +L E      + L   D  K  +  +++ L+ A+Q++++ ++D+++  +  +E  Y  ++     +NA+   E NS       +E ++ +    S  +++  L+ ++ + E  L DL  +S   +RD    L + K +E+ E  + + +   + + LLD KL+L +EI AYRKLLEGEE R     S       G   ++  +  +Q       ++K++ + + ++    A+      T G V++ E   +G+ + L N     + + +  I R  +    L+ +  P K  +   + + IWA G     +   ++    +  WG GS + T L N+ GEE A
Sbjct:   28 RLQEKEDLQELNDRLAVYIDRVRSLETENAGLRLRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARNTKKEGDLLAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRG--QVAKLEAALGEAKKQLQDEMLRRVDAENRLQTLKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQRE--FESRLADALQELRAQHEDQVEQYKKELEKTYSAKL-----DNARQSAERNSNLVGAAHEELQQSRIRIDSLSAQLSQLQKQLAAKEAKLRDL-EDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRG--RASSHSSQSQGGGSVTKKRKLESSESRSSFSQHAR------TSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIRRQ-NGDDPLMTYRFPPKFTLKAGQVVTIWASGAGATHSPPTDLVWKAQNTWGCGSSLRTALINSTGEEVA 539          
BLAST of Intermediate filament 1 vs. UniProt/SwissProt
Match: sp|Q01241|NF70_DORPE (70 kDa neurofilament protein OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 3.254e-92
Identity = 204/550 (37.09%), Postives = 313/550 (56.91%), Query Frame = 2
Query:  227 FNYETRVIPSKSAAYGDVG--NYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELT----EADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSST-VVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETN--WGMGSDIHTILYNAVGEERATY 1849
            F+Y    +P + A     G  + K  RE++K DMR+LNE+ A YIE+VRFLEAQNKK +GEL  LK KWGK+T  +K  Y  E++  +KL+    K +   +  +  L  +L++ + +L  SR       ++I    ++L++ E  ISML++ +  LE+ K +    + K+ DE++ ++ DLNN+TI +L+ E   Q   +E+EF K +H  +L EL+ALAYRDTT +N++FW+ EL+ A++DIQ +YD +   +R  IE+ Y +++Q+ +T   K  ME+   K+EN ++K+     R+R+ DLE +   LER   DL  + EE  R  E+E     +E+T    E +SI+ E    L+ L+D KLSL+LEIAAYRKLLEGEE+R   K     VV         L T + + +         Q +     GE++AK+T+ RT+KG+VSI E  + G  I LE   K +E ++   I R +D  + +  + IP      G   +KIW+K  +     D  +   N  WG GS++ TIL N  GE++A Y
Sbjct:   67 FSYGATAMPGRYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTELIDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKE----LQDLMDIKLSLELEIAAYRKLLEGEESRVGMKQIVEQVVGARPNEAEVLSTILTRSEGGYEATGDSQISMKMMRGELAAKTTYQRTSKGSVSIKEADSQGCFIALET--KKEENLTGWKIVRKVDDNK-VYTYEIPNLVLKTGT-VVKIWSKNHQAQARGDDLVSRENDTWGTGSNVVTILQNEKGEDKANY 608          
BLAST of Intermediate filament 1 vs. UniProt/SwissProt
Match: sp|P90901|IFA1_CAEEL (Intermediate filament protein ifa-1 OS=Caenorhabditis elegans OX=6239 GN=ifa-1 PE=1 SV=2)

HSP 1 Score: 282.722 bits (722), Expect = 1.860e-85
Identity = 193/577 (33.45%), Postives = 324/577 (56.15%), Query Frame = 2
Query:  146 VSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGN-----YKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQ-VKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEE-ISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEI--PETNWGMGSDIHTILYNAVGEERATY 1849
             S   S R  +  RT   V SQ   R     T +     +     G       +  RE++K +M +LN++LA YIE+VRFLEAQN+K + +L  L+ KWGKDT  ++  Y  E+ + +KL+ E  K R   E  L  ++ EL + + +L  +     +   KI+     LS  EA IS+LK+R+ +LE+   + K E  +L  E+Q  + DL+ +T+  ++ + ++Q  L+E++FL+++H  ++ EL  LA RDTT +N++F+K ELS A++DI+ +YD    + R+ +ES Y +++Q+ +T++A+  ME    K+E KR++ +    R ++ DLE++   LE+ + +L ++ E+++R YE  L+ +  ++ +         ++L+ LLD K +L  EIA YRK+LEGEE R                 + LK  V Q VK   I Q+   ET     GE +++ +F R+ KGNVSI E + DG+ I+L+N  + K+E I +  + R ID  R+ + + +P+   +   KT+KI+A+        D  +   E ++G G+++ TIL+N  GEERAT+
Sbjct:   12 TSTTPSARAPLGGRTTGNVTSQ--DRMLKIVTEMRSGAGSGLSPFGQNAASTIRDSREREKKEMSDLNDRLASYIEKVRFLEAQNRKLAADLDALRSKWGKDTHNIRNMYEGELVDAQKLIDETNKQRKDMEGQLKKMQDELAEMRRKLEDATKGREQDRAKIDALLVTLSNLEAEISLLKRRIAQLEDEVKRIKQENQRLLSELQRARTDLDQETLNRIDYQNQVQTLLEEIDFLRRVHDNEIKELQTLASRDTTPENREFFKNELSSAIRDIREEYDQVNNVHRNDMESWYRLKVQEIQTQSARQNMEQGYAKEEVKRLRTQLSDLRGKLADLESRNSLLEKQIQELNYQLEDDQRSYEAALNDRDSQIRKMREECQALMVELQMLLDTKQTLDAEIAIYRKMLEGEENR-----------------AGLKQLVEQVVKTHAITQETDTETMRVVKGETASRQSFQRSAKGNVSIHEASPDGKFIVLQNTHRAKDEAIGEWKLKRRIDGKRENV-YTLPRDFVLRAGKTLKIFARNQGVASPPDQLVYDAEDSFGSGNNVQTILFNKEGEERATH 568          
BLAST of Intermediate filament 1 vs. UniProt/SwissProt
Match: sp|P90900|IFA4_CAEEL (Intermediate filament protein ifa-4 OS=Caenorhabditis elegans OX=6239 GN=ifa-4 PE=1 SV=3)

HSP 1 Score: 263.462 bits (672), Expect = 3.430e-78
Identity = 172/526 (32.70%), Postives = 310/526 (58.94%), Query Frame = 2
Query:  290 KKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEI---QLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQ-VKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIP--ETNWGMGSDIHTILYNAVGEERATY 1849
            ++ R ++K +M  LN++LA YIE+VRFLEAQN+K   +L+ L+ KWG D+  VK+ Y  E+++ K L+ +++K R + E  +  L  EL   +++L+ +    +   K+++    +L   EA I +LK+R+  +EE     K E  ++ D + + +  +  +T+  ++ + ++Q  L+E +F+++IH +++++L A+A RDTT +N++++K ELS A+++I+S+YD      R+ IES Y +++Q+  T+N++  +E N  ++E KR++   G  R ++ DLE + + LE+ + DL ++ EE+ R YE  L+ K    T  + +  E++I   +L+ L+D K +L  EI  YRK+L+GEE R                 + L+  V Q VK  +I Q K  E+     GE ++ S+++R+ KGN++I E    G+ I+LENI +  E I D  + R I   R+++ F  P++  +   K++KI+A+G       D  +   E ++G G+D+ T LYN  GE+RA++
Sbjct:   64 RESRTREKKEMSELNDRLASYIEKVRFLEAQNRKMEKDLNLLRGKWGHDSTSVKVMYETELRSAKDLIADSDKERAQLEDQIKKLVEELNNYRNKLHEAERGADVTRKELDNVLGRLGALEAEIELLKRRISLMEESIGHLKRENHRMIDSLHHARNAVEQETLNRIDYQNQVQTLLEECDFIRRIHDSEIHDLLAMASRDTTVENREYFKNELSSAIREIRSEYDHVSNTTRTDIESWYKLKVQEIHTQNSRNCLEQNYAREEVKRLRTTLGDMRGKMADLEGRNLLLEKQIEDLNYQMEEDMRSYEQSLNDKD---TSINKLRDESKILMVELQMLIDTKQTLDAEIVIYRKMLDGEENR-----------------AGLRQLVEQVVKTTSIHQTKEIESLRVLKGETTSHSSYSRSAKGNIAIQEAEPSGKYIVLENISRRDENIGDWKLRRKIAGKREIV-FTFPREFTLRAQKSVKIFARGQGVHSPPDSLVYDLEDSFGTGNDVVTTLYNKEGEDRASH 568          
BLAST of Intermediate filament 1 vs. UniProt/SwissProt
Match: sp|P23730|IFEA_ASCSU (Intermediate filament protein A (Fragment) OS=Ascaris suum OX=6253 PE=1 SV=1)

HSP 1 Score: 250.751 bits (639), Expect = 2.940e-74
Identity = 175/523 (33.46%), Postives = 305/523 (58.32%), Query Frame = 2
Query:  320 MRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXS-------MLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQ-LKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQ-VKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEE-ISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIP---ETNWGMGSDIHTILYNAVGEERATY 1849
            M +LN++LA YIE+VRFLEAQN+K + +L  L+ +WGKDT  V+  Y  E+Q  +KL+ +   NR + E     LE E++K  DEL+  R    + L+  +I  +++ E    +S       +L++R+  + E  A+ K E L+  +E+   + DL+ +T+  ++ + ++Q  L+E++F++++H  ++ EL A+A RDTT +N++++K EL+ A++DI+++YD    + R  +ES Y +++Q+ +T++ +  +E N  K   KR++ +    R ++ DLE +  SL +   +L ++ E+++R YE  L+ +  ++ + D      E Q L  LLD K +L  EIA YRK+LEGEE R                 + L+  V Q VK   + Q    E+     GE +++++F R+ KGNVSI E   DGR ++LEN  ++KEE I +  + R ID  R+++ + +P+   +   K++KIWA+G   + +   ++    E  +G GS++ TIL+N  GEERAT+
Sbjct:    1 MSDLNDRLASYIEKVRFLEAQNRKLAADLDLLRGRWGKDTLSVRAMYEGELQEARKLVNDT--NRQREE-----LEKEIRKLLDELSEYRRKYEDALRGHQIDRDRIDELLNQLSGLEAEINLLRRRIANIIEEIARIKKENLQFANELTKARSDLDQETLNRIDFQNQVQTLLEEIDFMRRVHDQEIAELQAMASRDTTPENREYFKNELASAIRDIRAEYDQICNVNRMDMESWYKLKVQEIQTQSTRQNLEQNYAK---KRLRVQLTDLRGKLADLEGR-NSLLKQTQELNYQLEDDQRSYEAALNDRDAQIRKMDE-----ECQALMMLLDTKQTLDAEIAIYRKMLEGEENR-----------------AGLRQLVEQVVKTHGLTQVDETESLRVLKGETASRTSFQRSAKGNVSIQETAPDGRYVVLENTHRSKEEAIGEWKLKRKIDGKREIV-YTLPRDFILRPGKSVKIWARGQGGIHSPPEQLVFDLEDTFGSGSNVQTILFNREGEERATH 489          
BLAST of Intermediate filament 1 vs. UniProt/SwissProt
Match: sp|Q01240|NF60_DORPE (60 kDa neurofilament protein OS=Doryteuthis pealeii OX=1051067 PE=2 SV=1)

HSP 1 Score: 249.21 bits (635), Expect = 1.529e-73
Identity = 155/386 (40.16%), Postives = 238/386 (61.66%), Query Frame = 2
Query:  227 FNYETRVIPSKSAAYGDVG--NYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELT----EADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETR 1366
            F+Y    +P + A     G  + K  RE++K DMR+LNE+ A YIE+VRFLEAQNKK +GEL  LK KWGK+T  +K  Y  E++  +KL+    K +   +  +  L  +L++ + +L  SR       ++I    ++L++ E  ISML++ +  LE+ K +    + K+ DE++ ++ DLNN+TI +L+ E   Q   +E+EF K +H  +L EL+ALAYRDTT +N++FW+ EL+ A++DIQ +YD +   +R  IE+ Y +++Q+ +T   K  ME+   K+EN ++K+     R+R+ DLE +   LER   DL  + EE  R  E+E     +E+T    E +SI+ E    L+ L+D KLSL+LEIAAYRKLLEGEE+R
Sbjct:   67 FSYGATAMPGRYANISSTGVNHVKANREREKQDMRDLNERFANYIEKVRFLEAQNKKLAGELEELKSKWGKETSAIKEMYETELEEARKLIDATNKEKITLDVRVTELIDQLERQQKDLEESRTYHQIDQEQIARQNQQLADLEGEISMLRRSIESLEKEKMRQSNILAKMNDEMEKMRMDLNNETINHLDAENRRQTLEEELEFQKDVHAQELKELAALAYRDTTAENREFWRNELAQAIRDIQQEYDAKCDQMRGDIEAYYNLKVQEFRTGATKQNMEVTRNKEENTKLKSNMTEIRNRLADLEARNAQLERTNQDLLRDLEEKDRQNELESCQYKEEITKLRGEMESILKE----LQDLMDIKLSLELEIAAYRKLLEGEESR 448          
BLAST of Intermediate filament 1 vs. TrEMBL
Match: A0A1Z1R173 (Intermediate filament 1 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1155.2 bits (2987), Expect = 0.000e+0
Identity = 596/596 (100.00%), Postives = 596/596 (100.00%), Query Frame = 2
Query:   62 IIREKSNSTVSLKTMTENNQIENSKEKTVSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY 1849
            IIREKSNSTVSLKTMTENNQIENSKEKTVSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMENELLKKIEICEEKLSEEEALISMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY
Sbjct:    1 IIREKSNSTVSLKTMTENNQIENSKEKTVSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMENELLKKIEICEEKLSEEEALISMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY 596          
BLAST of Intermediate filament 1 vs. TrEMBL
Match: Q86M45 (Intermediate filament protein OS=Dugesia japonica OX=6161 GN=Djf-2 PE=2 SV=1)

HSP 1 Score: 870.152 bits (2247), Expect = 0.000e+0
Identity = 446/614 (72.64%), Postives = 537/614 (87.46%), Query Frame = 2
Query:   32 MQKTVTQNSTIIREKSNSTVSLKTMTENNQI--------ENSKEKTVSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY 1849
            MQKTVTQN+TIIREKS+S VSLK   E NQI        EN +++++SPI++QRTIIINRTN+Q    II +SF Y++ + P  S   G++GN+K++REKDK DMRNLNEKLAGYIEQVRFLEAQNKKQ  EL+NLK+KWGK+TEEVK  Y+ E++NL+ LL +AEKNRGK +FDL NL+++LQ+AK+EL++SR+ ENEL K++E CEE+LSEEEALISMLKKR+  L+E K +D+ EIL LRDEIQNLQ DLNNQTIKYLN ECELQGKLDE+EFLKQIHQ QLNELSALAYRDTTKDNKDFWKAE++LAMQDIQSDYDDRIQMLRSSIESQ GV+MQD K+ENAK  MELN+ K+ENKRIKN+W S++S++PDLENKII LER LVD+R E EENKRDYE+E+S+KTKEL +AD +I + +++LKTLLDDKLSLQLEIAAYRKLLEGEETRWT+K++TVVVHENG+L ++LKTF+NQ+++E+IV+KK+QETNT +TGEISAKSTFNRTTKGN SILEC+TDG+CI LENIGK KE++SDM INRDIDHGRQL KF++PKKT +D +KT+KIWAKGFKP GTNDLEI ETNWG+GSDIHT L +A GEE+ATY
Sbjct:    1 MQKTVTQNTTIIREKSSSNVSLKKGGELNQIDLSSENMKENVQKRSLSPIATQRTIIINRTNSQPSHTIINKSFAYDSMLSPINSNVSGEIGNFKRDREKDKKDMRNLNEKLAGYIEQVRFLEAQNKKQGEELTNLKEKWGKETEEVKNMYSNELKNLQILLIDAEKNRGKMDFDLNNLQNDLQRAKEELDISRNFENELRKQLEKCEEELSEEEALISMLKKRIANLDEQKLRDRKEILNLRDEIQNLQTDLNNQTIKYLNSECELQGKLDEIEFLKQIHQAQLNELSALAYRDTTKDNKDFWKAEIALAMQDIQSDYDDRIQMLRSSIESQNGVKMQDIKSENAKFYMELNATKEENKRIKNDWNSSKSKMPDLENKIIVLERTLVDVRQELEENKRDYEMEISNKTKELADADFLIQDIQMKLKTLLDDKLSLQLEIAAYRKLLEGEETRWTEKNNTVVVHENGSLNNSLKTFINQIQEESIVKKKIQETNTMSTGEISAKSTFNRTTKGNCSILECSTDGKCITLENIGKLKEDMSDMTINRDIDHGRQLTKFMLPKKTILDPSKTLKIWAKGFKPSGTNDLEILETNWGIGSDIHTTLLSATGEEKATY 614          
BLAST of Intermediate filament 1 vs. TrEMBL
Match: A0A5J6BTN2 (Intermediate filament b-like protein 1 (Fragment) OS=Minona ileanae OX=60013 PE=2 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 5.749e-138
Identity = 238/584 (40.75%), Postives = 387/584 (66.27%), Query Frame = 2
Query:  146 VSPISSQRTIIINRT-----NNQVPSQI----IQRSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTS----ATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGN---KTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY 1849
            + P+++ RT++I RT      N   S +    ++RS    + V    +  +  V N  + REK+K DMR+LNE+ A YIE+VRFLEAQNKK + EL+ L+D+WGK+TE +K  Y++EM  L+KLL +A K++ + E  + +LE  + + + +L+ +  + N   + I+    ++S++E+ +S+L++R+   E   ++DK E+ +LRDEI+ L+ DL+ +T+ ++N E E     DE+EFLK++H ++L EL+ALAYRDTT++N++FW++E+S  ++DIQ++YD+++ +++S +E+ Y +++Q+++T N +   EL   K+EN RIK +    R RIP+LE +   LER L +LR ++EE  RD+E+E SS  K L++  + +    ++L+TLLD KLSL+LEIAAYRKLLEGEE+R   ++   +V E    +S+ +T         I  +K      S      GE+SAK+T+ RT KGN+SI EC  DG+ + +EN GK +E+IS M I R++D+GRQ+++F  P KTF++     K+IK+WA+G KP G++D+E  E  WG G++IHT+L ++ GEE+AT+
Sbjct:   34 IKPVATPRTVVITRTAHGGGGNSTGSVVREVEMRRSTGALSSVNGHTAGVHNGVSNIMENREKEKKDMRDLNERFANYIEKVRFLEAQNKKLANELATLRDRWGKETERIKQMYDVEMTQLRKLLDDAMKSKAELEVKVNSLEETVDELQKQLDAANQLHNSDREMIDRLNSQVSDQESELSVLRRRISSFESDHSRDKAEVQRLRDEIRRLRMDLDQETLNHINSEQEAHSLRDEIEFLKKVHDSELKELAALAYRDTTQENREFWRSEMSQCLRDIQNEYDNKLDVMQSEMETHYNLKIQESRTNNTRGGAELQHTKEENIRIKQQLSELRDRIPELEARNAQLERLLEELRRDNEEKLRDWELERSSLRKTLSDNQAELESVLVELQTLLDAKLSLELEIAAYRKLLEGEESRAGLRN---LVEETMKRSSDYET------TRVIETRKTNAMPPSNMGIIKGEMSAKTTYQRTAKGNISIQECAPDGKFLTIENTGKKREDISGMRITRNVDNGRQIIRFTFPDKTFLEPEGRAKSIKVWARGLKPPGSSDMECNENTWGNGANIHTVLISSDGEEKATH 608          
BLAST of Intermediate filament 1 vs. TrEMBL
Match: A0A267FSC2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010052g3 PE=3 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 8.118e-138
Identity = 252/581 (43.37%), Postives = 388/581 (66.78%), Query Frame = 2
Query:  143 TVSPISSQRTIIINRTNNQVPSQIIQRSFNYET----RVIPSKSAAYG------DVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFM-DG-NKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY 1849
            T  PIS+ +T++INRT   +P   I R    ++    RV  S ++A G      +V N    REK+K DM+ LNE+ A YIE+VRFLEAQNKK S EL  LKD+WGK+TE VK  Y  E+  L+KLL ++EK + + E  + +LE +L + +  L+ +        + I+   ++L++ +  IS+L++R+   +E +++D+ EI +LRDE+  L+ DL+ +T+ ++N E E Q   +++EF+KQIH+++L EL+ALAYRDTT +N++FWK E++ A+ +IQ +YD+++ ++RS IESQY +++Q+ +T N +  MEL+ +++ENKRIK +    R+RIP+LE +   LER L +LR E EE +R+ E+E      +L    + + E   +L+TL+D KLSL+LEIAAYRKLLEGEETR      T  +    + T   ++F   V+Q+ + Q + ++  +   GE+SAK+T+ RT KGNVSI EC+ DG+ I+LEN GK KE+IS   + R+ID+GRQ++KF +P    + DG +K I+IWA+G KP G++DLE  E++WG+G++I+T LYN  GEERAT+
Sbjct:   20 TRGPISAPKTVVINRT---LPGFGIGRGDTVDSVKSVRVTRSMASASGIQQTNAEVNNMLNGREKEKKDMQELNERFANYIEKVRFLEAQNKKLSNELQQLKDRWGKETERVKQTYETELAQLRKLLDDSEKQKAEAEVRISSLEDQLNELQVLLDEANRQHQVDRETIDKLNQQLADYDGEISLLRRRVATFDEERSRDRKEIKRLRDEVNRLRGDLDAETLNHINAENEAQSLREQLEFMKQIHESELKELAALAYRDTTSENREFWKNEMAQALHEIQREYDNKMDVMRSEIESQYSMKVQEARTTNTRDNMELSHLREENKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMEKGRLRTDLANTQATLEEYLKELQTLMDMKLSLELEIAAYRKLLEGEETRINQHHRTQELMSQKSSTVESRSFA--VEQQAMHQGQNKQQMSLIKGEMSAKTTYQRTAKGNVSIQECSADGKYILLENTGKKKEDISGWRLLRNIDNGRQVIKFTVPNGVVLGDGPHKNIRIWARGLKPPGSDDLEAAESSWGVGANINTSLYNTEGEERATH 595          
BLAST of Intermediate filament 1 vs. TrEMBL
Match: W0GAA8 (Intermediate filament b-like protein OS=Macrostomum lignano OX=282301 GN=if1 PE=2 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 1.171e-137
Identity = 252/581 (43.37%), Postives = 388/581 (66.78%), Query Frame = 2
Query:  143 TVSPISSQRTIIINRTNNQVPSQIIQRSFNYET----RVIPSKSAAYG------DVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFM-DG-NKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY 1849
            T  PIS+ +T++INRT   +P   I R    ++    RV  S ++A G      +V N    REK+K DM+ LNE+ A YIE+VRFLEAQNKK S EL  LKD+WGK+TE VK  Y  E+  L+KLL ++EK + + E  + +LE +L + +  L+ +        + I+   ++L++ +  IS+L++R+   +E +++D+ EI +LRDE+  L+ DL+ +T+ ++N E E Q   +++EF+KQIH+++L EL+ALAYRDTT +N++FWK E++ A+ +IQ +YD+++ ++RS IESQY +++Q+ +T N +  MEL+ +++ENKRIK +    R+RIP+LE +   LER L +LR E EE +R+ E+E      +L    + + E   +L+TL+D KLSL+LEIAAYRKLLEGEETR      T  +    + T   ++F   V+Q+ + Q + ++  +   GE+SAK+T+ RT KGNVSI EC+ DG+ I+LEN GK KE+IS   + R+ID+GRQ++KF +P    + DG +K I+IWA+G KP G++DLE  E++WG+G++I+T LYN  GEERAT+
Sbjct:   20 TRGPISAPKTVVINRT---LPGFGIGRGDTVDSVKSVRVTRSMASASGIQQTNAEVNNMLNGREKEKKDMQELNERFANYIEKVRFLEAQNKKLSNELQQLKDRWGKETERVKQTYETELAQLRKLLDDSEKQKAEAEVRISSLEDQLNELQVLLDEANRQHQVDRETIDKLNQQLADYDGEISLLRRRVATFDEERSRDQKEIKRLRDEVNRLRGDLDAETLNHINAENEAQSLREQLEFMKQIHESELKELAALAYRDTTSENREFWKNEMAQALHEIQREYDNKMDVMRSEIESQYSMKVQEARTTNTRDNMELSHLREENKRIKGQMTDARNRIPELEARNAQLERELEELRREMEEAERECEMEKGRLRTDLANTQATLEEYLKELQTLMDMKLSLELEIAAYRKLLEGEETRINQHHRTQELMSQKSSTVESRSFA--VEQQAMHQGQNKQQMSLIKGEMSAKTTYQRTAKGNVSIQECSADGKYILLENTGKKKEDISGWRLLRNIDNGRQVIKFTVPNGVVLGDGPHKNIRIWARGLKPPGSDDLEAAESSWGVGANINTSLYNTEGEERATH 595          
BLAST of Intermediate filament 1 vs. Ensembl Cavefish
Match: lmnb1 (lamin B1 [Source:NCBI gene;Acc:103034386])

HSP 1 Score: 99.3673 bits (246), Expect = 2.200e-21
Identity = 138/544 (25.37%), Postives = 262/544 (48.16%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDL--INLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQI-----------HQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLE-------NKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLK---TLLDDKLSLQLEIAAYRKLLEGEETR--WTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEI-PETNWGMGSDIHTILYNAVGEERAT 1846
            R ++K ++ NLN++LA YI++VR LE++N     ++S  ++   ++   +K  Y  E+ + ++ L +  K R + + +L  I  EHE Q  +       D+     +  ++     S+E +L + L +R   LE   A  + +I +L   + + ++ L ++T+  +++E   Q  ++E+EF K +           H+T+L E+      D+ +  +  ++ +L+ A+ D++  +DD++++ +  +E  Y  ++++ +  +       +  ++E K       S  +++  L+       ++I  LE AL     E + ++R     L+ K +E++E   I  + ++QL+    LLD KL+L +EI AYRKLLEGEE R   +   S+ V     + + +++T   + K+   V  +  E ++S +   SA +T      GNV I E   DG+ I L N     + +    + R I       KF  PK     G K + IWA   G       DL    +++WG G ++  +L N  GEE A 
Sbjct:   25 RLQEKEELSNLNDRLAIYIDKVRSLESENSVLHLQISEKEEVRSRELTGLKALYETELADARRSLDDTAKERARLQIELGKIRTEHE-QLLQSYAKKDSDLAGCQARLKDVEALLNSKEASLATALSERKA-LEGSLADLQAQIHELEASLASARKQLGDETLLRVDLENRCQSLVEELEFRKNMFEEEIKDTRRRHETRLVEV------DSGRQVE--YEFKLAQALTDMRQQHDDQVKVYKEEMEQTYMAKLENVRLSSEMNSSSASMAREELKEASLRVESLTAQLSGLQKEARGWQDRINELESALA---QEKDLSRR----MLADKEREISE---IRAKMQLQLEEYEQLLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKR---VDVEESEASSSVSIAHSASAT------GNVCIDELDVDGKFIRLHNTSDQDQPMVGFEMTRTIGDSSATYKFT-PKYVLKAGQK-VTIWASNAGVSSSPPTDLIWKSQSSWGTGENVKVVLTNGDGEEVAV 537          
BLAST of Intermediate filament 1 vs. Ensembl Cavefish
Match: lmnb1 (lamin B1 [Source:NCBI gene;Acc:103034386])

HSP 1 Score: 94.7449 bits (234), Expect = 6.103e-20
Identity = 141/564 (25.00%), Postives = 266/564 (47.16%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDL--INLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQI-----------HQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENA---------------------KLLMELNSIKDENKRIKNEWGSTRS------RIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQL---KTLLDDKLSLQLEIAAYRKLLEGEETR--WTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEI-PETNWGMGSDIHTILYNAVGEERAT 1846
            R ++K ++ NLN++LA YI++VR LE++N     ++S  ++   ++   +K  Y  E+ + ++ L +  K R + + +L  I  EHE Q  +       D+     +  ++     S+E +L + L +R   LE   A  + +I +L   + + ++ L ++T+  +++E   Q  ++E+EF K +           H+T+L E+      D+ +  +  ++ +L+ A+ D++  +DD++++ +  +E  Y  ++++ +  +                       L  +L+ ++ E +   N  GS+R       +    +++I  LE AL     E + ++R     L+ K +E++E   I  + ++QL   + LLD KL+L +EI AYRKLLEGEE R   +   S+ V     + + +++T   + K+   V  +  E ++S +   SA +T      GNV I E   DG+ I L N     + +    + R I       KF  PK     G K + IWA   G       DL    +++WG G ++  +L N  GEE A 
Sbjct:   25 RLQEKEELSNLNDRLAIYIDKVRSLESENSVLHLQISEKEEVRSRELTGLKALYETELADARRSLDDTAKERARLQIELGKIRTEHE-QLLQSYAKKDSDLAGCQARLKDVEALLNSKEASLATALSERKA-LEGSLADLQAQIHELEASLASARKQLGDETLLRVDLENRCQSLVEELEFRKNMFEEEIKDTRRRHETRLVEV------DSGRQVE--YEFKLAQALTDMRQQHDDQVKVYKEEMEQTYMAKLENVRLSSEMNSSSASMAREELKEASLRVESLTAQLSGLQKEEEETLNR-GSSRGGGECQDQARGWQDRINELESALA---QEKDLSRR----MLADKEREISE---IRAKMQLQLEEYEQLLDVKLALDMEINAYRKLLEGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKR---VDVEESEASSSVSIAHSASAT------GNVCIDELDVDGKFIRLHNTSDQDQPMVGFEMTRTIGDSSATYKFT-PKYVLKAGQK-VTIWASNAGVSSSPPTDLIWKSQSSWGTGENVKVVLTNGDGEEVAV 556          
BLAST of Intermediate filament 1 vs. Ensembl Cavefish
Match: lmnl3 (lamin-L(III)-like [Source:NCBI gene;Acc:103047028])

HSP 1 Score: 94.3597 bits (233), Expect = 8.875e-20
Identity = 138/549 (25.14%), Postives = 248/549 (45.17%), Query Frame = 2
Query:  278 VGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLL--TEAEKNRGKTEFDLINLEHEL---QKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSA-----LAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQL-------EIAAYRKLLEGEETRW------TDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATG-EISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEIPE-TNWGMGSDIHTILYNAVGEERA 1843
            V   +  R ++K D+R LN++LA YIE+VR LE+        L   ++   ++   V++ Y  E+ + +K L  T  E+ R + E+  +  +H     +  K E  LS  +E     +  +  ++         +   R  +LE   A  +  +  L   +QN +  +N++T++ ++VE ++Q   ++M+F K + + ++ E+ +     L   D+ +  K+F +++L+ AMQ ++ +++ +IQ  +  +E  +  ++     ENAK +   NS  D     K E   T+ R+     +I +L+     L    +E +R  + E     + L++ D  + +   Q++T L++  SL         EI AYRK+LEGEE R       +  SS    H  GT  +  K             K+  E    A+G   S K + + +++G VSI E    G  I L N     + +   ++ R    G   + F IPK   +    T+ IW+   G +P    DL +     WG  SD+   L+N   EE A
Sbjct:   24 VSPTRLSRLQEKEDLRQLNDRLANYIERVRQLESDKSSMQLLLEEKEETTTRELRSVRLLYENELADARKTLDTTANERARLQIEYSQLCEDHRRLVSRNNKKEAELSNAVERWRSLEAALNSKEADYANL---LAANR--RLETDVADLRTHVDNLESALQNAKTQINSETLRRVDVENQIQTLQEQMDFQKHVTEQEVREMRSRHETRLVEVDSGR-QKEF-ESKLAEAMQQLRQEHEAQIQQYKDDLERTFSAKL-----ENAKQVAVKNS--DFATSTKEELAGTKLRLESQSLQISNLQTQNSTLEARVQELERMLDRERQVSHQRLSQKDQEMADMRQQMQTQLEEYQSLLDLKLMLDMEINAYRKMLEGEEKRLNLSPSPSQHSSISRTHAQGTRKAGSK-------------KRKHE---GASGLSPSYKVSQHSSSRGVVSIDEIDLMGNFIKLRNNSDTDQSLGGWVV-RKRQSGTPDVVFKIPKSCILRAEDTVTIWSAGAGVEPNPPTDLVLSGLKTWGAVSDVLVSLFNTHNEEAA 541          
BLAST of Intermediate filament 1 vs. Ensembl Cavefish
Match: lmnl3 (lamin-L(III)-like [Source:NCBI gene;Acc:103047028])

HSP 1 Score: 94.3597 bits (233), Expect = 9.385e-20
Identity = 137/542 (25.28%), Postives = 246/542 (45.39%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLL--TEAEKNRGKTEFDLINLEHEL---QKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSA-----LAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQL-------EIAAYRKLLEGEETRW------TDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATG-EISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEIPE-TNWGMGSDIHTILYNAVGEERA 1843
            R ++K D+R LN++LA YIE+VR LE+        L   ++   ++   V++ Y  E+ + +K L  T  E+ R + E+  +  +H     +  K E  LS  +E     +  +  ++         +   R  +LE   A  +  +  L   +QN +  +N++T++ ++VE ++Q   ++M+F K + + ++ E+ +     L   D+ +  K+F +++L+ AMQ ++ +++ +IQ  +  +E  +  ++     ENAK +   NS  D     K E   T+ R+     +I +L+     L    +E +R  + E     + L++ D  + +   Q++T L++  SL         EI AYRK+LEGEE R       +  SS    H  GT  +  K             K+  E    A+G   S K + + +++G VSI E    G  I L N     + +   ++ R    G   + F IPK   +    T+ IW+   G +P    DL +     WG  SD+   L+N   EE A
Sbjct:   31 RLQEKEDLRQLNDRLANYIERVRQLESDKSSMQLLLEEKEETTTRELRSVRLLYENELADARKTLDTTANERARLQIEYSQLCEDHRRLVSRNNKKEAELSNAVERWRSLEAALNSKEADYANL---LAANR--RLETDVADLRTHVDNLESALQNAKTQINSETLRRVDVENQIQTLQEQMDFQKHVTEQEVREMRSRHETRLVEVDSGR-QKEF-ESKLAEAMQQLRQEHEAQIQQYKDDLERTFSAKL-----ENAKQVAVKNS--DFATSTKEELAGTKLRLESQSLQISNLQTQNSTLEARVQELERMLDRERQVSHQRLSQKDQEMADMRQQMQTQLEEYQSLLDLKLMLDMEINAYRKMLEGEEKRLNLSPSPSQHSSISRTHAQGTRKAGSK-------------KRKHE---GASGLSPSYKVSQHSSSRGVVSIDEIDLMGNFIKLRNNSDTDQSLGGWVV-RKRQSGTPDVVFKIPKSCILRAEDTVTIWSAGAGVEPNPPTDLVLSGLKTWGAVSDVLVSLFNTHNEEAA 541          
BLAST of Intermediate filament 1 vs. Ensembl Cavefish
Match: lmnl3 (lamin-L(III)-like [Source:NCBI gene;Acc:103047028])

HSP 1 Score: 94.3597 bits (233), Expect = 9.605e-20
Identity = 138/549 (25.14%), Postives = 248/549 (45.17%), Query Frame = 2
Query:  278 VGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLL--TEAEKNRGKTEFDLINLEHEL---QKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSA-----LAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQL-------EIAAYRKLLEGEETRW------TDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATG-EISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEIPE-TNWGMGSDIHTILYNAVGEERA 1843
            V   +  R ++K D+R LN++LA YIE+VR LE+        L   ++   ++   V++ Y  E+ + +K L  T  E+ R + E+  +  +H     +  K E  LS  +E     +  +  ++      L +       +LE   A  +  +  L   +QN +  +N++T++ ++VE ++Q   ++M+F K + + ++ E+ +     L   D+ +  K+F +++L+ AMQ ++ +++ +IQ  +  +E  +  ++     ENAK +   NS  D     K E   T+ R+     +I +L+     L    +E +R  + E     + L++ D  + +   Q++T L++  SL         EI AYRK+LEGEE R       +  SS    H  GT  +  K             K+  E    A+G   S K + + +++G VSI E    G  I L N     + +   ++ R    G   + F IPK   +    T+ IW+   G +P    DL +     WG  SD+   L+N   EE A
Sbjct:   24 VSPTRLSRLQEKEDLRQLNDRLANYIERVRQLESDKSSMQLLLEEKEETTTRELRSVRLLYENELADARKTLDTTANERARLQIEYSQLCEDHRRLVSRNNKKEAELSNAVERWRSLEAALNSKEADYANLLAAN-----RRLETDVADLRTHVDNLESALQNAKTQINSETLRRVDVENQIQTLQEQMDFQKHVTEQEVREMRSRHETRLVEVDSGR-QKEF-ESKLAEAMQQLRQEHEAQIQQYKDDLERTFSAKL-----ENAKQVAVKNS--DFATSTKEELAGTKLRLESQSLQISNLQTQNSTLEARVQELERMLDRERQVSHQRLSQKDQEMADMRQQMQTQLEEYQSLLDLKLMLDMEINAYRKMLEGEEKRLNLSPSPSQHSSISRTHAQGTRKAGSK-------------KRKHE---GASGLSPSYKVSQHSSSRGVVSIDEIDLMGNFIKLRNNSDTDQSLGGWVV-RKRQSGTPDVVFKIPKSCILRAEDTVTIWSAGAGVEPNPPTDLVLSGLKTWGAVSDVLVSLFNTHNEEAA 541          
BLAST of Intermediate filament 1 vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 99.7525 bits (247), Expect = 7.050e-23
Identity = 92/348 (26.44%), Postives = 172/348 (49.43%), Query Frame = 2
Query:  848 HQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVD-----------LRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRW---TDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEIPE-TNWGMGSDIHTILYNAVGEER 1840
            H+++L E+ A         ++  ++++L+ A+QD+++++ D++Q+ ++ +E+ Y      TK ENAK+ ++ NS    +  ++ E   +R RI  L N++ +L+R +             LR E + + R    +L+ K +ELTE    +     + + LL+ KL+L +EI+AYRK+LEGEE R       SS V V  +   +  ++T     ++   VQ+    ++ S T   SA         G +++ E    GR + L N  +  + +    + R I HG   + +    +T +    +I IWA   G +     DL + + + WG G ++  ++ NA GEE+
Sbjct:   11 HESRLVEIDA--------GHQQEYESKLAQALQDLRAEHMDQVQLYKNELENNY-----KTKMENAKMSLQQNSTM--SGVVQEELTESRMRIETLNNQLGALQRQVAGAEAKIRDLEETLRRERDSHWR----QLADKDRELTEIRQAMTAQINEYEQLLEVKLALDMEISAYRKMLEGEEERLHLSPSPSSRVTVTRS---SETVRTSGGAKRKRLDVQESEATSSVSVTQRASA--------SGVIAVDEIDAGGRFVKLINDSQQDQAVGGWTVKRSI-HGHADIVYKFTGRTIVKAGDSITIWAGGAGVQHNPPRDLLMKQHSTWGSGDEVRVVVLNANGEEQ 327          
BLAST of Intermediate filament 1 vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 94.3597 bits (233), Expect = 2.035e-20
Identity = 121/550 (22.00%), Postives = 264/550 (48.00%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELS----------NLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQ-------RDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTT-----KDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLE---RALVD-LRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWT----DKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQ-ETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEI-PETNWGMGSDIHTILYNAVGEERAT 1846
            R ++K  +  LN++LA YIE+VR LE    +    +S             ++  + T  ++  Y+ E+  +++ L +A   +         LE +L+ A+ E +  R   ++  ++  +   ++ + E  +   +  L      K   + E+  LR+++  L+       + L  +T+  +++E  +    +E+EF K+IH+ +++E  + + R+T         +  ++ +LS A+ +++  +++++Q+ R  ++     +++ +     K  +++ SI+++ +   +  G+  S++   ++ +  L+   R L + L HE +++KR     L    +EL E   ++ E  I+ + LLD KL+L +EIAAYRKLLEGEE+R          + VV  + + + +++T   +       +K+VQ E    +  +     + + +  G++ I E   +G+ + + N  +  + +   ++ R I+   + + +    +  +   +T+ IWA   G      +DL    +++WG G DI T L N+ GEE A 
Sbjct:   16 RLQEKESLVELNDRLAAYIERVRSLEVDKARLLARVSMWEEEEEEQRQKSERQREATGGLRAAYDAELAEVRRALDDALGAKAA-------LEIQLRLAQVERDEGRSRCSKYEQEWNVALGRIRDMEVQLCAKEASLSTASGDKEYLETEVDDLRNQVNQLEGVLVSSKQQLEEETLARVDLENRMLTLQEELEFTKRIHEQEIHE--SRSKRETHVLEIDGGQQQAFEYKLSEALTELRQQHEEQVQLYRQELDQTMRAKLEKSILTPEKQSLDI-SIREDLREATSRVGTLSSQLSAAQHDLALLQGRVRELEETLSHERDQSKR----RLDESDRELAELREVMDEQLIEYEQLLDIKLALDMEIAAYRKLLEGEESRLNLSPEKGVQSSVVQTSTSASHSIRTMPGK-------RKRVQLEGFVDSMAQSQRSVSQHASASGSIGIKEVDMEGKSVTMVNNSEKDQPLGGWVLKRQIEDQAE-IAYKFSSRYVLKAGQTVTIWAANAGVSHNPPSDLLWKTQSSWGTGDDIRTSLLNSDGEEVAV 543          
BLAST of Intermediate filament 1 vs. Ensembl Sea Lamprey
Match: lmnb2 (lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13])

HSP 1 Score: 86.2705 bits (212), Expect = 2.506e-18
Identity = 88/361 (24.38%), Postives = 171/361 (47.37%), Query Frame = 2
Query:  848 HQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVD-----------LRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRW---TDKSSTVVVHEN-----------GTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEE--ISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEIPE-TNWGMGSDIHTILYNAVGEER 1840
            H+++L E+ A         ++  ++++L+ A+QD+++++ D++Q+ ++ +E+ Y      TK ENAK+ ++ NS    +  ++ E   +R RI  L N++ +L+R +             LR E + + R    +L+ K +ELTE    +     + + LL+ KL+L +EI+AYRK+LEGEE R       SS V V  +           G ++ +     +          +    ++ +    S   T   +  G +++ E    GR + L N  + +++  +    + R I HG   + +    +T +    +I IWA   G +     DL + + + WG G ++  ++ NA GEE+
Sbjct:   10 HESRLVEIDA--------GHQQEYESKLAQALQDLRAEHMDQVQLYKNELENNY-----KTKMENAKMSLQQNSTM--SGVVQEELTESRMRIETLNNQLGALQRQVAGAEAKIRDLEETLRRERDSHWR----QLADKDRELTEIRQAMTAQINEYEQLLEVKLALDMEISAYRKMLEGEEERLHLSPSPSSRVTVTRSSETVRTSGGGGGAVSRSASGAGSASGAGGAASSRSSVASSESEATSSVSVTQRASASGVIAVDEIDAGGRFVKLINDSQQEQDQAVGGWTVKRSI-HGHADIVYKFTGRTIVKAGDSITIWAGGAGVQHNPPRDLLMKQHSTWGSGDEVRVVVLNANGEEQ 350          
BLAST of Intermediate filament 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010102.1 (pep scaffold:Pmarinus_7.0:GL478364:74479:82531:1 gene:ENSPMAG00000009106.1 transcript:ENSPMAT00000010102.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 8.969e-12
Identity = 81/363 (22.31%), Postives = 166/363 (45.73%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEIL---KLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSA-LAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTD 1375
            R ++K  +++LN++ A +I++VRFLE QNK        L+ +W    E+     +I+       + EA  N  + + D   L H+    K +LN                             L +    +E+ +AK + EI        E   +++D++   +  + +E  LQG +DE+ FL+ I   +L+EL A + + +   +  +    ++   + D++  Y+      R+  ++ Y  + Q   +++ +   EL   ++E   +  +    R+ +  L+ +   LE A+ +     E + R+ +  ++   +E+ +A   +     + + L++ KL+L +EI  YRKLLEGEE+R ++
Sbjct:  137 RTQEKEAIKHLNDRFANFIDKVRFLEQQNKV-------LEAQWYALQEKTTTGSSIDE------MFEAYINGLRRQLD--GLGHD----KGQLN---------------------------GNLGQMQAVVEDFRAKYEAEINNRNAAEGEFVVVKKDVDGAYLSKVELETRLQGLVDEINFLRSIFTQELSELEAQIKHTNVLVEIDNSRNLDVDGIIADVRQQYETIAARSRAEADAFYQDKFQSLHSDSGRNDEELRMTRNEITELNRQMQRFRAEMEALKKQRAKLESAIAEAEGRGEADIREAKAAIAQLEEEIHKAKQEMARHVREYQELMNVKLALDIEIVTYRKLLEGEESRSSE 453          
BLAST of Intermediate filament 1 vs. Ensembl Sea Lamprey
Match: desmb (desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102])

HSP 1 Score: 63.929 bits (154), Expect = 4.394e-11
Identity = 94/400 (23.50%), Postives = 176/400 (44.00%), Query Frame = 2
Query:  188 TNNQVPSQIIQRSFNYETRVIPSKSAAYGDV----GNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTE--AEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFW-KAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETR 1366
            ++  V S +  RS+    + +P +S  +        +Y+  R  +K +++ LN++ A YI++VR+LE QNK    EL+ LK   G++   V   Y  E++ L+  +     EK RG  E    NL  ELQ+                                   L++RL +    + + +  +       Q  ++D+++ T+  +++E +++   +E+ FLK+IH  +L E+       T     D   K +L+ A++DI+++Y+       +  E  Y  +  D      +    L + K E    + +  + +  I  L+    SLER + ++         +Y+  ++    ++      +       + LL  K++L +EIA YRKLLEGEETR
Sbjct:   47 SSGSVASSLYGRSY---VKAMPGQSVDFSLAEALNADYRTTRTNEKVELQELNDRFANYIDKVRYLEQQNKALLAELALLK---GREPTRVGPLYEQELRELRAQVERLTGEKARGDVE--RANLLDELQR-----------------------------------LQQRLQEETAAREEAEKNL-------QAFRQDVDDATLARVDLERKVESLQEEIAFLKKIHDEELREVQVQVQEQTVHVEYDVGTKPDLTAALRDIRAEYEGIAAKNVAEAEEWYKSKFLDLSEAAVRNNEALRAAKQELMDYRRQVQAQQCDIDSLKGANESLERQIREMEERFSVESANYQDTITRLEDDIGNLKDEMARHLRDYQELLHVKMALDIEIATYRKLLEGEETR 396          
BLAST of Intermediate filament 1 vs. Ensembl Nematostella
Match: EDO37225 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGD1])

HSP 1 Score: 107.071 bits (266), Expect = 3.137e-24
Identity = 142/566 (25.09%), Postives = 262/566 (46.29%), Query Frame = 2
Query:  239 TRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQ--------------KAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-SALAYRDTTK-----DNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRW--TDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDID-HGRQLLKFVIPKKTFMDGNKTIKIW-AKG---FKPVGTNDL---EIPETNWGMGSDIHTILYNAVGEERAT 1846
            T V  S+       G+ K  R ++K+++++LN++LA YI++V+ LE +N K   E++  +    ++ + +K  Y  E+ + ++LL E  K + K + +     ++ Q              KA+ ELN   D+   L  K      +  E   L S+L++  G+ EE           L+D ++  +  L  +T+  +++E   Q   +E  F KQ++  +L+++ S L   +T +     D KD ++  ++  +Q+++ DYD   +  +   E  Y  + ++ + +  +    L  +++EN+ +        S++  LE K  +L   + DL+    ++K  ++ E+  +  E+ E  + I +     + L+  K++L +EI AYRKLLE EETR   T  +S V+    G  +S        V Q     K+ +   T +T       T   T +G +   E   DG+ I + N G+  E +    I R +      + KF    K  +     + +W A+G    KP   +DL   ++P  +WG G++  T L NA GEE AT
Sbjct:   17 TPVSSSRIMGSSPPGSAKFTRAQEKAELQHLNDRLATYIDRVKNLEQENSKLRSEVTVSRKTVEREVDSMKSLYETELADARRLLDETAKEKAKQQIESSKNSNDAQEFKNKFDKEAAARKKAEKELN---DVRKLLHDKENQLTRRNQEALNLESVLRELQGECEE-----------LKDALKAAKYALEQETLTRVDLENRCQSLQEEQNFKKQMYDKELSDIRSQLKTVETKRVVVETDYKDKYEGLMAEKLQELREDYDSDARSFKEETELLYSSKFEELRIQRERDSEALAKLREENRNLSKSVDELSSQVHQLEAKNNALVSRVSDLQGLRAQDKEKHDNEILLRENEIAELRTSIDDALRDYEDLMGVKVALDMEITAYRKLLESEETRLEITPPASPVL----GGSSS--------VSQTRRGNKRARTEETEST------MTTTTTAEGAIQFTEADPDGKYIKIYNSGEKDEALGGWTIQRQVGTEDPSVYKFT--PKYVLKSQSHVTVWSAQGGGTHKP--PSDLVFKQLP--SWGSGNEARTALVNAGGEEMAT 544          
BLAST of Intermediate filament 1 vs. Ensembl Medaka
Match: ENSORLT00000011270.2 (lamin-A [Source:NCBI gene;Acc:101160250])

HSP 1 Score: 121.324 bits (303), Expect = 2.481e-28
Identity = 125/529 (23.63%), Postives = 247/529 (46.69%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINL--EHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDN----KDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSAT---GEISAKS--TFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWA--KGFKPVGTNDLEI-PETNWGMGSDIHTILYNAVGEERA 1843
            R ++K D+ NLN++LA YI++VR LEA+N      ++  + +  ++   +K  Y  E+ + +K L    K R + + +L  L  +H+  KA++    S         K         +     ++ +KR   LE      K ++ KL   + + ++ L ++ ++ ++ E  +Q   +E+EF K +H  +L E          + N    +DF +++L+ A+ +++S ++ +IQ+ +  IE  Y  +++  +    +    + +  +E ++I+    ST +++  L+ ++ + E  + DL       +      L+ K +E+ +    + +   + + LLD KL+L +EI AYRKLLEGEE R     S       G+ +S  ++  +  +     +++  E ++ A+   G   A++  T   +  G V++ E   DG+ + L N     + +    + R +  G  +L F  P K  +   + + IWA   G      +DL    + +WG G    T L +A GEE A
Sbjct:   23 RLQEKEDLSNLNDRLAVYIDKVRSLEAENACLRVRITESETEVTRELTGLKNAYEAELADARKTLDSVAKERARLQLELGKLREDHKELKARNTKKESDLAAALQRLKDLEALMNSKDASLTTALGEKR--NLEVENRDLKAQVSKLDTGLGDARKQLQDEMLRRVDGENRIQTLKEELEFQKNLHSEELQETKRRHESRMVEMNNGQQQDF-ESKLAEALVEMRSQHELQIQLYKEEIEKTYNAKLESARQSADRSSHLVGAAHEELQQIRTRLESTSAQLSQLQKQLAAREAKIRDLEDALTRERDSTRRLLADKEREMADMRQRMQQQLDEYQELLDVKLALDMEICAYRKLLEGEEERLRLSPSPPPTRVTGSRSSVGRSVHSSAQSSPAKRRRPNEADSEASSYGGGALARTRITQQASASGRVTVDEVDLDGKYVRLSNKADEDQNLGSWQVRRQVGSGTPIL-FKFPAKFTLKAGQRVTIWASNAGGSHNPPSDLVWKSQPSWGTGDQFQTTLISASGEEMA 547          
BLAST of Intermediate filament 1 vs. Ensembl Medaka
Match: lmnb2 (lamin B2 [Source:NCBI gene;Acc:101158263])

HSP 1 Score: 105.916 bits (263), Expect = 2.014e-23
Identity = 139/555 (25.05%), Postives = 264/555 (47.57%), Query Frame = 2
Query:  257 KSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKA-----KDELNLSRDMXXXXXXXXX--XXXXXXXXXXXXXSMLKKRLGKLEE--HKAKDKMEILKLRDEIQNLQR-DLNNQTIKYLNVECELQGKL--DEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSS-----------KTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIW-AKGFKPVGTND--LEIPETNWGMGSDIHTILYNAVGEERA 1843
            +SAA   +   +  R ++K D++ LN++LA YIE+VR LE +N +   ++S  ++   ++   +K  Y  E+ +L+++L E  K R + + DL   + +L++A     K E +L+  +      + +    E  LS   +  + L   LG+++    KA+D   + K + E + L R DL N+  + L+ + + +  +  +EM   ++  + ++ E+ + A ++        ++ +L+ A+QD++  +D+++   +  +E  +       K ENA +  E+++   +  R   E   +RSRI  L  ++ SL++ +      SE+  R+ E  LS+           K +E++E    +     + + LLD KL+L +EI AYRKLLEGEE R     S      +  +T +  T  +  +       +V+    +   E     +   T+ G+VSI     DG  + L N     + +    + R +D+G +++    PK     G +++ +W A   KP       L   + +WG GS I T L ++ GEE A
Sbjct:   14 RSAASTPLSPTRISRLQEKQDLQQLNDRLAVYIERVRALELENDRLMVKVSEKEEVTTREVTGLKALYEAELADLRRVLDETAKERARLQIDLGKAQADLEEATRSAKKKEADLAAAVSRANSLEGQLHKSEAALSTALSQSAALTSELGEVKSLLAKAEDGHAVAKRQLEAETLMRVDLENR-CQSLSEDLDFRRNMFDEEMRESRRHQEQRIVEVDSGARQE--------YEFKLTQALQDLRKQHDEQVSFYKEELEKTF-----QAKLENAHVSSEMSNAAMDAAR--EELQESRSRIESLSYQLSSLQKQV----GTSEDRIRELEEILSAERDRHRRAMERKEQEMSELREGMDAQLSEYQELLDVKLALDVEINAYRKLLEGEEHRLKLSPSP-----SARVTVSRVTGSSSSRSTKRKWSEVEAQEEAGQAEEQLLVSEEATSTGSVSICPTDMDGTSVKLTNETDQDQPLGSWRLRRQVDNGEEVVYKFSPKFVLKAG-QSVTVWSADAGKPHNPPSELLWKSQASWGTGSTIVTSLIDSSGEEVA 542          
BLAST of Intermediate filament 1 vs. Ensembl Medaka
Match: lmna (lamin A/C [Source:NCBI gene;Acc:101162240])

HSP 1 Score: 97.4413 bits (241), Expect = 1.179e-20
Identity = 134/560 (23.93%), Postives = 251/560 (44.82%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDL--INLEHELQKA---KDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLE--EHKAKD-KMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNEL-----SALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERAL----VDLRHESEENKRDYEI---ELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRW----TDKSSTVVV-------HENGTLTSNLKTFVNQVKQETIVQKKVQ---ETNTSATGEISAKSTFNR--TTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETN--------WGMGSDIHTILYNAVGEERAT 1846
            R ++K D+ NLN++LA YI++VR LEA+N      +S  +    +D   +K  Y  E+ + +  L +  K + + + DL  I  EH+  KA   K EL+L   +      +  +  +         + L   LG+    E + KD K ++ KL   + + ++ L ++ +K ++ E  LQ   +E+EF K I+  +  E      S +   D ++  +  ++ +L+ A+ ++++ +++++ + +  +E  Y  R+++ +  +A+    L     E      E   TRSR+  L  ++  L++ L      +R   E   R+ ++    L  K +E+ E  + + +     + LLD KL+L +EI+ YR LLEGEE R     +  S+ V+V       H +  L S+     ++        KK +       S  G    KS  ++  +  G + + E   +G+ I L N     + +    +   +  G   + +  P K  +    T+ IWA      GT++   P T+        WG G  +  IL ++ GEE A 
Sbjct:   20 RLQEKEDLCNLNDRLAVYIDKVRSLEAENAGLRLRISESESLVTRDLSGIKAAYENELADARHALDQVAKEKARLQLDLGKIREEHKELKARNTKKELDLEAALARLRDLEALLNSKD--------AALATALGEKRNLEAEVKDLKAQLAKLDMNLADARKQLQDEMLKRVDAENRLQTVKEELEFQKNIYNEETRESKRRSESRMVEIDCSRQQE--FENKLAAALVELRAQHEEQVSIYKEELEKTYNSRLENAR-HSAERTTHLVGAAHE------ELQQTRSRLEGLTLQMTQLQKQLSASEAKVRELEEALSRERDLMRRRLEDKDREMAENRARMQQQLEDYQELLDIKLALDMEISHYRTLLEGEEERLRLSPSPPSAKVIVTRSTGSSHASRLLHSSAVASSSRTSSGASSTKKRRLNDSVAASMVGGTVVKSHISQQASASGRIVVNEVDLEGKFIRLSNKSDEDQSLGSWQVKAQVGDGNP-VTYKFPSKFSLKAGATVTIWAASGG--GTHN---PPTDLVWKNQNSWGTGDSLEIILVSSSGEEMAA 556          
BLAST of Intermediate filament 1 vs. Ensembl Medaka
Match: lmnl3 (lamin-L(III) [Source:NCBI gene;Acc:101168604])

HSP 1 Score: 92.0485 bits (227), Expect = 4.753e-19
Identity = 115/537 (21.42%), Postives = 252/537 (46.93%), Query Frame = 2
Query:  299 REKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTE--AEKNR-----GKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKK--RLGKLEEHKAKDKMEILKLRDEIQNLQR-------DLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTK------DNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETN--WGMGSDIHTILYNAVGEE 1837
            R +++ ++R+LN++LA YI++V+ LE +       L   ++   ++T  V+  Y  E+ ++++ L E  AE+ R     G    D++ L+   QK ++      D+   + ++ ++     S+E     +L +  RLG           E+  L+ +++N +R        L+++ ++ + +E ++Q   +++E  K I + ++ E+ +   R  T+        +  ++++L+  MQ ++ D+  ++Q  + ++E  +  ++Q+ +    +  + +++ ++E +  + +  S RS++   +   + LE    +L+   ++ +  ++  LS K +EL    + ++      + LLD KL+L +EI AYRK+LE EE R    S T   H          T V +V++   ++ K ++   +     + K     T KG V++ E    G+ + ++N    ++ +   ++ R   H    + F  P    + G +T+ IW+ G          + E N  WG   D+  +L N   EE
Sbjct:   27 RVQERGELRHLNDRLANYIQRVQELEQEKGAMLLRLQEQEEATARETRGVRRLYEEELADVRRALDELAAERARLQIEQGNQREDILKLQSRNQKKEN------DLAAAVTQRRKVEAVLSSKEAENRKLLSENGRLGG----------EVADLQVQLENAERLLAETKNQLSSEILRRVEMENQVQTLKEQLELQKNISRQEILEVRS---RQETRLVEVESGRRREFESKLAETMQQLREDHTLQLQQYKEAMEKTFSTKLQNAQQAAEENGVSVSTAREELEASREKLESLRSQLQQNQKDKLVLEERFQELQRTLDQERDAWQQRLSLKERELLSMRTQMNSQLENHQNLLDVKLALDMEINAYRKMLEVEEQRL-QLSPTPPRH----------TSVARVQEHHQLRGKKRKHEEATRSSPAYKICRRSTRKGGVTVAEVDVGGKYVQIQNNSDQEQPLGGWVVRRVYPHSGD-VSFQFPPSCVLAGGQTLTIWSSGAADEAEPGDMVLENNGSWGAVGDMRVVLLNPSHEE 532          
BLAST of Intermediate filament 1 vs. Ensembl Medaka
Match: lmnl3 (lamin-L(III) [Source:NCBI gene;Acc:101168604])

HSP 1 Score: 90.5077 bits (223), Expect = 1.772e-18
Identity = 115/540 (21.30%), Postives = 253/540 (46.85%), Query Frame = 2
Query:  290 KKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTE--AEKNR-----GKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKK--RLGKLEEHKAKDKMEILKLRDEIQNLQR-------DLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTK------DNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETN--WGMGSDIHTILYNAVGEE 1837
            +  R +++ ++R+LN++LA YI++V+ LE +       L   ++   ++T  V+  Y  E+ ++++ L E  AE+ R     G    D++ L+   QK ++      D+   + ++ ++     S+E     +L +  RLG           E+  L+ +++N +R        L+++ ++ + +E ++Q   +++E  K I + ++ E+ +   R  T+        +  ++++L+  MQ ++ D+  ++Q  + ++E  +  ++Q+ +    +  + +++ ++E +  + +  S RS++   +   + LE    +L+   ++ +  ++  LS K +EL    + ++      + LLD KL+L +EI AYRK+LE EE R    S T   H          T V +V++   ++ K ++   +     + K     T KG V++ E    G+ + ++N    ++ +   ++ R   H    + F  P    + G +T+ IW+ G          + E N  WG   D+  +L N   EE
Sbjct:   24 QPPRVQERGELRHLNDRLANYIQRVQELEQEKGAMLLRLQEQEEATARETRGVRRLYEEELADVRRALDELAAERARLQIEQGNQREDILKLQSRNQKKEN------DLAAAVTQRRKVEAVLSSKEAENRKLLSENGRLGG----------EVADLQVQLENAERLLAETKNQLSSEILRRVEMENQVQTLKEQLELQKNISRQEILEVRS---RQETRLVEVESGRRREFESKLAETMQQLREDHTLQLQQYKEAMEKTFSTKLQNAQQAAEENGVSVSTAREELEASREKLESLRSQLQQNQKDKLVLEERFQELQRTLDQERDAWQQRLSLKERELLSMRTQMNSQLENHQNLLDVKLALDMEINAYRKMLEVEEQR-LQLSPTPPRH----------TSVARVQEHHQLRGKKRKHEEATRSSPAYKICRRSTRKGGVTVAEVDVGGKYVQIQNNSDQEQPLGGWVVRRVYPHSGD-VSFQFPPSCVLAGGQTLTIWSSGAADEAEPGDMVLENNGSWGAVGDMRVVLLNPSHEE 532          
BLAST of Intermediate filament 1 vs. Planmine SMEST
Match: SMESG000046938.1 (SMESG000046938.1)

HSP 1 Score: 1175.23 bits (3039), Expect = 0.000e+0
Identity = 605/606 (99.83%), Postives = 606/606 (100.00%), Query Frame = 2
Query:   32 MQKTVTQNSTIIREKSNSTVSLKTMTENNQIENSKEKTVSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY 1849
            MQKTVTQNSTIIREKSNSTVSLKTMTENNQIENSKEKTVSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMENELLKKIEICEEKLSEEEALISMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAE+SLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY
Sbjct:    1 MQKTVTQNSTIIREKSNSTVSLKTMTENNQIENSKEKTVSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMENELLKKIEICEEKLSEEEALISMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAEISLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY 606          
BLAST of Intermediate filament 1 vs. Planmine SMEST
Match: SMESG000062826.1 (SMESG000062826.1)

HSP 1 Score: 360.918 bits (925), Expect = 4.831e-116
Identity = 225/587 (38.33%), Postives = 369/587 (62.86%), Query Frame = 2
Query:  146 VSPISSQRTIIINRTNNQVPS---------QIIQRSFNYETRVIPSKSA--AYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQK-KVQETNTSAT----GEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDG---NKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY 1849
            + PIS  R ++I RT   V +         + I+ S +Y     P  ++   +  V N    REK+K+++++LN++ A YI++VR LE +NK+ S EL +LKD+WGK+T  +K  Y+ +M  L++ L +AE  + + E  +  LE  + +A+ ELN +  +     + I+     LS+ E  I+ L+KRLG LEE K +D  EI++L++E+  L++DL  +T++++    ELQ  +D++EFLK+I ++++ EL++L Y+D+T +NKDFW+ E++ A++DIQ++YD ++  L   +E+QY +++Q+ +T  ++  +E   +++EN R+K++    R+R+P+LE +   LER L  LR E EE  R++++E ++  KEL    + +    I+L+ LLD KLSL+LEI AYRK+LEGEE R   KS     ++N   T      ++ V + +I Q+     T T  T    GE+SAK++F RT KGNV+I EC+ DG+ IILEN G  +E+IS  ++ R+ D+GR ++K VIP KT ++    N+  KIWA+G +P G+ D E  E+NWG G+ I T+L N+ GEE+AT+
Sbjct:   22 IQPISGYRNVVITRTGPTVSTVGTQGGSNIRTIEMSKSYGLSSTPGATSNIVHNGVNNLMNGREKEKNELQDLNDRFANYIDKVRNLEDENKRLSDELVDLKDQWGKETARIKTFYDNDMIQLRRSLDQAEGAKAQMEMKINTLEDLILEAQTELNDATQLHLADKETIDKMASTLSDYEHEIANLRKRLGGLEEEKVRDNKEIMRLKEELNLLKQDLEKETLEHITAHNELQSLVDQIEFLKKIFESEVRELASLVYKDST-ENKDFWRNEMAQALRDIQTEYDRKLDTLHYDMEAQYTLKIQEIRTTQSQENVETVQLREENTRLKDQLAEMRNRLPELEARNNELERLLELLRREIEEKNREFDLEKNNLRKELLNRKAELEGILIELQILLDAKLSLELEIIAYRKMLEGEEYRVNRKS-----NQNLNQTGRSVDTMDHVTRTSISQQHAAPSTKTQVTSVIKGEMSAKTSFQRTAKGNVTIQECSPDGKFIILENTGSQEEDISGYILQRNTDNGRIVIKHVIPSKTILEPTGKNRYYKIWARGNRPQGSGDPECSESNWGFGAQIVTVLQNSKGEEKATH 602          
BLAST of Intermediate filament 1 vs. Planmine SMEST
Match: SMESG000046289.1 (SMESG000046289.1)

HSP 1 Score: 350.132 bits (897), Expect = 2.385e-112
Identity = 213/582 (36.60%), Postives = 346/582 (59.45%), Query Frame = 2
Query:  146 VSPISSQRTIIINRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLE---HELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELT----EADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETR--WTDKSSTVVVHENGTLTSNL--KTFVNQVKQETIVQKKVQETNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDG---NKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY 1849
             S  S++ T+ IN+++  V    +++S+N+    +      + +V +  + RE++K +M++LNE+LA YIE+VRFLEAQNK+ + EL+ L+++WGK+ E ++  Y IEM  LKKLL EAE  R +    +  LE   HE  +  DE N    M+ E+++K+     +   E     +L++R+  LEE + + K  I +LRDEI+  + DL+ +T+ ++  E E+Q + DE++F+K  H  ++ EL+ALAYRD+T +N+DFW++E+  +++++Q +YD +++ +R  +E+ + V++Q+ +  + +  +E   +K+EN R+KN+  + RS+ P++E K   LER L +LR + +    D+E E      +L     E DSI+ E     + ++D KLSL+LEIAAYRKLLEGEE+R    +     +   +G +  N+  KT V+ + +                 E +AK    RT KGNV I E + DG+ IILEN GK  E+IS   I R+ID+ R ++++ IP  T +      K +KIW+KG +P G+NDLE    NWG G+ I T L N   EERAT+
Sbjct:    2 ASRTSARSTVTINKSSPAVKEYEMRQSYNFSGAPMGGSVQIHSNVSSAVEGREREKREMQDLNERLANYIEKVRFLEAQNKRLTNELNTLRERWGKEAERIRALYEIEMDQLKKLLDEAEAARSELLPKINKLEEQLHEYLQGIDEANNQHGMDQEMIEKLNRQLSECEGEI---GLLRRRIAALEEERGRSKKTISRLRDEIKRTRMDLDQETMNHIASESEVQSRKDEIDFMKDSHDNEMKELAALAYRDSTAENRDFWRSEMGSSLRELQIEYDRKLEAMRGDLENHHNVKVQELRHSSPREGVESIHLKEENIRLKNQLSNLRSKCPEMEAKNAQLERFLEELRRDLDRQINDFESERDKLRSDLQRTQDELDSIMKE----FQNVMDMKLSLELEIAAYRKLLEGEESRSGLRNMMEQTIFKTSGGIEGNIISKTAVSNLMK----------------NERNAKVNHQRTAKGNVIIHETSADGKFIILENTGKKDEDISGFKIIRNIDNDRSIIRYEIPNSTILKPEGQQKFLKIWSKGNRPTGSNDLECSSANWGTGTHIFTALLNKSNEERATH 560          
BLAST of Intermediate filament 1 vs. Planmine SMEST
Match: SMESG000030598.1 (SMESG000030598.1)

HSP 1 Score: 261.922 bits (668), Expect = 1.099e-77
Identity = 179/537 (33.33%), Postives = 295/537 (54.93%), Query Frame = 2
Query:  278 VGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQE-------------TNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY 1849
            V + KK R ++K D+++LNE+ A YIE+ RFLEAQNK+ + E+  LK    +D  ++K  Y +E+  L+ L+ E+EK++   E  + +LE+E+   +  L +  D+ ++    I+   + +S  E  +  L++  G       K+K E+  LRD+++ L++D   + + +L +E ELQ   + +EF KQIH T++ EL+ +AYRD TK+N  +W++E+  A++DIQ++Y++++  ++  +E+ YG++MQ+ +T   +  +E    K+EN RIK++  S RSRI DLE +    E  L ++R   EE +R  E++L    ++LT     +     +L++LLD KL L+LEIAAY KLLE EE+R            N TL S   +F +                           T    T   S +  F RTTKGN+SI E    G  IILENIG   E +  M I R +D     + F I  K  ++  + I + AKG       ++EI + +WG+G+++ T L ++ G E+A +
Sbjct:  145 VTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-----NFSADGNATL-SQFMSFTSSSGAGGAGGSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAH 675          
BLAST of Intermediate filament 1 vs. Planmine SMEST
Match: SMESG000030598.1 (SMESG000030598.1)

HSP 1 Score: 259.996 bits (663), Expect = 6.034e-77
Identity = 177/537 (32.96%), Postives = 294/537 (54.75%), Query Frame = 2
Query:  278 VGNYKKEREKDKSDMRNLNEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNLKKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMXXXXXXXXXXXXXXXXXXXXXXSMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTIKYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAELSLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDENKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSKTKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKSSTVVVHENGTLTSNLKTFVNQVKQETIVQKKVQE-------------TNTSATGEISAKSTFNRTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFVIPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVGEERATY 1849
            V + KK R ++K D+++LNE+ A YIE+ RFLEAQNK+ + E+  LK    +D  ++K  Y +E+  L+ L+ E+EK++   E  + +LE+E+   +  L +  D+ ++    I+   + +S  E  +  L++  G       K+K E+  LRD+++ L++D   + + +L +E ELQ   + +EF KQIH T++ EL+ +AYRD TK+N  +W++E+  A++DIQ++Y++++  ++  +E+ YG++MQ+ +T   +  +E    K+EN RIK++  S RSRI DLE +    E  L ++R   EE +R  E++L    ++LT     +     +L++LLD KL L+LEIAAY KLLE EE+R            N TL+  +    +                           T    T   S +  F RTTKGN+SI E    G  IILENIG   E +  M I R +D     + F I  K  ++  + I + AKG       ++EI + +WG+G+++ T L ++ G E+A +
Sbjct:  145 VTSMKKGRAQEKRDLQDLNERFASYIEKARFLEAQNKQLANEIEKLKGGTVQDNSKIKEIYEVEINQLRALVNESEKSKAPLEAQVDSLEYEIDDLRKRLMMLEDINSQYKSTIDKQRKDISGFEGELVELRRFKGTQGADVNKEKEEVKTLRDDLKKLRQDYEKEALAHLTLEHELQSLKEALEFEKQIHDTEVKELATVAYRDPTKENMVYWQSEMGRALRDIQTEYENKLTGIKQELEASYGLQMQEIRTSKTRDNVETTHYKEENSRIKSQIQSMRSRIADLEMQNAEYEHNLNNIRANYEETQRSLELQLLYLQEQLTGTQQELTVALTELQSLLDAKLGLELEIAAYAKLLEFEESRV-----NFSADGNATLSQFMSFTSSSGAGGGGGSSGFGSGSRIGGSSGFSGMTERETTDYQSKRMKFRRTTKGNISIAETDLIGSTIILENIGTKVESLEGMTIKRVVDGSENKISFTISGKVNLNAGEKISLCAKGKITGKGREIEIDDASWGVGNNVVTTLCDSEGAEKAAH 676          
The following BLAST results are available for this feature:
BLAST of Intermediate filament 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LMNA5.300e-2623.83lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA7.478e-2623.83lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA1.188e-2523.83lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNA2.623e-2523.58lamin A/C [Source:HGNC Symbol;Acc:HGNC:6636][more]
LMNB11.077e-2325.52lamin B1 [Source:HGNC Symbol;Acc:HGNC:6637][more]
back to top
BLAST of Intermediate filament 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ifa-11.063e-8633.45Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-11.063e-8633.45Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-11.063e-8633.45Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-11.185e-8633.45Intermediate filament protein ifa-1 [Source:UniPr... [more]
ifa-11.462e-8633.45Intermediate filament protein ifa-1 [Source:UniPr... [more]
back to top
BLAST of Intermediate filament 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lam5.749e-2725.46gene:FBgn0002525 transcript:FBtr0346460[more]
Lam5.749e-2725.46gene:FBgn0002525 transcript:FBtr0307059[more]
Lam5.749e-2725.46gene:FBgn0002525 transcript:FBtr0307058[more]
Lam5.749e-2725.46gene:FBgn0002525 transcript:FBtr0079100[more]
LamC1.140e-2324.20gene:FBgn0010397 transcript:FBtr0087512[more]
back to top
BLAST of Intermediate filament 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmnl33.319e-2423.72lamin L3 [Source:ZFIN;Acc:ZDB-GENE-020424-4][more]
lmnl34.802e-2423.72lamin L3 [Source:ZFIN;Acc:ZDB-GENE-020424-4][more]
lmnb25.319e-2424.64lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
lmna7.500e-2422.73lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
lmna7.500e-2422.73lamin A [Source:ZFIN;Acc:ZDB-GENE-020424-3][more]
back to top
BLAST of Intermediate filament 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmx1a1.077e-2323.43LIM homeobox transcription factor 1 alpha [Source:... [more]
lmx1a1.382e-2323.43LIM homeobox transcription factor 1 alpha [Source:... [more]
lmx1a2.122e-2323.26LIM homeobox transcription factor 1 alpha [Source:... [more]
rnasek1.672e-2224.67ribonuclease K [Source:Xenbase;Acc:XB-GENE-6046202... [more]
rnasek5.423e-2224.44ribonuclease K [Source:Xenbase;Acc:XB-GENE-6046202... [more]
back to top
BLAST of Intermediate filament 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lmnb21.505e-2924.69lamin B2 [Source:MGI Symbol;Acc:MGI:96796][more]
Lmnb21.929e-2924.69lamin B2 [Source:MGI Symbol;Acc:MGI:96796][more]
Lmnb11.402e-2325.09lamin B1 [Source:MGI Symbol;Acc:MGI:96795][more]
Lmna2.564e-2322.98lamin A [Source:MGI Symbol;Acc:MGI:96794][more]
Lmna3.570e-2322.98lamin A [Source:MGI Symbol;Acc:MGI:96794][more]
back to top
BLAST of Intermediate filament 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q01241|NF70_DORPE3.254e-9237.0970 kDa neurofilament protein OS=Doryteuthis pealei... [more]
sp|P90901|IFA1_CAEEL1.860e-8533.45Intermediate filament protein ifa-1 OS=Caenorhabdi... [more]
sp|P90900|IFA4_CAEEL3.430e-7832.70Intermediate filament protein ifa-4 OS=Caenorhabdi... [more]
sp|P23730|IFEA_ASCSU2.940e-7433.46Intermediate filament protein A (Fragment) OS=Asca... [more]
sp|Q01240|NF60_DORPE1.529e-7340.1660 kDa neurofilament protein OS=Doryteuthis pealei... [more]
back to top
BLAST of Intermediate filament 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1Z1R1730.000e+0100.00Intermediate filament 1 (Fragment) OS=Schmidtea me... [more]
Q86M450.000e+072.64Intermediate filament protein OS=Dugesia japonica ... [more]
A0A5J6BTN25.749e-13840.75Intermediate filament b-like protein 1 (Fragment) ... [more]
A0A267FSC28.118e-13843.37Uncharacterized protein OS=Macrostomum lignano OX=... [more]
W0GAA81.171e-13743.37Intermediate filament b-like protein OS=Macrostomu... [more]
back to top
BLAST of Intermediate filament 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmnb12.200e-2125.37lamin B1 [Source:NCBI gene;Acc:103034386][more]
lmnb16.103e-2025.00lamin B1 [Source:NCBI gene;Acc:103034386][more]
lmnl38.875e-2025.14lamin-L(III)-like [Source:NCBI gene;Acc:103047028][more]
lmnl39.385e-2025.28lamin-L(III)-like [Source:NCBI gene;Acc:103047028][more]
lmnl39.605e-2025.14lamin-L(III)-like [Source:NCBI gene;Acc:103047028][more]
back to top
BLAST of Intermediate filament 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lmnb27.050e-2326.44lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
lmnb22.035e-2022.00lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
lmnb22.506e-1824.38lamin B2 [Source:ZFIN;Acc:ZDB-GENE-990630-13][more]
ENSPMAT00000010102.18.969e-1222.31pep scaffold:Pmarinus_7.0:GL478364:74479:82531:1 g... [more]
desmb4.394e-1123.50desmin b [Source:ZFIN;Acc:ZDB-GENE-061027-102][more]
back to top
BLAST of Intermediate filament 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Intermediate filament 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372253.137e-2425.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Intermediate filament 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000011270.22.481e-2823.63lamin-A [Source:NCBI gene;Acc:101160250][more]
lmnb22.014e-2325.05lamin B2 [Source:NCBI gene;Acc:101158263][more]
lmna1.179e-2023.93lamin A/C [Source:NCBI gene;Acc:101162240][more]
lmnl34.753e-1921.42lamin-L(III) [Source:NCBI gene;Acc:101168604][more]
lmnl31.772e-1821.30lamin-L(III) [Source:NCBI gene;Acc:101168604][more]
back to top
BLAST of Intermediate filament 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046938.10.000e+099.83SMESG000046938.1[more]
SMESG000062826.14.831e-11638.33SMESG000062826.1[more]
SMESG000046289.12.385e-11236.60SMESG000046289.1[more]
SMESG000030598.11.099e-7733.33SMESG000030598.1[more]
SMESG000030598.16.034e-7732.96SMESG000030598.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031632 ID=SMED30031632|Name=Intermediate filament 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2008bp
GCAAACAAACGACTAACAAACATTAAACAAGATGCAGAAAACCGTGACAC
AAAATTCAACAATTATTCGTGAAAAATCTAACTCAACCGTTTCACTGAAA
ACGATGACGGAAAATAATCAAATTGAAAACAGTAAAGAAAAGACTGTATC
CCCAATATCGTCACAGCGAACTATTATTATCAACCGAACTAATAATCAAG
TTCCAAGTCAAATCATTCAAAGAAGTTTCAATTATGAAACCAGAGTAATT
CCATCAAAATCAGCAGCGTATGGAGATGTTGGTAACTATAAAAAAGAAAG
AGAAAAAGACAAAAGTGACATGAGAAATCTCAACGAAAAATTGGCAGGAT
ATATTGAACAGGTAAGATTTCTTGAAGCTCAAAATAAAAAGCAATCAGGA
GAATTGTCGAATCTCAAAGATAAATGGGGAAAAGATACAGAAGAAGTGAA
AATCAGATACAATATAGAAATGCAGAATCTGAAAAAATTATTAACTGAAG
CTGAAAAAAATCGCGGAAAAACCGAATTCGATTTAATTAATTTAGAACAT
GAATTACAAAAAGCCAAAGACGAATTAAATTTATCTCGAGATATGGAAAA
TGAATTGCTAAAAAAAATAGAAATTTGCGAAGAGAAATTAAGTGAAGAAG
AGGCCTTAATATCAATGTTGAAAAAAAGACTTGGAAAACTTGAAGAGCAT
AAAGCAAAAGATAAAATGGAAATTCTTAAGCTTCGTGATGAAATTCAAAA
TTTGCAAAGGGATTTAAACAATCAAACGATAAAATATTTGAATGTAGAAT
GTGAATTACAAGGGAAATTGGATGAAATGGAATTTTTAAAACAAATTCAT
CAAACGCAACTGAATGAATTGTCCGCTCTTGCCTATCGAGACACTACAAA
AGATAACAAAGATTTTTGGAAAGCGGAATTATCATTAGCTATGCAAGATA
TTCAATCTGATTACGACGACCGCATTCAAATGCTCCGATCTTCAATTGAG
TCTCAATACGGAGTAAGGATGCAGGATACAAAAACAGAAAATGCTAAATT
ATTAATGGAATTGAATTCAATAAAAGATGAAAATAAGAGAATAAAGAACG
AATGGGGCTCTACTAGATCTAGAATTCCTGATTTAGAAAATAAGATTATT
TCGTTGGAAAGAGCTTTAGTTGATTTACGGCACGAATCGGAGGAAAATAA
GAGAGATTATGAAATCGAGTTGAGCAGTAAAACAAAAGAATTAACAGAAG
CCGATTCAATAATTCATGAAACAGAGATACAACTGAAAACTTTATTGGAT
GATAAATTAAGTTTACAATTAGAAATTGCAGCTTATCGAAAATTACTTGA
AGGAGAAGAAACAAGATGGACTGATAAAAGCAGCACCGTCGTTGTTCATG
AAAACGGAACCTTGACTTCCAATTTGAAAACATTTGTGAATCAAGTTAAA
CAAGAAACTATTGTTCAAAAGAAAGTACAAGAAACCAATACAAGTGCTAC
TGGTGAAATTTCGGCTAAATCTACTTTTAATCGAACAACTAAAGGAAACG
TTTCGATTCTTGAATGTACAACTGATGGAAGATGTATTATTTTAGAAAAC
ATTGGGAAAAATAAAGAAGAAATCAGCGATATGTTGATTAACAGAGACAT
TGACCACGGACGACAGCTACTTAAATTTGTCATTCCAAAGAAAACTTTTA
TGGATGGAAACAAAACGATTAAAATTTGGGCTAAAGGATTTAAACCTGTT
GGAACAAATGACTTGGAAATACCAGAAACAAACTGGGGAATGGGATCCGA
CATTCATACTATTCTTTACAATGCGGTTGGCGAGGAAAGAGCAACTTATA
CTCAAAAGACTGTAACAACAAAAAAATAAATATTCAAATTCATACAATTA
ACAATAAAAGATTGTGATTTTTTATTGCCTAGTTGAAATTTATTTTGCTT
GGAATAATTATTTATTTAGACTATTTTTATGTTAAATTAACCTTGATTTA
TTTTAAAA
back to top

protein sequence of SMED30031632-orf-1

>SMED30031632-orf-1 ID=SMED30031632-orf-1|Name=SMED30031632-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=616bp
MQKTVTQNSTIIREKSNSTVSLKTMTENNQIENSKEKTVSPISSQRTIII
NRTNNQVPSQIIQRSFNYETRVIPSKSAAYGDVGNYKKEREKDKSDMRNL
NEKLAGYIEQVRFLEAQNKKQSGELSNLKDKWGKDTEEVKIRYNIEMQNL
KKLLTEAEKNRGKTEFDLINLEHELQKAKDELNLSRDMENELLKKIEICE
EKLSEEEALISMLKKRLGKLEEHKAKDKMEILKLRDEIQNLQRDLNNQTI
KYLNVECELQGKLDEMEFLKQIHQTQLNELSALAYRDTTKDNKDFWKAEL
SLAMQDIQSDYDDRIQMLRSSIESQYGVRMQDTKTENAKLLMELNSIKDE
NKRIKNEWGSTRSRIPDLENKIISLERALVDLRHESEENKRDYEIELSSK
TKELTEADSIIHETEIQLKTLLDDKLSLQLEIAAYRKLLEGEETRWTDKS
STVVVHENGTLTSNLKTFVNQVKQETIVQKKVQETNTSATGEISAKSTFN
RTTKGNVSILECTTDGRCIILENIGKNKEEISDMLINRDIDHGRQLLKFV
IPKKTFMDGNKTIKIWAKGFKPVGTNDLEIPETNWGMGSDIHTILYNAVG
EERATYTQKTVTTKK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0000470neuropil
PLANA:0002089reproductive organ
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
PLANA:0007528glial cell
Vocabulary: INTERPRO
TermDefinition
IPR039008IF_rod_dom
IPR042180IF_rod_dom_coil1B
IPR036415Lamin_tail_dom_sf
IPR001664IF
IPR001322Lamin_tail_dom
IPR018039IF_conserved
Vocabulary: molecular function
TermDefinition
GO:0005198structural molecule activity
Vocabulary: cellular component
TermDefinition
GO:0005882intermediate filament
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 368..406
NoneNo IPR availableCOILSCoilCoilcoord: 333..360
NoneNo IPR availableCOILSCoilCoilcoord: 143..261
NoneNo IPR availableCOILSCoilCoilcoord: 86..134
NoneNo IPR availableGENE3DG3DSA:1.20.5.170coord: 350..445
e-value: 2.2E-10
score: 43.0
NoneNo IPR availablePANTHERPTHR45721:SF12INTERMEDIATE FILAMENT PROTEIN IFA-1coord: 44..614
NoneNo IPR availablePANTHERPTHR45721FAMILY NOT NAMEDcoord: 44..614
NoneNo IPR availableSUPERFAMILYSSF64593Intermediate filament protein, coiled coil regioncoord: 377..448
NoneNo IPR availableSUPERFAMILYSSF64593Intermediate filament protein, coiled coil regioncoord: 95..129
IPR039008Intermediate filament, rod domainSMARTSM01391Filament_2coord: 95..448
e-value: 0.0014
score: -6.5
IPR039008Intermediate filament, rod domainPFAMPF00038Filamentcoord: 96..448
e-value: 9.2E-35
score: 120.7
IPR039008Intermediate filament, rod domainPROSITEPS51842IF_ROD_2coord: 96..449
score: 25.65
IPR042180Intermediate filament, rod domain, coil 1BGENE3DG3DSA:1.20.5.1160coord: 91..185
e-value: 3.7E-14
score: 55.0
IPR036415Lamin tail domain superfamilyGENE3DG3DSA:2.60.40.1260coord: 505..618
e-value: 2.6E-24
score: 87.4
IPR036415Lamin tail domain superfamilySUPERFAMILYSSF74853Lamin A/C globular tail domaincoord: 476..616
IPR018039Intermediate filament protein, conserved sitePROSITEPS00226IF_ROD_1coord: 435..443
IPR001322Lamin tail domainPROSITEPS51841LTDcoord: 498..613
score: 15.201