6-phosphogluconate dehydrogenase, decarboxylating

Overview
Name6-phosphogluconate dehydrogenase, decarboxylating
Smed IDSMED30031631
Length (bp)2007
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 6-phosphogluconate dehydrogenase, decarboxylating (SMED30031631) t-SNE clustered cells

Violin plots show distribution of expression levels for 6-phosphogluconate dehydrogenase, decarboxylating (SMED30031631) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 6-phosphogluconate dehydrogenase, decarboxylating (SMED30031631) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 6-phosphogluconate dehydrogenase, decarboxylating (SMED30031631) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031631

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 22

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30031631SMESG000005721.1 Contig1749GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30031631SMESG000005721.1 dd_Smed_v4_366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031631SMESG000005721.1 dd_Smed_v4_366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031631SMESG000005721.1 dd_Smed_v4_366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031631SMESG000005721.1 dd_Smed_v4_366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031631SMESG000005721.1 dd_Smed_v4_366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031631SMESG000005721.1 dd_Smed_v4_366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031631SMESG000005721.1 dd_Smed_v4_366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031631SMESG000005721.1 dd_Smed_v4_366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031631SMESG000005721.1 dd_Smed_v4_366_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031631SMESG000066407.1 SMESG000046471.1 SMESG000005721.1 Contig17739newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031631SMESG000066407.1 SMESG000046471.1 SMESG000005721.1 Contig17739uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031631SMESG000005721.1 Contig36978newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031631SMESG000005721.1 Contig36978uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031631SMESG000005721.1 Contig51170newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031631SMESG000005721.1 Contig51170uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031631 Contig51171newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30031631SMESG000005721.1 dd_Smed_v6_366_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031631SMESG000005721.1 dd_Smed_v6_366_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30031631SMESG000005721.1 dd_Smed_v6_366_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30031631SMESG000005721.1 dd_Smed_v6_366_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031631SMESG000005721.1 dd_Smed_v4_366_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Human
Match: PGD (phosphogluconate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8891])

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 328/483 (67.91%), Postives = 382/483 (79.09%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL+LNMN+HG+ VC FNRT+S V  FL NEAK TKV+GA SL+++V KL  PR+IILLVKAGQ VDDFI+KLVPLL  GDIIIDGGNSEY D+TRRC+DL AK ILFVGSGVSGGEEGAR GPSLMPGGN EAW HI+ IFQ IAAK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M  +E++ AF +WN +EL+SFLIEIT+ I KF+  DG +L+  I DSAGQKGTGKWTAI+AL++GVPVTLI E+VFAR LS+LK  R++ASK+        F G+K  FL  I+ ALYASKIISY QGFM++R AA EF W L+ G IALMWRGGCIIRS FL  IK+A+D+N  L  LL D+FF+  V  CQ SWR+ VS     GIP P F+ ALSFYDG R E LPA+LIQAQRD FGAH Y+LL  PG + HT+WTGHGG  ++S+Y A
Sbjct:    1 MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA 483          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Human
Match: PGD (phosphogluconate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8891])

HSP 1 Score: 365.155 bits (936), Expect = 3.768e-122
Identity = 189/277 (68.23%), Postives = 217/277 (78.34%), Query Frame = 3
Query:  105 DIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLI 935
            DI LIGLAVMGQNL+LNMN+HG+ VC FNRT+S V  FL NEAK TKV+GA SL+++V KL  PR+IILLVKAGQ VDDFI+KL                      RRC+DL AK ILFVGSGVSGGEEGAR GPSLMPGGN EAW HI+ IFQ IAAK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M  +E++ AF +WN +EL+SFLIEIT+ I KF+  DG +L+  I DSAGQKGTGKWTAI+AL++GVPVTLI
Sbjct:    2 DIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKL----------------------RRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLI 256          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Human
Match: PGD (phosphogluconate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8891])

HSP 1 Score: 310.457 bits (794), Expect = 8.601e-102
Identity = 156/204 (76.47%), Postives = 175/204 (85.78%), Query Frame = 3
Query:  132 MGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEIS 743
            MGQNL+LNMN+HG+ VC FNRT+S V  FL NEAK TKV+GA SL+++V KL  PR+IILLVKAGQ VDDFI+KLVPLL  GDIIIDGGNSEY D+TRRC+DL AK ILFVGSGVSGGEEGAR GPSLMPGGN EAW HI+ IFQ IAAK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M  +E++
Sbjct:    1 MGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMA 204          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Human
Match: PGD (phosphogluconate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8891])

HSP 1 Score: 276.559 bits (706), Expect = 2.151e-88
Identity = 130/196 (66.33%), Postives = 156/196 (79.59%), Query Frame = 3
Query:  612 VGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIR 1199
            VG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M  +E++ AF +WN +EL+SFLIEIT+ I KF+  DG +L+  I DSAGQKGTGKWTAI+AL++GVPVTLI E+VFAR LS+LK  R++ASK+        F G+K  FL  I+ ALYASKIISY QGFM++R AA EF W L+ G IALMWRGGCIIR
Sbjct:   29 VGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIR 224          

HSP 2 Score: 50.0618 bits (118), Expect = 4.107e-6
Identity = 22/29 (75.86%), Postives = 26/29 (89.66%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKV 179
            M +ADI LIGLAVMGQNL+LNMN+HG+ V
Sbjct:    1 MAQADIALIGLAVMGQNLILNMNDHGFVV 29          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Human
Match: PGD (phosphogluconate dehydrogenase [Source:HGNC Symbol;Acc:HGNC:8891])

HSP 1 Score: 234.572 bits (597), Expect = 3.666e-73
Identity = 122/160 (76.25%), Postives = 135/160 (84.38%), Query Frame = 3
Query:  132 MGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDW 611
            MGQNL+LNMN+HG+ VC FNRT+S V  FL NEAK TKV+GA SL+++V KL  PR+IILLVKAGQ VDDFI+KLVPLL  GDIIIDGGNSEY D+TRRC+DL AK ILFVGSGVSGGEEGAR GPSLMPGGN EAW HI+ IFQ IAAK   GEPCCDW
Sbjct:    1 MGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDW 160          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Celegans
Match: T25B9.9 (6-phosphogluconate dehydrogenase, decarboxylating [Source:UniProtKB/Swiss-Prot;Acc:Q17761])

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 296/485 (61.03%), Postives = 365/485 (75.26%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQ--TFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI +IGLAVMGQNL+LNMN+HG+ VC FNRT+  V  FL NEAK TK+IGA S+E++  KL  PR++++L+KAG PVD  I  +VP L  GDIIIDGGNSEY DS RR + LAAK I+FVG GVSGGEEGAR GPSLMPGGN +AW H++ IFQ IAAK+N GEPCCDWVG+ G+GHFVKMVHNGIEYGDMQLI EAYHL+   +++ +++++    +WN  ELESFLIEIT+ I K++   G  +V  I DSAGQKGTGKWT   AL++G+PVTLI E+VFAR LSALK  RV ASK+ P   +   T   +K  F+ QI  ALYASKI+SY QGFM++  A+++F W+L+ G IALMWRGGCIIRSRFL +I+ A+ KNK L  LL D+FF K + + Q SWR VV  A   GIP PAFS AL+FYDG  +E +PANL+QAQRD FGAH Y+LL  PGT+ HT+WTG GG   ++ Y A
Sbjct:    1 MAEADIAVIGLAVMGQNLILNMNDHGFTVCAFNRTVKLVDDFLANEAKGTKIIGAHSIEEMCKKLKRPRRVMMLIKAGTPVDMMIDAIVPHLEEGDIIIDGGNSEYTDSNRRSEQLAAKGIMFVGCGVSGGEEGARFGPSLMPGGNPKAWPHLKDIFQKIAAKSN-GEPCCDWVGNAGSGHFVKMVHNGIEYGDMQLIAEAYHLLSKAVELNHDQMAEVLDDWNKGELESFLIEITANILKYRDEQGEPIVPKIRDSAGQKGTGKWTCFAALEYGLPVTLIGEAVFARCLSALKDERVRASKQLPRPQVSPDTVVQDKRVFIKQISKALYASKIVSYAQGFMLLAEASKQFNWNLNFGAIALMWRGGCIIRSRFLGDIEHAFQKNKQLSNLLLDDFFTKAITEAQDSWRVVVCAAVRLGIPVPAFSSALAFYDGYTSEVVPANLLQAQRDYFGAHTYELLAKPGTWVHTNWTGTGGRVTSNAYNA 484          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Fly
Match: Pgd (gene:FBgn0004654 transcript:FBtr0070384)

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 315/481 (65.49%), Postives = 377/481 (78.38%), Query Frame = 3
Query:   99 KADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            +ADI LIGLAVMGQNL+LNM+E G+ VC +NRT++ V++FL NEAK+TKVIGA SLED+V KL SPRK++LLVKAG  VDDFIQ+LVPLL  GD+IIDGGNSEY D++RRC +LA   +LFVGSGVSGGEEGAR+GPSLMPGG+  AW  IQ IFQ I AKA+ GEPCC+WVG  GAGHFVKMVHNGIEYGDMQLICEAYH+M+ L  +  +++++ F  WN++EL+SFLIEIT  I K+K   G YL+E I D+AGQKGTGKWTAI AL +GVPVTLI E+VF+R LSALK  RV+AS        +    N T+FL+ IK+ALY +KI+SY QGFM+MR AA+E KW L+ G IALMWRGGCIIRS FL NIK+AY     L  LL D+FF+K + + Q SWR+VV+ A   GIP PA S ALSFYDG RT KLPANL+QAQRD FGAH Y+LL   G + HT+WTG GGN +ASTYQA
Sbjct:    4 QADIALIGLAVMGQNLILNMDEKGFVVCAYNRTVAKVKEFLANEAKDTKVIGADSLEDMVSKLKSPRKVMLLVKAGSAVDDFIQQLVPLLSAGDVIIDGGNSEYQDTSRRCDELAKLGLLFVGSGVSGGEEGARHGPSLMPGGHEAAWPLIQPIFQAICAKAD-GEPCCEWVGDGGAGHFVKMVHNGIEYGDMQLICEAYHIMQSL-GLSADQMADEFGKWNSAELDSFLIEITRDILKYKDGKG-YLLERIRDTAGQKGTGKWTAIAALQYGVPVTLIGEAVFSRCLSALKDERVQASSVLKGPSTKAQVANLTKFLDDIKHALYCAKIVSYAQGFMLMREAARENKWRLNYGGIALMWRGGCIIRSVFLGNIKDAYTSQPELSNLLLDDFFKKAIERGQDSWREVVANAFRWGIPVPALSTALSFYDGYRTAKLPANLLQAQRDYFGAHTYELLGQEGQFHHTNWTGTGGNVSASTYQA 481          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Fly
Match: Pgd (gene:FBgn0004654 transcript:FBtr0331410)

HSP 1 Score: 620.542 bits (1599), Expect = 0.000e+0
Identity = 315/481 (65.49%), Postives = 377/481 (78.38%), Query Frame = 3
Query:   99 KADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            +ADI LIGLAVMGQNL+LNM+E G+ VC +NRT++ V++FL NEAK+TKVIGA SLED+V KL SPRK++LLVKAG  VDDFIQ+LVPLL  GD+IIDGGNSEY D++RRC +LA   +LFVGSGVSGGEEGAR+GPSLMPGG+  AW  IQ IFQ I AKA+ GEPCC+WVG  GAGHFVKMVHNGIEYGDMQLICEAYH+M+ L  +  +++++ F  WN++EL+SFLIEIT  I K+K   G YL+E I D+AGQKGTGKWTAI AL +GVPVTLI E+VF+R LSALK  RV+AS        +    N T+FL+ IK+ALY +KI+SY QGFM+MR AA+E KW L+ G IALMWRGGCIIRS FL NIK+AY     L  LL D+FF+K + + Q SWR+VV+ A   GIP PA S ALSFYDG RT KLPANL+QAQRD FGAH Y+LL   G + HT+WTG GGN +ASTYQA
Sbjct:    4 QADIALIGLAVMGQNLILNMDEKGFVVCAYNRTVAKVKEFLANEAKDTKVIGADSLEDMVSKLKSPRKVMLLVKAGSAVDDFIQQLVPLLSAGDVIIDGGNSEYQDTSRRCDELAKLGLLFVGSGVSGGEEGARHGPSLMPGGHEAAWPLIQPIFQAICAKAD-GEPCCEWVGDGGAGHFVKMVHNGIEYGDMQLICEAYHIMQSL-GLSADQMADEFGKWNSAELDSFLIEITRDILKYKDGKG-YLLERIRDTAGQKGTGKWTAIAALQYGVPVTLIGEAVFSRCLSALKDERVQASSVLKGPSTKAQVANLTKFLDDIKHALYCAKIVSYAQGFMLMREAARENKWRLNYGGIALMWRGGCIIRSVFLGNIKDAYTSQPELSNLLLDDFFKKAIERGQDSWREVVANAFRWGIPVPALSTALSFYDGYRTAKLPANLLQAQRDYFGAHTYELLGQEGQFHHTNWTGTGGNVSASTYQA 481          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Zebrafish
Match: pgd (phosphogluconate dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-2807])

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 329/483 (68.12%), Postives = 381/483 (78.88%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL+LNMN+HG+ VC FNRT+S V  FL+NEAK TKVIGA SL+D+V KL  P +IILLVKAGQ VDDFI KLVPLL PGDIIIDGGNSEY D+TRRC+ L  K +LFVGSGVSGGE+GAR GPSLMPGG+ +AW H++ IFQ IAAK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M ++E++  F  WN +EL+SFLIEIT+ I KFK  DG  L+  I DSAGQKGTGKWTAI+AL++G PVTLI E+VFAR LS+LK  RV+ASK         FTGNK +FL  I+ ALYASKIISY QGFM++R AA EF W L+ G IALMWRGGCIIRS FL  IKEA+D+N  L  LL D FF K V  CQ SWR+VVS     GIP P+F+ ALSFYDG R E LPANL+QAQRD FGAH Y+LL +PGT+ HT+WTGHGG  ++S+Y A
Sbjct:   29 MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVHDFLNNEAKGTKVIGAESLKDMVSKLKKPCRIILLVKAGQAVDDFIDKLVPLLEPGDIIIDGGNSEYRDTTRRCKSLKEKNLLFVGSGVSGGEDGARYGPSLMPGGHKDAWPHLKDIFQSIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLCMNHDEMAQVFEQWNKTELDSFLIEITANILKFKDADGTNLLPKIRDSAGQKGTGKWTAISALEYGTPVTLIGEAVFARCLSSLKDERVQASKSLSGPQGVKFTGNKAQFLEDIRKALYASKIISYAQGFMLLRQAALEFGWSLNYGAIALMWRGGCIIRSVFLGKIKEAFDRNPELQSLLLDSFFSKAVQDCQDSWRRVVSTGVQQGIPMPSFTTALSFYDGYRHEMLPANLLQAQRDYFGAHTYELLSNPGTFIHTNWTGHGGKVSSSSYNA 511          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Zebrafish
Match: pgd (phosphogluconate dehydrogenase [Source:ZFIN;Acc:ZDB-GENE-040426-2807])

HSP 1 Score: 670.233 bits (1728), Expect = 0.000e+0
Identity = 329/483 (68.12%), Postives = 381/483 (78.88%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL+LNMN+HG+ VC FNRT+S V  FL+NEAK TKVIGA SL+D+V KL  P +IILLVKAGQ VDDFI KLVPLL PGDIIIDGGNSEY D+TRRC+ L  K +LFVGSGVSGGE+GAR GPSLMPGG+ +AW H++ IFQ IAAK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M ++E++  F  WN +EL+SFLIEIT+ I KFK  DG  L+  I DSAGQKGTGKWTAI+AL++G PVTLI E+VFAR LS+LK  RV+ASK         FTGNK +FL  I+ ALYASKIISY QGFM++R AA EF W L+ G IALMWRGGCIIRS FL  IKEA+D+N  L  LL D FF K V  CQ SWR+VVS     GIP P+F+ ALSFYDG R E LPANL+QAQRD FGAH Y+LL +PGT+ HT+WTGHGG  ++S+Y A
Sbjct:   29 MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVHDFLNNEAKGTKVIGAESLKDMVSKLKKPCRIILLVKAGQAVDDFIDKLVPLLEPGDIIIDGGNSEYRDTTRRCKSLKEKNLLFVGSGVSGGEDGARYGPSLMPGGHKDAWPHLKDIFQSIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLCMNHDEMAQVFEQWNKTELDSFLIEITANILKFKDADGTNLLPKIRDSAGQKGTGKWTAISALEYGTPVTLIGEAVFARCLSSLKDERVQASKSLSGPQGVKFTGNKAQFLEDIRKALYASKIISYAQGFMLLRQAALEFGWSLNYGAIALMWRGGCIIRSVFLGKIKEAFDRNPELQSLLLDSFFSKAVQDCQDSWRRVVSTGVQQGIPMPSFTTALSFYDGYRHEMLPANLLQAQRDYFGAHTYELLSNPGTFIHTNWTGHGGKVSSSSYNA 511          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Xenopus
Match: PGD (phosphogluconate dehydrogenase [Source:NCBI gene;Acc:100491794])

HSP 1 Score: 655.981 bits (1691), Expect = 0.000e+0
Identity = 322/470 (68.51%), Postives = 379/470 (80.64%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWT 1502
            M +ADI LIGLAVMGQNLVLNMN+HG+ VC +NRT+S V +FL NEAK TKVIGA SLE++V KL  PR+I++LVKAGQ VDDFI  LVP L PGDIIIDGGNSEY DSTRRC++L AK ILFVGSGVSGGE+GAR GPSLMPGG+ +AW HI+ IFQ IAAK  N EPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L +  +E++ AF  WN +EL+SFLIEIT+ I KFK  DG +L+E I D+AGQKGTGKWTAI+ALDFGVPVTLI E+VFAR LS+LKT R+EASK+     + TF G+K  FL  I+ ALYASKIISY QGF++ R AA+EF W+L+ G IA+MWRGGCIIRS FL  IKEA+D+N  L  LL D FF+ E+ +CQ+SWR+VVS    +GIP P F+ ALSFYDG R E LPANLIQAQRD FGAH Y+ L +PG + HT+WT
Sbjct:    1 MAQADIALIGLAVMGQNLVLNMNDHGFVVCAYNRTVSKVDQFLANEAKGTKVIGAHSLEEMVSKLKKPRRIMMLVKAGQAVDDFINNLVPYLEPGDIIIDGGNSEYRDSTRRCRELKAKNILFVGSGVSGGEDGARYGPSLMPGGDKQAWPHIKDIFQSIAAKVEN-EPCCDWVGEEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDILGIDQDEMAKAFEEWNKTELDSFLIEITADILKFKDTDGKHLLEKIQDTAGQKGTGKWTAISALDFGVPVTLIGEAVFARCLSSLKTERIEASKQLKGPKVNTFCGDKKAFLEDIRKALYASKIISYAQGFILFRQAAKEFGWNLNYGGIAMMWRGGCIIRSVFLGKIKEAFDRNPELQNLLLDNFFKSEMERCQESWRRVVSTGVQYGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYERLSNPGNFIHTNWT 469          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Xenopus
Match: PGD (phosphogluconate dehydrogenase [Source:NCBI gene;Acc:100491794])

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 322/469 (68.66%), Postives = 378/469 (80.60%), Query Frame = 3
Query:   96 EKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWT 1502
            E ADI LIGLAVMGQNLVLNMN+HG+ VC +NRT+S V +FL NEAK TKVIGA SLE++V KL  PR+I++LVKAGQ VDDFI  LVP L PGDIIIDGGNSEY DSTRRC++L AK ILFVGSGVSGGE+GAR GPSLMPGG+ +AW HI+ IFQ IAAK  N EPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L +  +E++ AF  WN +EL+SFLIEIT+ I KFK  DG +L+E I D+AGQKGTGKWTAI+ALDFGVPVTLI E+VFAR LS+LKT R+EASK+     + TF G+K  FL  I+ ALYASKIISY QGF++ R AA+EF W+L+ G IA+MWRGGCIIRS FL  IKEA+D+N  L  LL D FF+ E+ +CQ+SWR+VVS    +GIP P F+ ALSFYDG R E LPANLIQAQRD FGAH Y+ L +PG + HT+WT
Sbjct:    4 ELADIALIGLAVMGQNLVLNMNDHGFVVCAYNRTVSKVDQFLANEAKGTKVIGAHSLEEMVSKLKKPRRIMMLVKAGQAVDDFINNLVPYLEPGDIIIDGGNSEYRDSTRRCRELKAKNILFVGSGVSGGEDGARYGPSLMPGGDKQAWPHIKDIFQSIAAKVEN-EPCCDWVGEEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDILGIDQDEMAKAFEEWNKTELDSFLIEITADILKFKDTDGKHLLEKIQDTAGQKGTGKWTAISALDFGVPVTLIGEAVFARCLSSLKTERIEASKQLKGPKVNTFCGDKKAFLEDIRKALYASKIISYAQGFILFRQAAKEFGWNLNYGGIAMMWRGGCIIRSVFLGKIKEAFDRNPELQNLLLDNFFKSEMERCQESWRRVVSTGVQYGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYERLSNPGNFIHTNWT 471          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Xenopus
Match: PGD (phosphogluconate dehydrogenase [Source:NCBI gene;Acc:100491794])

HSP 1 Score: 648.277 bits (1671), Expect = 0.000e+0
Identity = 322/478 (67.36%), Postives = 379/478 (79.29%), Query Frame = 3
Query:   96 EKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKL---------VPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWT 1502
            +KADI LIGLAVMGQNLVLNMN+HG+ VC +NRT+S V +FL NEAK TKVIGA SLE++V KL  PR+I++LVKAGQ VDDFI  L         VP L PGDIIIDGGNSEY DSTRRC++L AK ILFVGSGVSGGE+GAR GPSLMPGG+ +AW HI+ IFQ IAAK  N EPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L +  +E++ AF  WN +EL+SFLIEIT+ I KFK  DG +L+E I D+AGQKGTGKWTAI+ALDFGVPVTLI E+VFAR LS+LKT R+EASK+     + TF G+K  FL  I+ ALYASKIISY QGF++ R AA+EF W+L+ G IA+MWRGGCIIRS FL  IKEA+D+N  L  LL D FF+ E+ +CQ+SWR+VVS    +GIP P F+ ALSFYDG R E LPANLIQAQRD FGAH Y+ L +PG + HT+WT
Sbjct:    5 KKADIALIGLAVMGQNLVLNMNDHGFVVCAYNRTVSKVDQFLANEAKGTKVIGAHSLEEMVSKLKKPRRIMMLVKAGQAVDDFINNLSPVAKIGFTVPYLEPGDIIIDGGNSEYRDSTRRCRELKAKNILFVGSGVSGGEDGARYGPSLMPGGDKQAWPHIKDIFQSIAAKVEN-EPCCDWVGEEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDILGIDQDEMAKAFEEWNKTELDSFLIEITADILKFKDTDGKHLLEKIQDTAGQKGTGKWTAISALDFGVPVTLIGEAVFARCLSSLKTERIEASKQLKGPKVNTFCGDKKAFLEDIRKALYASKIISYAQGFILFRQAAKEFGWNLNYGGIAMMWRGGCIIRSVFLGKIKEAFDRNPELQNLLLDNFFKSEMERCQESWRRVVSTGVQYGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYERLSNPGNFIHTNWT 481          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Xenopus
Match: PGD (phosphogluconate dehydrogenase [Source:NCBI gene;Acc:100491794])

HSP 1 Score: 645.195 bits (1663), Expect = 0.000e+0
Identity = 321/477 (67.30%), Postives = 378/477 (79.25%), Query Frame = 3
Query:   99 KADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKL---------VPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWT 1502
            +ADI LIGLAVMGQNLVLNMN+HG+ VC +NRT+S V +FL NEAK TKVIGA SLE++V KL  PR+I++LVKAGQ VDDFI  L         VP L PGDIIIDGGNSEY DSTRRC++L AK ILFVGSGVSGGE+GAR GPSLMPGG+ +AW HI+ IFQ IAAK  N EPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L +  +E++ AF  WN +EL+SFLIEIT+ I KFK  DG +L+E I D+AGQKGTGKWTAI+ALDFGVPVTLI E+VFAR LS+LKT R+EASK+     + TF G+K  FL  I+ ALYASKIISY QGF++ R AA+EF W+L+ G IA+MWRGGCIIRS FL  IKEA+D+N  L  LL D FF+ E+ +CQ+SWR+VVS    +GIP P F+ ALSFYDG R E LPANLIQAQRD FGAH Y+ L +PG + HT+WT
Sbjct:   64 QADIALIGLAVMGQNLVLNMNDHGFVVCAYNRTVSKVDQFLANEAKGTKVIGAHSLEEMVSKLKKPRRIMMLVKAGQAVDDFINNLSPVAKIGFTVPYLEPGDIIIDGGNSEYRDSTRRCRELKAKNILFVGSGVSGGEDGARYGPSLMPGGDKQAWPHIKDIFQSIAAKVEN-EPCCDWVGEEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDILGIDQDEMAKAFEEWNKTELDSFLIEITADILKFKDTDGKHLLEKIQDTAGQKGTGKWTAISALDFGVPVTLIGEAVFARCLSSLKTERIEASKQLKGPKVNTFCGDKKAFLEDIRKALYASKIISYAQGFILFRQAAKEFGWNLNYGGIAMMWRGGCIIRSVFLGKIKEAFDRNPELQNLLLDNFFKSEMERCQESWRRVVSTGVQYGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYERLSNPGNFIHTNWT 539          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Xenopus
Match: PGD (phosphogluconate dehydrogenase [Source:NCBI gene;Acc:100491794])

HSP 1 Score: 629.787 bits (1623), Expect = 0.000e+0
Identity = 312/466 (66.95%), Postives = 368/466 (78.97%), Query Frame = 3
Query:  132 MGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKL---------VPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWT 1502
            MGQNLVLNMN+HG+ VC +NRT+S V +FL NEAK TKVIGA SLE++V KL  PR+I++LVKAGQ VDDFI  L         VP L PGDIIIDGGNSEY DSTRRC++L AK ILFVGSGVSGGE+GAR GPSLMPGG+ +AW HI+ IFQ IAAK  N EPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L +  +E++ AF  WN +EL+SFLIEIT+ I KFK  DG +L+E I D+AGQKGTGKWTAI+ALDFGVPVTLI E+VFAR LS+LKT R+EASK+     + TF G+K  FL  I+ ALYASKIISY QGF++ R AA+EF W+L+ G IA+MWRGGCIIRS FL  IKEA+D+N  L  LL D FF+ E+ +CQ+SWR+VVS    +GIP P F+ ALSFYDG R E LPANLIQAQRD FGAH Y+ L +PG + HT+WT
Sbjct:    1 MGQNLVLNMNDHGFVVCAYNRTVSKVDQFLANEAKGTKVIGAHSLEEMVSKLKKPRRIMMLVKAGQAVDDFINNLSPVAKIGFTVPYLEPGDIIIDGGNSEYRDSTRRCRELKAKNILFVGSGVSGGEDGARYGPSLMPGGDKQAWPHIKDIFQSIAAKVEN-EPCCDWVGEEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDILGIDQDEMAKAFEEWNKTELDSFLIEITADILKFKDTDGKHLLEKIQDTAGQKGTGKWTAISALDFGVPVTLIGEAVFARCLSSLKTERIEASKQLKGPKVNTFCGDKKAFLEDIRKALYASKIISYAQGFILFRQAAKEFGWNLNYGGIAMMWRGGCIIRSVFLGKIKEAFDRNPELQNLLLDNFFKSEMERCQESWRRVVSTGVQYGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYERLSNPGNFIHTNWT 465          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Mouse
Match: Pgd (phosphogluconate dehydrogenase [Source:MGI Symbol;Acc:MGI:97553])

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 326/483 (67.49%), Postives = 383/483 (79.30%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL+LNMN+HG+ VC FNRT+S V  FL NEAK TKV+GA SL+D+V KL  PR++ILLVKAGQ VDDFI+KLVPLL  GDIIIDGGNSEY D+TRRC+DL AK ILFVGSGVSGGEEGAR GPSLMPGGN EAW HI+ IFQ IAAK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M +EE++ AF  WN +EL+SFLIEIT+ I K++  DG  L+  I DSAGQKGTGKWTAI+AL++G+PVTLI E+VFAR LS+LK  RV+AS++     +    G+K  FL  I+ ALYASKIISY QGFM++R AA EF W L+ G IALMWRGGCIIRS FL  IK+A+++N  L  LL D+FF+  V  CQ SWR+V+S     GIP P F+ ALSFYDG R E LPANLIQAQRD FGAH Y+LL  PG + HT+WTGHGG+ ++S+Y A
Sbjct:    1 MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKDMVSKLKKPRRVILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKAIFQAIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMRHEEMAQAFEEWNKTELDSFLIEITANILKYRDTDGKELLPKIRDSAGQKGTGKWTAISALEYGMPVTLIGEAVFARCLSSLKEERVQASQKLKGPKVVQLEGSKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFERNPELQNLLLDDFFKSAVDNCQDSWRRVISTGVQAGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLTKPGEFIHTNWTGHGGSVSSSSYNA 483          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. UniProt/SwissProt
Match: sp|P52209|6PGD_HUMAN (6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD PE=1 SV=3)

HSP 1 Score: 666.766 bits (1719), Expect = 0.000e+0
Identity = 328/483 (67.91%), Postives = 382/483 (79.09%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL+LNMN+HG+ VC FNRT+S V  FL NEAK TKV+GA SL+++V KL  PR+IILLVKAGQ VDDFI+KLVPLL  GDIIIDGGNSEY D+TRRC+DL AK ILFVGSGVSGGEEGAR GPSLMPGGN EAW HI+ IFQ IAAK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M  +E++ AF +WN +EL+SFLIEIT+ I KF+  DG +L+  I DSAGQKGTGKWTAI+AL++GVPVTLI E+VFAR LS+LK  R++ASK+        F G+K  FL  I+ ALYASKIISY QGFM++R AA EF W L+ G IALMWRGGCIIRS FL  IK+A+D+N  L  LL D+FF+  V  CQ SWR+ VS     GIP P F+ ALSFYDG R E LPA+LIQAQRD FGAH Y+LL  PG + HT+WTGHGG  ++S+Y A
Sbjct:    1 MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQGIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMAQDEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQKFQFDGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKSAVENCQDSWRRAVSTGVQAGIPMPCFTTALSFYDGYRHEMLPASLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGTVSSSSYNA 483          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. UniProt/SwissProt
Match: sp|P85968|6PGD_RAT (6-phosphogluconate dehydrogenase, decarboxylating OS=Rattus norvegicus OX=10116 GN=Pgd PE=1 SV=1)

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 327/483 (67.70%), Postives = 383/483 (79.30%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL+LNMN+HG+ VC FNRT+S V  FL  EAK TKVIGA SL+D+V KL  PR++ILLVKAGQ VDDFI+KLVPLL  GDIIIDGGNSEY D+TRRCQDL AK ILFVGSGVSGGEEGAR GPSLMPGGN EAW HI+ IFQ IAAK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M +EE++ AF +WN +EL+SFLIEIT+ I KF+  DG  L+  I DSAGQKGTGKWTAI+AL++G+PVTLI E+VFAR LS+LK  RV+AS++     +    G+K  FL  ++ ALYASKIISY QGFM++R AA EF W L+ G IALMWRGGCIIRS FL  IK+A+++N  L  LL D+FF+  V  CQ SWR+V+S     GIP P F+ ALSFYDG R E LPANLIQAQRD FGAH Y+LL  PG + HT+WTGHGG+ ++S+Y A
Sbjct:    1 MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLAKEAKGTKVIGAKSLKDMVSKLKKPRRVILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCQDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKTIFQAIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMRHEEMAQAFEDWNKTELDSFLIEITANILKFQDTDGKELLPKIRDSAGQKGTGKWTAISALEYGMPVTLIGEAVFARCLSSLKEERVQASRKLKGPKMVQLEGSKQAFLEDVRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFERNPELQNLLLDDFFKSAVDDCQDSWRRVISTGVQAGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLSKPGEFIHTNWTGHGGSVSSSSYNA 483          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. UniProt/SwissProt
Match: sp|Q9DCD0|6PGD_MOUSE (6-phosphogluconate dehydrogenase, decarboxylating OS=Mus musculus OX=10090 GN=Pgd PE=1 SV=3)

HSP 1 Score: 649.047 bits (1673), Expect = 0.000e+0
Identity = 326/483 (67.49%), Postives = 383/483 (79.30%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL+LNMN+HG+ VC FNRT+S V  FL NEAK TKV+GA SL+D+V KL  PR++ILLVKAGQ VDDFI+KLVPLL  GDIIIDGGNSEY D+TRRC+DL AK ILFVGSGVSGGEEGAR GPSLMPGGN EAW HI+ IFQ IAAK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M +EE++ AF  WN +EL+SFLIEIT+ I K++  DG  L+  I DSAGQKGTGKWTAI+AL++G+PVTLI E+VFAR LS+LK  RV+AS++     +    G+K  FL  I+ ALYASKIISY QGFM++R AA EF W L+ G IALMWRGGCIIRS FL  IK+A+++N  L  LL D+FF+  V  CQ SWR+V+S     GIP P F+ ALSFYDG R E LPANLIQAQRD FGAH Y+LL  PG + HT+WTGHGG+ ++S+Y A
Sbjct:    1 MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVVGAQSLKDMVSKLKKPRRVILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGSGVSGGEEGARYGPSLMPGGNKEAWPHIKAIFQAIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMRHEEMAQAFEEWNKTELDSFLIEITANILKYRDTDGKELLPKIRDSAGQKGTGKWTAISALEYGMPVTLIGEAVFARCLSSLKEERVQASQKLKGPKVVQLEGSKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFERNPELQNLLLDDFFKSAVDNCQDSWRRVISTGVQAGIPMPCFTTALSFYDGYRHEMLPANLIQAQRDYFGAHTYELLTKPGEFIHTNWTGHGGSVSSSSYNA 483          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. UniProt/SwissProt
Match: sp|P41570|6PGD_CERCA (6-phosphogluconate dehydrogenase, decarboxylating OS=Ceratitis capitata OX=7213 GN=Pgd PE=2 SV=1)

HSP 1 Score: 630.172 bits (1624), Expect = 0.000e+0
Identity = 321/481 (66.74%), Postives = 377/481 (78.38%), Query Frame = 3
Query:   99 KADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            KADI LIGLAVMGQNLVLNMN+ G+ VC +NRT+  V +FL NEAK T VIGATSL+D+V+KL  PRKI+LLVKAG  VDDFIQ+LVPLL PGD+IIDGGNSEY D+ RRC +L AKKIL+VGSGVSGGEEGAR+GPSLMPGG+ EAW  IQ IFQ I AKA+  EPCC+WVG  GAGHFVKMVHNGIEYGDMQLICEAY +M+  L +   E++  F  WN+ EL+SFLIEIT  I  ++ +D  YL+E I D+AGQKGTGKWTAI+AL +GVPVTLI E+VF+R LSALK  RV ASK+    ++     +  +FLN IK+ALY SKI+SY QGFM+MR AA+E  W+L+ G IALMWRGGCIIRS FL NIK+AY +N  L  LL D+FF+K +   Q SWRQVV+ A L GIP PA S ALSFYDG RTEKLPANL+QAQRD FGAH Y+LL   G + HT+WTG GGN +ASTYQA
Sbjct:    4 KADIALIGLAVMGQNLVLNMNDKGFVVCAYNRTVEKVNQFLKNEAKGTNVIGATSLQDMVNKLKLPRKIMLLVKAGSAVDDFIQQLVPLLSPGDVIIDGGNSEYQDTARRCDELRAKKILYVGSGVSGGEEGARHGPSLMPGGHPEAWPLIQPIFQSICAKADK-EPCCEWVGEGGAGHFVKMVHNGIEYGDMQLICEAYQIMK-ALGLSQAEMATEFEKWNSEELDSFLIEITRDILNYQ-DDRGYLLERIRDTAGQKGTGKWTAISALQYGVPVTLIGEAVFSRCLSALKDERVAASKQLKGPNVNAKVEDLPKFLNHIKHALYCSKIVSYAQGFMLMREAAKENNWNLNYGGIALMWRGGCIIRSVFLGNIKDAYTRNPQLSNLLLDDFFKKAIEVGQNSWRQVVANAFLWGIPVPALSTALSFYDGYRTEKLPANLLQAQRDYFGAHTYELLGAEGKFVHTNWTGTGGNVSASTYQA 481          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. UniProt/SwissProt
Match: sp|P00349|6PGD_SHEEP (6-phosphogluconate dehydrogenase, decarboxylating OS=Ovis aries OX=9940 GN=PGD PE=1 SV=4)

HSP 1 Score: 623.624 bits (1607), Expect = 0.000e+0
Identity = 325/483 (67.29%), Postives = 381/483 (78.88%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL+LNMN+HG+ VC FNRT+S V  FL NEAK TKV+GA SLE++V KL  PR+IILLVKAGQ VD+FI+KLVPLL  GDIIIDGGNSEY D+ RRC+DL  K ILFVGSGVSGGE+GAR GPSLMPGGN EAW HI+ IFQ IAAK   GEPCCDWVG DGAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L +G++E++ AF  WN +EL+SFLIEIT+ I KF+  DG +L+  I DSAGQKGTGKWTAI+AL++GVPVTLI E+VFAR LS+LK  R++ASK+        F G+K  FL  I+ ALYASKIISY QGFM++R AA EF W L+ G IALMWRGGCIIRS FL  IK+A+D+N  L  LL D+FF+  V  CQ SWR+ +S     GIP P F+ ALSFYDG R   LPANLIQAQRD FGAH Y+LL  PG + HT+WTGHGG+ ++S+Y A
Sbjct:    1 MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVLGAHSLEEMVSKLKKPRRIILLVKAGQAVDNFIEKLVPLLDIGDIIIDGGNSEYRDTMRRCRDLKDKGILFVGSGVSGGEDGARYGPSLMPGGNKEAWPHIKAIFQGIAAKVGTGEPCCDWVGDDGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGLGHKEMAKAFEEWNKTELDSFLIEITASILKFQDADGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERIQASKKLKGPQNIPFEGDKKSFLEDIRKALYASKIISYAQGFMLLRQAATEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPGLQNLLLDDFFKSAVENCQDSWRRAISTGVQAGIPMPCFTTALSFYDGYRHAMLPANLIQAQRDYFGAHTYELLAKPGQFIHTNWTGHGGSVSSSSYNA 483          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. TrEMBL
Match: A0A3B4D0B3 (6-phosphogluconate dehydrogenase, decarboxylating OS=Pygocentrus nattereri OX=42514 PE=3 SV=1)

HSP 1 Score: 676.011 bits (1743), Expect = 0.000e+0
Identity = 332/483 (68.74%), Postives = 385/483 (79.71%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL+LNMN+HG+ VC +NRT+S V  FL NEAK TKVIGA SLED+V KL +PR+IILLVKAGQ VDDFI KLVPLL PGDIIIDGGNSEY D+TRRCQ L AK +LFVGSGVSGGEEGAR GPSLMPGG+ EAW HI+ IFQ IAAK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M ++E++ AF  WN +EL+SFLIEIT+ I KF+  DG +L+  I DSAGQKGTGKWTAI+AL++GVPVTLI E+VFAR LS+LK  RV ASK         FTG+KT+FL  I+ ALYASKIISY QGFM++R AA+EF W L+ G IALMWRGGCIIRS FL  IKEA+D++  L  LL D FF   V  CQ SWR+VVS     GIP P+F+ ALSFYDG R   LPANL+QAQRD FGAH Y+LL +PG + HT+WTGHGGN ++++Y A
Sbjct:   41 MAQADIALIGLAVMGQNLILNMNDHGFVVCAYNRTVSKVHDFLQNEAKGTKVIGAESLEDMVSKLKTPRRIILLVKAGQAVDDFIDKLVPLLQPGDIIIDGGNSEYRDTTRRCQSLKAKGLLFVGSGVSGGEEGARYGPSLMPGGHKEAWPHIKDIFQSIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMDHDEMAQAFDRWNKTELDSFLIEITANILKFRDTDGTHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKEERVLASKSLTGPQGAKFTGDKTQFLEDIRKALYASKIISYAQGFMLLRQAAKEFGWSLNYGGIALMWRGGCIIRSVFLGKIKEAFDRDSELQNLLLDNFFSNAVQDCQDSWRRVVSTGVQLGIPMPSFTTALSFYDGYRHAMLPANLLQAQRDYFGAHTYELLSNPGHFIHTNWTGHGGNVSSTSYNA 523          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. TrEMBL
Match: Q5ZIZ0 (6-phosphogluconate dehydrogenase, decarboxylating OS=Gallus gallus OX=9031 GN=PGD PE=2 SV=1)

HSP 1 Score: 675.626 bits (1742), Expect = 0.000e+0
Identity = 332/481 (69.02%), Postives = 383/481 (79.63%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTY 1535
            M +ADI LIGLAVMGQNL+LNMN+HG+ VC FNRT+S V  FL NEAK TKVIGA SLE++V KL  PR+IILLVKAG  VDDFI KLVPLL  GDIIIDGGNSEY D+TRRC++L  K +LFVGSGVSGGEEGAR GPSLMPGG+ EAW HI+ IFQ IAAK  +GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D++ M ++E+S  F  WNN+EL+SFLIEIT+ I KFK  DG YL+  I DSAGQKGTGKWTAI+AL++GVPVTLI E+VFAR LS+LK  RV+ASK      +  F+GNK  FL  I+ ALYASKIISY QGFM++R AA+EF W L+ G IALMWRGGCIIRS FL  IK+A+D+N  L  LL D+FF+  V KCQ SWR V+S    HGIP P F+ ALSFYDG R E LPANLIQAQRD FGAH Y+LL  PG + HT+WTGHGGN ++S Y
Sbjct:    1 MAEADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVDDFLANEAKGTKVIGAHSLEEMVSKLKKPRRIILLVKAGSAVDDFINKLVPLLETGDIIIDGGNSEYRDTTRRCKELLQKGLLFVGSGVSGGEEGARYGPSLMPGGSKEAWPHIKTIFQSIAAKVGSGEPCCDWVGEEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVVGMDHDEMSQVFEEWNNTELDSFLIEITANILKFKDKDGKYLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKDERVQASKLLNGPKLTQFSGNKKAFLEDIRKALYASKIISYAQGFMLLRQAAKEFGWTLNYGGIALMWRGGCIIRSVFLGKIKDAFDRNPELQNLLLDDFFKTAVEKCQDSWRHVISTGVQHGIPMPCFTTALSFYDGYRHEVLPANLIQAQRDYFGAHTYELLSKPGVFIHTNWTGHGGNVSSSAY 481          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. TrEMBL
Match: A0A3Q3RAY8 (6-phosphogluconate dehydrogenase, decarboxylating OS=Monopterus albus OX=43700 PE=3 SV=1)

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 330/483 (68.32%), Postives = 385/483 (79.71%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL++NMN+HG+ VC +NRT+S V  FL NEAK +KVIGA SLED+V KL  PR+IILLVKAGQ VDDFI KLVPLL  GDIIIDGGNSEY D+TRRC+ L  K +LFVGSGVSGGEEGAR GPSLMPGG+ EAW HI+ IFQ IAAK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M ++E++ AF NWN +EL+SFLIEIT+ I KF+ +DG +L+  I DSAGQKGTGKWTAI+AL++G PVTLI E+VFAR LS+LK  RVEAS+         F+G+K  FL  I+ ALYASKIISY QGFM++R AA+EF W L+ G IALMWRGGCIIRS FL  IKEA+D+N  L  LL D FF   V  CQ+SWR+ VSV   HGIP P+F+ ALSFYDG R EKLPANL+QAQRD FGAH Y+LL  PG + HT+WTGHGGN ++S+Y A
Sbjct:    1 MVEADIALIGLAVMGQNLIMNMNDHGFVVCAYNRTVSKVHDFLKNEAKGSKVIGAESLEDMVSKLKKPRRIILLVKAGQAVDDFIDKLVPLLEAGDIIIDGGNSEYRDTTRRCKSLKEKGLLFVGSGVSGGEEGARQGPSLMPGGHKEAWPHIKGIFQSIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMDHDEMAQAFDNWNRTELDSFLIEITANILKFRDSDGKHLLPKIRDSAGQKGTGKWTAISALEYGTPVTLIGEAVFARCLSSLKDERVEASRSLSGPQGVKFSGDKAAFLEDIRKALYASKIISYAQGFMLLRQAAKEFGWSLNYGGIALMWRGGCIIRSVFLGKIKEAFDRNAKLQNLLLDSFFSSAVQDCQESWRRTVSVGVQHGIPMPSFTTALSFYDGYRHEKLPANLLQAQRDYFGAHTYELLSCPGQFIHTNWTGHGGNVSSSSYNA 483          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. TrEMBL
Match: A0A3Q3BA01 (6-phosphogluconate dehydrogenase, decarboxylating OS=Kryptolebias marmoratus OX=37003 PE=3 SV=1)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 329/483 (68.12%), Postives = 385/483 (79.71%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL++NMN+HG+ VC +NRT+S V  FL NEAK +KVIGA SLED+V KL  PR+IILLVKAG  VDDFI KLVPLL PGDIIIDGGNSEY D+TRRC+ L  K +LFVGSGVSGGEEGAR GPSLMPGG+ EAW HI+ IFQ IAAK   GEPCCDWVG++GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M ++E++ AF +WN +EL+SFLIEIT+ I K++  DG +L+  I DSAGQKGTGKWTAI+AL++G PVTLI E+VFAR LS+LK  RV+AS+         F+GNK  FL  I+ ALYASKIISY QGFM+MR AA+EF W L+ G IALMWRGGCIIRS FL  IKEA+D+N +L  LL D FF K V  CQ+SWR+ V V   HGIP P F+ ALSFYDG R E LPANL+QAQRD FGAH Y+LL +PG Y HT+WTGHGGN ++S+Y A
Sbjct:    1 MAEADIALIGLAVMGQNLIMNMNDHGFVVCAYNRTVSKVHDFLQNEAKGSKVIGAESLEDMVSKLKMPRRIILLVKAGHAVDDFIDKLVPLLKPGDIIIDGGNSEYRDTTRRCKTLKEKNLLFVGSGVSGGEEGARYGPSLMPGGHEEAWPHIKDIFQSIAAKVGTGEPCCDWVGNEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMDHDEMAKAFDSWNKTELDSFLIEITANILKYREADGTHLLPKIRDSAGQKGTGKWTAISALEYGTPVTLIGEAVFARCLSSLKDERVQASRSLSGPQGVKFSGNKAAFLEDIRKALYASKIISYAQGFMLMRQAAKEFGWSLNYGAIALMWRGGCIIRSVFLGKIKEAFDRNSDLQNLLLDSFFSKAVQDCQESWRRTVGVGVQHGIPMPCFTIALSFYDGYRHEMLPANLLQAQRDYFGAHTYELLSNPGHYVHTNWTGHGGNVSSSSYNA 483          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. TrEMBL
Match: Q6TNR8 (6-phosphogluconate dehydrogenase, decarboxylating OS=Danio rerio OX=7955 GN=pgd PE=2 SV=1)

HSP 1 Score: 674.47 bits (1739), Expect = 0.000e+0
Identity = 331/483 (68.53%), Postives = 382/483 (79.09%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL+LNMN+HG+ VC FNRT+S V  FL+NEAK TKVIGA SLED+V KL  PR+IILLVKAGQ VDDFI KLVPLL PGDIIIDGGNSEY D+TRRC+ L  K +LFVGSGVSGGE+GAR GPSLMPGG+ +AW H++ IFQ IAAK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M ++E++  F  WN +EL+SFLIEIT+ I KFK  DG  L+  I DSAGQKGTGKWTAI+AL++G PVTLI E+VFAR LS+LK  RV+ASK         FTGNK +FL  I+ ALYASKIISY QGFM++R AA EF W L+ G IALMWRGGCIIRS FL  IKEA+D+N  L  LL D FF K V  CQ SWR+VVS     GIP P+F+ ALSFYDG R E LPANL+QAQRD FGAH Y+LL +PGT+ HT+WTGHGG  ++S+Y A
Sbjct:    1 MAQADIALIGLAVMGQNLILNMNDHGFVVCAFNRTVSKVHDFLNNEAKGTKVIGAESLEDMVSKLKKPRRIILLVKAGQAVDDFIDKLVPLLEPGDIIIDGGNSEYRDTTRRCKSLKEKNLLFVGSGVSGGEDGARYGPSLMPGGHKDAWPHLKDIFQSIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLCMNHDEMAQVFEQWNKTELDSFLIEITANILKFKDADGTNLLPKIRDSAGQKGTGKWTAISALEYGTPVTLIGEAVFARCLSSLKDERVQASKSLSGPQGVKFTGNKEQFLEDIRKALYASKIISYAQGFMLLRQAALEFGWSLNYGAIALMWRGGCIIRSVFLGKIKEAFDRNPELQSLLLDSFFSKAVQDCQDSWRRVVSTGVQQGIPMPSFTTALSFYDGYRHEMLPANLLQAQRDYFGAHTYELLSNPGTFIHTNWTGHGGKVSSSSYNA 483          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Cavefish
Match: pgd (phosphogluconate dehydrogenase [Source:NCBI gene;Acc:103026797])

HSP 1 Score: 673.7 bits (1737), Expect = 0.000e+0
Identity = 332/483 (68.74%), Postives = 386/483 (79.92%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL+LNMN+HG+ VC +NRT+S V  FL NEAK TKVIGA SLED+V KL +PR+I+LLVKAGQ VDDFI KLVPLL PGDIIIDGGNSEY D+TRRCQ L AK +LFVGSGVSGGEEGAR GPSLMPGG+ EAW HI+ IFQ IAAK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M ++E++ AF  WN +EL+SFLIEIT+ I KFK +DG +L+  I DSAGQKGTGKWTAI+AL++GVPVTLI E+VFAR LS+LK  RV ASK         FTG+K +FL  I+ ALYASKIISY QGFM++R AA EF W L+ G IALMWRGGCIIRS FL  IKEA+D++ NL  LL D+FF   V  CQ SWR+VVS     GIP P+F+ ALSFYDG R   LPANL+QAQRD FGAH Y+LL +PG + HT+WTGHGGN ++++Y A
Sbjct:    1 MAQADIALIGLAVMGQNLILNMNDHGFVVCAYNRTVSKVHDFLKNEAKGTKVIGAESLEDMVSKLKTPRRIVLLVKAGQAVDDFIDKLVPLLQPGDIIIDGGNSEYRDTTRRCQSLKAKGLLFVGSGVSGGEEGARYGPSLMPGGHKEAWPHIKDIFQSIAAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMDHDEMAQAFDQWNKTELDSFLIEITANILKFKDSDGKHLLPKIRDSAGQKGTGKWTAISALEYGVPVTLIGEAVFARCLSSLKEERVLASKSLTGPQGAKFTGDKAKFLEDIRKALYASKIISYAQGFMLLRQAANEFGWSLNYGGIALMWRGGCIIRSVFLGKIKEAFDRDSNLQNLLLDDFFSNAVQDCQASWRRVVSKGVELGIPMPSFTTALSFYDGYRHAMLPANLLQAQRDYFGAHTYELLSNPGQFIHTNWTGHGGNVSSTSYNA 483          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Yeast
Match: GND1 (6-phosphogluconate dehydrogenase (decarboxylating); catalyzes an NADPH regenerating reaction in the pentose phosphate pathway; required for growth on D-glucono-delta-lactone and adaptation to oxidative stress; GND1 has a paralog, GND2, that arose from the whole genome duplication [Source:SGD;Acc:S000001226])

HSP 1 Score: 585.489 bits (1508), Expect = 0.000e+0
Identity = 298/488 (61.07%), Postives = 364/488 (74.59%), Query Frame = 3
Query:  102 ADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDI-QTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYE-------HTDWTGHGGNAAASTYQA 1541
            AD GLIGLAVMGQNL+LN  +HG+ VC +NRT S V  FL NEAK   +IGATS+ED + KL  PRK++LLVKAG PVD  I ++VPLL  GDIIIDGGNS + DS RR ++L  K ILFVGSGVSGGEEGAR GPSLMPGG+ EAW HI+ IFQ I+AK++ GEPCC+WVG  GAGH+VKMVHNGIEYGDMQLICEAY +M+ L    ++EIS+ FA WNN  L+SFL+EIT  I KF   DG  LVE I D+AGQKGTGKWTAI ALD G+PVTLI E+VFAR LSALK  R+ ASK  P  ++ +    ++ +F++ ++ ALYASKIISY QGFM++R AA  + W L+   IALMWRGGCIIRS FL  I +AY +  +L  LLF++FF   V K Q  WR+ +++A  +GIPTPAFS ALSFYDG R+E+LPANL+QAQRD FGAH +++L    +         H +WTGHGGN ++STYQA
Sbjct:    3 ADFGLIGLAVMGQNLILNAADHGFTVCAYNRTQSKVDHFLANEAKGKSIIGATSIEDFISKLKRPRKVMLLVKAGAPVDALINQIVPLLEKGDIIIDGGNSHFPDSNRRYEELKKKGILFVGSGVSGGEEGARYGPSLMPGGSEEAWPHIKNIFQSISAKSD-GEPCCEWVGPAGAGHYVKMVHNGIEYGDMQLICEAYDIMKRLGGFTDKEISDVFAKWNNGVLDSFLVEITRDILKFDDVDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSALKNERIRASKVLPGPEVPKDAVKDREQFVDDLEQALYASKIISYAQGFMLIREAAATYGWKLNNPAIALMWRGGCIIRSVFLGQITKAYREEPDLENLLFNKFFADAVTKAQSGWRKSIALATTYGIPTPAFSTALSFYDGYRSERLPANLLQAQRDYFGAHTFRVLPECASDNLPVDKDIHINWTGHGGNVSSSTYQA 489          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Yeast
Match: GND2 (6-phosphogluconate dehydrogenase (decarboxylating); catalyzes an NADPH regenerating reaction in the pentose phosphate pathway; required for growth on D-glucono-delta-lactone; GND2 has a paralog, GND1, that arose from the whole genome duplication [Source:SGD;Acc:S000003488])

HSP 1 Score: 575.089 bits (1481), Expect = 0.000e+0
Identity = 299/497 (60.16%), Postives = 365/497 (73.44%), Query Frame = 3
Query:   93 MEKA--DIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASK-----RFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYE-------HTDWTGHGGNAAASTYQA 1541
            M KA  D+GL+GLAVMGQNL+LN  +HG+ V  +NRT S V +FL NEAK   +IGATS+EDLV KL  PRKI+LL+KAG PVD  I++LVP L  GDIIIDGGNS + D+ RR ++L  + ILFVGSGVSGGE+GAR GPSLMPGG+AEAW HI+ IFQ IAAK+ NGEPCC+WVG  G+GH+VKMVHNGIEYGDMQLICEAY +M+ +    ++EIS  F  WN   L+SFLIEIT  I KF   DG  LVE I D+AGQKGTGKWTAI ALD G+PVTLI E+VFAR LSA+K  R  ASK       P D I     ++ +F+  ++ ALYASKIISY QGFM++R AA+ + W L+   IALMWRGGCIIRS FL  I +AY  + +L  LLF+EFF   V K Q  WR+ +++AA +GIPTPAFS AL+FYDG R+E+LPANL+QAQRD FGAH +++L    +         H +WTGHGGN ++STYQA
Sbjct:    1 MSKAVGDLGLVGLAVMGQNLILNAADHGFTVVAYNRTQSKVDRFLANEAKGKSIIGATSIEDLVAKLKKPRKIMLLIKAGAPVDTLIKELVPHLDKGDIIIDGGNSHFPDTNRRYEELTKQGILFVGSGVSGGEDGARFGPSLMPGGSAEAWPHIKNIFQSIAAKS-NGEPCCEWVGPAGSGHYVKMVHNGIEYGDMQLICEAYDIMKRIGRFTDKEISEVFDKWNTGVLDSFLIEITRDILKFDDVDGKPLVEKIMDTAGQKGTGKWTAINALDLGMPVTLIGEAVFARCLSAIKDERKRASKLLAGPTVPKDAIH----DREQFVYDLEQALYASKIISYAQGFMLIREAARSYGWKLNNPAIALMWRGGCIIRSVFLAEITKAYRDDPDLENLLFNEFFASAVTKAQSGWRRTIALAATYGIPTPAFSTALAFYDGYRSERLPANLLQAQRDYFGAHTFRILPECASAHLPVDKDIHINWTGHGGNISSSTYQA 492          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Yeast
Match: YHR182C-A_mRNA (Dubious open reading frame; unlikely to encode a functional protein, based on available experimental and comparative sequence data; almost completely overlaps ORF GND1/YHR183W [Source:SGD;Acc:S000028784])

HSP 1 Score: 48.9062 bits (115), Expect = 2.349e-7
Identity = 47/149 (31.54%), Postives = 76/149 (51.01%), Query Frame = -2
Query:  102 MFPSFXXXXXXXXXXXXXXXXXXXXXXANE*NFFCCKILTPSC*IVIF*IPPIDNYISRM*EWNQFLNKIINRLTSFY*KNNFSGGYQFIHKILQRRCPYDFCVLSFVV*EFLYSRQSSVENTHFVSMFIHIKH*ILTHDSQTN*PNIC 548
            M+PSF  ++WHQ W+++ +F T+  T  NE N    +    S  I    +  ID+ I+   +W+  +++ +N  TSF  K++ S   QF  +I       D   LSF+  E +    SSV +T+  ++   ++  ILTHD QTN   I 
Sbjct:    1 MWPSFFRTTWHQRWTVTGTFLTTGDTRTNEKNTLLLQFFVTSIRIWEVRVTTIDDNITLFQKWDDLVDQSVNWSTSFNQKHDLSRSLQFGDEIFNGSSTDDRFALSFIGQEMVDLGLSSVVSTNSETVVSSVQDQILTHDGQTNQTEIS 149          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Nematostella
Match: EDO35313 (6-phosphogluconate dehydrogenase, decarboxylating [Source:UniProtKB/TrEMBL;Acc:A7SLT6])

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 316/480 (65.83%), Postives = 377/480 (78.54%), Query Frame = 3
Query:  102 ADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            ADI LIGLAVMGQN++LNMN+HGY VC  NRT+  V +FL NEAK T+++GA SL+++V KL  PR++++LVKAG  VD FI  LVPLL  GDIIIDGGNSEY DS RRC+ L  + +LFVGSGVSGGEEGAR GPSLMPGG+ +AW HI+ IFQ IAAKA N +PCCDWVG DG+GHFVKMVHNGIEYGDMQL CEAYHLM+D L M ++EIS  F  WN  EL+SFLIEIT  I  +K  DG+ LVE I DSAGQKGTGKWTAI+AL++G+PVTLI ESVFAR LS+L+  RV AS          FTG+K EF+  I+ ALYASKI+SY QGFM+MR AA+ F W L+ G IALMWRGGCIIRSRFL NIK+A++KN NL  LL D+FF+  + KCQ SWR+ ++ A   GIPTPAFS AL+FYDG R+ +LPANLIQAQRD FGAH Y+LL +PG + HT+WTG GGN +++TYQA
Sbjct:    6 ADIALIGLAVMGQNIILNMNDHGYVVCAHNRTVEKVDRFLANEAKGTRIVGAHSLQEMVSKLKKPRRVMILVKAGSAVDAFIDHLVPLLESGDIIIDGGNSEYKDSMRRCKALEERGLLFVGSGVSGGEEGARYGPSLMPGGSEKAWPHIKPIFQAIAAKAGN-DPCCDWVGGDGSGHFVKMVHNGIEYGDMQLCCEAYHLMKDALGMTSDEISQVFDEWNKGELDSFLIEITKNIMAYKDADGSPLVEKIRDSAGQKGTGKWTAISALEYGMPVTLIGESVFARCLSSLQAERVHASTHLKGPASTKFTGDKKEFVEHIRKALYASKIVSYAQGFMLMREAAKVFNWKLNYGGIALMWRGGCIIRSRFLGNIKDAFNKNPNLDNLLLDDFFKDAIHKCQDSWRKTIATAVTLGIPTPAFSTALAFYDGYRSARLPANLIQAQRDYFGAHTYELLSNPGHFIHTNWTGKGGNVSSTTYQA 484          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Nematostella
Match: EDO28780 (6-phosphogluconate dehydrogenase, decarboxylating [Source:UniProtKB/TrEMBL;Acc:A7T5I4])

HSP 1 Score: 439.113 bits (1128), Expect = 1.525e-150
Identity = 221/334 (66.17%), Postives = 260/334 (77.84%), Query Frame = 3
Query:  423 RRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQ 1424
            RRC+ L  + +LFVGSGVSGGEEGAR GPSLMPGG+ +AW HI+ IFQ IAAKA N +PCCDWVG DG+GHFVKMVHNGIEYGDMQL CEAYHLM+D L M ++EIS  F  WN  EL+SFLIEIT  I  +K  DG+ LVE I DSAGQKGTGKWTAI+AL++G+PVTLI ESVFAR LS+L+  RV AS          FTG+K EF+  I+ ALYASKI+SY QGFM+MR AA+ F W L+ G IALMWRGGCIIRSRFL NIK+A++KN NL  LL D+FF+  + KCQ SWR+ ++ A   GIPTPAFS AL+FYDG R+ +LPANLIQ
Sbjct:    2 RRCKALEERGLLFVGSGVSGGEEGARYGPSLMPGGSEKAWPHIKPIFQAIAAKAGN-DPCCDWVGGDGSGHFVKMVHNGIEYGDMQLCCEAYHLMKDALGMTSDEISQVFDEWNKGELDSFLIEITKNIMAYKDADGSPLVEKIRDSAGQKGTGKWTAISALEYGMPVTLIGESVFARCLSSLQAERVHASTHLKGPASTKFTGDKKEFVEHIRKALYASKIVSYAQGFMLMREAAKVFNWKLNYGGIALMWRGGCIIRSRFLGNIKDAFNKNPNLDNLLLDDFFKDAIHKCQDSWRKTIATAVTLGIPTPAFSTALAFYDGYRSARLPANLIQ 334          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Medaka
Match: pgd (phosphogluconate dehydrogenase [Source:NCBI gene;Acc:101173937])

HSP 1 Score: 667.152 bits (1720), Expect = 0.000e+0
Identity = 324/483 (67.08%), Postives = 383/483 (79.30%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M +ADI LIGLAVMGQNL++NMN+HG+ VC +NRT+S V  FL+NEAK +KV+GA SLED+V KL  PR+IILLVKAGQ VDDFI KLVPLL  GDIIIDGGNSEY D+TRRCQ L  K +LFVGSGVSGGEEGAR GPSLMPGG+ EAW HI+ IFQ I+AK   GEPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLM+D+L M ++E+  AF +WN +EL+SFLIEIT+ I K++ +DG +L+  I DSAGQKGTGKWTAI+AL++G PVTLI E+VFAR LS+LK  RVEAS+         F+GNK  FL  I+ ALYASKIISY QGFM++R AA+EF W L+ G IALMWRGGCIIRS FL  IKEA+D++ +L  LL D FF K V  CQ+SWR+ V     HGIP P F+ ALSFYDG R + LPANL+QAQRD FGAH Y+LL  PG + HT+WTGHGGN ++S+Y A
Sbjct:    1 MAEADIALIGLAVMGQNLIMNMNDHGFVVCAYNRTVSKVHDFLNNEAKGSKVVGAESLEDMVSKLKKPRRIILLVKAGQAVDDFIDKLVPLLDAGDIIIDGGNSEYRDTTRRCQSLKEKGLLFVGSGVSGGEEGARYGPSLMPGGHKEAWPHIKDIFQSISAKVGTGEPCCDWVGDEGAGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGMDHDEMGQAFESWNKTELDSFLIEITANILKYRDSDGKHLLPKIRDSAGQKGTGKWTAISALEYGTPVTLIGEAVFARCLSSLKEERVEASRSLSGPQGVKFSGNKASFLEDIRKALYASKIISYAQGFMLLRQAAKEFSWSLNYGAIALMWRGGCIIRSVFLGKIKEAFDRDGDLQNLLLDHFFSKAVQDCQESWRRTVGTGVQHGIPMPCFTTALSFYDGYRHDMLPANLLQAQRDYFGAHTYELLSKPGHFIHTNWTGHGGNVSSSSYNA 483          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Planmine SMEST
Match: SMESG000005721.1 (SMESG000005721.1)

HSP 1 Score: 981.089 bits (2535), Expect = 0.000e+0
Identity = 483/483 (100.00%), Postives = 483/483 (100.00%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFVGSGVSGGEEGARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA
Sbjct:    1 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFVGSGVSGGEEGARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 483          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Planmine SMEST
Match: SMESG000005726.1 (SMESG000005726.1)

HSP 1 Score: 736.102 bits (1899), Expect = 0.000e+0
Identity = 368/495 (74.34%), Postives = 408/495 (82.42%), Query Frame = 3
Query:  102 ADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQ-----------------KSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTY 1535
            ADIGLIGLAVMGQNLVLNM   G+ VCVFNRTL  + KFL+N  KNT VIGA SLE+ V KL SPRKI+LLVKAGQ VDDFI  L+PLL+ GDIIIDGGNSE++DSTRRC+ LA K ILFVGSGVSGGEEGAR GPSLMPGGN EAWKHIQ IFQ IAAK  N EPCCDWVG +G+GHFVKMVHNGIEYGDMQLICEAYHLMRD L MGN+EIS  F  WN SELESFLIEIT+ ITKF+  +G YL+  IYDSAGQKGTGKWTAI ALD GVPVTLIAESVFAR LS LK +RVEASKRFPS+    FTGNK EFLN +K ALYASKIISYTQGFMMM+SA+ + KW L+LGKIALMWRGGCIIRSRFLQNIKEAY+K++NL +LLFDE+FQ+E+LKC+                  SWR+VVS A L G+PTPAFS AL+FYDGLRTE LPANL+QAQRDLFGAHQYQLL++P  Y H +WTG  G+AAASTY
Sbjct:    5 ADIGLIGLAVMGQNLVLNMAGQGFGVCVFNRTLLVMDKFLNNLPKNTNVIGARSLEEFVSKLKSPRKIMLLVKAGQAVDDFINNLIPLLNSGDIIIDGGNSEFNDSTRRCRQLAEKNILFVGSGVSGGEEGARYGPSLMPGGNIEAWKHIQPIFQAIAAKVENNEPCCDWVGLEGSGHFVKMVHNGIEYGDMQLICEAYHLMRDFLHMGNDEISETFDAWNKSELESFLIEITTIITKFQNENGEYLLNQIYDSAGQKGTGKWTAINALDLGVPVTLIAESVFARCLSGLKPVRVEASKRFPSNSSHKFTGNKDEFLNDLKLALYASKIISYTQGFMMMKSASDQNKWSLNLGKIALMWRGGCIIRSRFLQNIKEAYEKDENLSVLLFDEYFQREILKCEVTIDEEIKYNSIELFIKTSWRKVVSTAVLEGLPTPAFSSALAFYDGLRTENLPANLLQAQRDLFGAHQYQLLDNPSAYHHCNWTGTSGSAAASTY 499          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Planmine SMEST
Match: SMESG000034754.1 (SMESG000034754.1)

HSP 1 Score: 724.161 bits (1868), Expect = 0.000e+0
Identity = 348/463 (75.16%), Postives = 401/463 (86.61%), Query Frame = 3
Query:  156 MNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQ-TFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            MN+HGY+VCVFNRT+STV  FL+NEA+NT +IGA SL+  +D L  PRKI LLVKAG+PVDDFI++L P L  GDIIIDGGNSEY+DSTRRC+ LA K+ILFVGSG+SGGEEGAR+GPSLMPGGN EAWKHIQ IFQ I AKA N EPCCDWVG +GAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLD+GNEE+SN F  WN  ELESFLIEITS I KF+  +G YL+ DI D+AGQKGTGKWTAI ALDFGVPVTLIAESVFARSLSA K +RVEASKRF + + +  FTGNK EFLN +K ALYASKIISYTQGFMMM++A+ ++KW+L+LGKIALMWRGGCIIRSRFLQNIK+AY+K++ L +LLFDEFFQ E+L+C+ +WR+V+S A +HG+PTPAFS AL+FYDGLRTE+LPANL+QAQRDLFGAHQYQL   P  Y H +WTG+GGN AASTYQA
Sbjct:    1 MNDHGYRVCVFNRTISTVDHFLNNEARNTNIIGAKSLQQFIDNLAIPRKIFLLVKAGRPVDDFIERLTPFLSVGDIIIDGGNSEYNDSTRRCRHLAEKQILFVGSGISGGEEGARHGPSLMPGGNVEAWKHIQPIFQSICAKAENNEPCCDWVGLEGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDIGNEEMSNIFQQWNKEELESFLIEITSVIIKFQTENGKYLINDICDTAGQKGTGKWTAINALDFGVPVTLIAESVFARSLSAFKQVRVEASKRFGNRNTKFYFTGNKHEFLNDLKLALYASKIISYTQGFMMMKTASDQYKWELNLGKIALMWRGGCIIRSRFLQNIKQAYEKDETLFVLLFDEFFQGEILRCEANWRKVISSAVMHGLPTPAFSSALAFYDGLRTERLPANLLQAQRDLFGAHQYQLTSDPNVYLHCNWTGNGGNTAASTYQA 463          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Planmine SMEST
Match: SMESG000005724.1 (SMESG000005724.1)

HSP 1 Score: 722.235 bits (1863), Expect = 0.000e+0
Identity = 345/483 (71.43%), Postives = 405/483 (83.85%), Query Frame = 3
Query:   93 MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLFGAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA 1541
            M K+D G+IGL VMGQN  LN+N+HGYKVCVFNR L  +  FL+NEA N+ + G+ + E+ VDKL  PRKI+LL++AG PVDD I+KLVPLL  GDIIIDGGNSE++DSTRRC+ LA K ILFVGSGVSGGEEGAR GPSLMPGGN EAWKHIQ IFQ IAAK  N EPCCDWVG +G+GHFVKMVHNGIEYGDMQLICEAYHLMRDLL MGN+EIS  F  WN  ELES+LIEITS +T +++ +G+YL+++IYD AGQKGTGKWTAI+ LD GVPVTLIAESVF+R LS LK LR++ SK+FPSD    FT NK EFL  IK ALYASKIISYTQGFMMM++ ++ +KWDL+LGKIA+ WRGGC+IRSRFL NIKEAYD + NL IL+ DEFF+ EVLKCQ+SWR+VVS+AAL+GIP PAFS AL+FYDGLRTEKLPANL+QAQRD+FGAHQYQLL +   + HT+WTG+GG A A+ Y+A
Sbjct:    1 MNKSDFGMIGLGVMGQNFALNLNDHGYKVCVFNRELDILDHFLNNEASNSNITGSKTFEEFVDKLTLPRKIMLLIRAGTPVDDVIEKLVPLLSSGDIIIDGGNSEFNDSTRRCRQLAEKNILFVGSGVSGGEEGARYGPSLMPGGNIEAWKHIQPIFQAIAAKVENNEPCCDWVGLEGSGHFVKMVHNGIEYGDMQLICEAYHLMRDLLHMGNDEISATFEEWNKGELESYLIEITSLVTNYQSENGSYLLDEIYDCAGQKGTGKWTAISGLDCGVPVTLIAESVFSRYLSTLKALRLKVSKQFPSDCAFEFTENKNEFLKSIKQALYASKIISYTQGFMMMKNTSESYKWDLNLGKIAMTWRGGCVIRSRFLSNIKEAYDTDCNLSILILDEFFRNEVLKCQRSWRKVVSIAALYGIPIPAFSSALNFYDGLRTEKLPANLLQAQRDVFGAHQYQLLSNTEAFHHTNWTGNGGTATATKYEA 483          
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Planmine SMEST
Match: SMESG000005726.1 (SMESG000005726.1)

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 341/459 (74.29%), Postives = 377/459 (82.14%), Query Frame = 3
Query:  102 ADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNTKVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIIDGGNSEYHDSTRRCQDLAAKKILFXXXXXXXXXXXARNGPSLMPGGNAEAWKHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICEAYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYLVEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEASKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFKWDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVLKCQ-----------------KSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQA 1427
            ADIGLIGLAVMGQNLVLNM   G+ VCVFNRTL  + KFL+N  KNT VIGA SLE+ V KL SPRKI+LLVKAGQ VDDFI  L+PLL+ GDIIIDGGNSE++DSTRRC+ LA K ILFVGSGVSGGEEGAR GPSLMPGGN EAWKHIQ IFQ IAAK  N EPCCDWVG +G+GHFVKMVHNGIEYGDMQLICEAYHLMRD L MGN+EIS  F  WN SELESFLIEIT+ ITKF+  +G YL+  IYDSAGQKGTGKWTAI ALD GVPVTLIAESVFAR LS LK +RVEASKRFPS+    FTGNK EFLN +K ALYASKIISYTQGFMMM+SA+ + KW L+LGKIALMWRGGCIIRSRFLQNIKEAY+K++NL +LLFDE+FQ+E+LKC+                  SWR+VVS A L G+PTPAFS AL+FYDGLRTE LPANL+Q 
Sbjct:    5 ADIGLIGLAVMGQNLVLNMAGQGFGVCVFNRTLLVMDKFLNNLPKNTNVIGARSLEEFVSKLKSPRKIMLLVKAGQAVDDFINNLIPLLNSGDIIIDGGNSEFNDSTRRCRQLAEKNILFVGSGVSGGEEGARYGPSLMPGGNIEAWKHIQPIFQAIAAKVENNEPCCDWVGLEGSGHFVKMVHNGIEYGDMQLICEAYHLMRDFLHMGNDEISETFDAWNKSELESFLIEITTIITKFQNENGEYLLNQIYDSAGQKGTGKWTAINALDLGVPVTLIAESVFARCLSGLKPVRVEASKRFPSNSSHKFTGNKDEFLNDLKLALYASKIISYTQGFMMMKSASDQNKWSLNLGKIALMWRGGCIIRSRFLQNIKEAYEKDENLSVLLFDEYFQREILKCEVTIDEEIKYNSIELFIKTSWRKVVSTAVLEGLPTPAFSSALAFYDGLRTENLPANLLQV 463          
The following BLAST results are available for this feature:
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGD0.000e+067.91phosphogluconate dehydrogenase [Source:HGNC Symbol... [more]
PGD3.768e-12268.23phosphogluconate dehydrogenase [Source:HGNC Symbol... [more]
PGD8.601e-10276.47phosphogluconate dehydrogenase [Source:HGNC Symbol... [more]
PGD2.151e-8866.33phosphogluconate dehydrogenase [Source:HGNC Symbol... [more]
PGD3.666e-7376.25phosphogluconate dehydrogenase [Source:HGNC Symbol... [more]
back to top
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
T25B9.90.000e+061.036-phosphogluconate dehydrogenase, decarboxylating ... [more]
back to top
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pgd0.000e+065.49gene:FBgn0004654 transcript:FBtr0070384[more]
Pgd0.000e+065.49gene:FBgn0004654 transcript:FBtr0331410[more]
back to top
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pgd0.000e+068.12phosphogluconate dehydrogenase [Source:ZFIN;Acc:ZD... [more]
pgd0.000e+068.12phosphogluconate dehydrogenase [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PGD0.000e+068.51phosphogluconate dehydrogenase [Source:NCBI gene;A... [more]
PGD0.000e+068.66phosphogluconate dehydrogenase [Source:NCBI gene;A... [more]
PGD0.000e+067.36phosphogluconate dehydrogenase [Source:NCBI gene;A... [more]
PGD0.000e+067.30phosphogluconate dehydrogenase [Source:NCBI gene;A... [more]
PGD0.000e+066.95phosphogluconate dehydrogenase [Source:NCBI gene;A... [more]
back to top
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Pgd0.000e+067.49phosphogluconate dehydrogenase [Source:MGI Symbol;... [more]
back to top
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P52209|6PGD_HUMAN0.000e+067.916-phosphogluconate dehydrogenase, decarboxylating ... [more]
sp|P85968|6PGD_RAT0.000e+067.706-phosphogluconate dehydrogenase, decarboxylating ... [more]
sp|Q9DCD0|6PGD_MOUSE0.000e+067.496-phosphogluconate dehydrogenase, decarboxylating ... [more]
sp|P41570|6PGD_CERCA0.000e+066.746-phosphogluconate dehydrogenase, decarboxylating ... [more]
sp|P00349|6PGD_SHEEP0.000e+067.296-phosphogluconate dehydrogenase, decarboxylating ... [more]
back to top
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3B4D0B30.000e+068.746-phosphogluconate dehydrogenase, decarboxylating ... [more]
Q5ZIZ00.000e+069.026-phosphogluconate dehydrogenase, decarboxylating ... [more]
A0A3Q3RAY80.000e+068.326-phosphogluconate dehydrogenase, decarboxylating ... [more]
A0A3Q3BA010.000e+068.126-phosphogluconate dehydrogenase, decarboxylating ... [more]
Q6TNR80.000e+068.536-phosphogluconate dehydrogenase, decarboxylating ... [more]
back to top
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgd0.000e+068.74phosphogluconate dehydrogenase [Source:NCBI gene;A... [more]
back to top
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
GND10.000e+061.076-phosphogluconate dehydrogenase (decarboxylating)... [more]
GND20.000e+060.166-phosphogluconate dehydrogenase (decarboxylating)... [more]
YHR182C-A_mRNA2.349e-731.54Dubious open reading frame; unlikely to encode a f... [more]
back to top
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO353130.000e+065.836-phosphogluconate dehydrogenase, decarboxylating ... [more]
EDO287801.525e-15066.176-phosphogluconate dehydrogenase, decarboxylating ... [more]
back to top
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
pgd0.000e+067.08phosphogluconate dehydrogenase [Source:NCBI gene;A... [more]
back to top
BLAST of 6-phosphogluconate dehydrogenase, decarboxylating vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005721.10.000e+0100.00SMESG000005721.1[more]
SMESG000005726.10.000e+074.34SMESG000005726.1[more]
SMESG000034754.10.000e+075.16SMESG000034754.1[more]
SMESG000005724.10.000e+071.43SMESG000005724.1[more]
SMESG000005726.10.000e+074.29SMESG000005726.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031631 ID=SMED30031631|Name=6-phosphogluconate dehydrogenase, decarboxylating|organism=Schmidtea mediterranea sexual|type=transcript|length=2007bp
GAATCAACATCGCTGAAAAGATTATATTCTCAGCAGTCACTTTTAAAACT
TTCAGAGTCCAAATTGTTGACTTTTGAGTATTAAATTTAGAAATGGAAAA
AGCAGATATTGGGTTAATTGGTTTGGCTGTCATGGGTCAGAATTTAGTGC
TTAATATGAATGAACATGGATACAAAGTGTGTGTTTTCAACAGAACTTTG
TCTACTGTACAAAAATTCTTAGACAACGAAGCTAAGAACACAAAAGTCAT
AGGGGCAACGTCTTTGGAGGATCTTGTGGATAAATTGGTATCCCCCAGAA
AAATTATTCTTTTAGTAAAAGCTGGTCAACCGGTTGATGATTTTATTCAA
AAATTGGTTCCACTCTTACATCCTGGAGATATAATTATCGATGGGGGGAA
TTCAGAATATCACGATTCAACACGAAGGTGTCAAGATCTTGCAGCAAAAA
AAATTTTATTCGTTGGCAGTGGTGTAAGCGGAGGTGAAGAAGGAGCTAGA
AATGGACCAAGTTTGATGCCAGGAGGAAATGCTGAAGCTTGGAAACATAT
TCAATTAATATTTCAAGACATTGCCGCTAAAGCGAATAATGGGGAACCAT
GTTGTGATTGGGTTGGTAGTGATGGTGCAGGTCATTTTGTAAAGATGGTC
CATAACGGCATAGAGTATGGAGATATGCAATTGATTTGTGAAGCATATCA
CTTAATGAGGGATCTTTTAGACATGGGAAACGAAGAGATTTCCAATGCCT
TTGCTAATTGGAATAATAGTGAATTAGAATCGTTTTTAATTGAAATAACC
AGCCAGATTACAAAATTCAAAGCTAACGATGGAGCCTATTTGGTCGAAGA
TATTTATGATTCTGCCGGACAGAAAGGTACAGGAAAATGGACAGCCATTA
CCGCCCTTGATTTTGGAGTACCGGTAACGCTTATTGCCGAGAGCGTATTT
GCTCGCAGCTTATCTGCTTTAAAGACACTTAGAGTTGAGGCCAGCAAACG
ATTTCCATCGGATGATATACAAACTTTCACGGGAAATAAAACAGAATTTC
TGAATCAAATAAAATATGCATTGTATGCTAGTAAAATTATATCATACACT
CAAGGATTCATGATGATGCGAAGTGCTGCTCAAGAATTTAAATGGGATTT
AGATTTGGGTAAGATTGCATTGATGTGGAGAGGAGGCTGCATTATTCGAA
GTCGGTTTTTGCAAAATATCAAAGAAGCTTATGACAAGAATAAGAATTTA
CCAATTTTACTTTTTGATGAATTTTTCCAGAAAGAAGTTTTGAAATGTCA
AAAAAGCTGGCGTCAAGTGGTTTCAGTCGCTGCATTGCATGGAATTCCAA
CTCCAGCTTTTTCATGTGCTCTTTCCTTTTATGATGGGTTACGAACAGAA
AAATTGCCTGCTAATTTGATACAAGCTCAGAGAGATCTTTTTGGCGCTCA
TCAATATCAATTGTTAGAGCATCCTGGAACTTATGAACACACAGATTGGA
CGGGTCACGGAGGAAATGCAGCAGCATCTACATATCAGGCCTAATAGTTA
TCCACTATAGATAAAAAATTAATATATTTTATAGAATTGATATATCTTCA
AATTGTTATTATCTTATATAATCCTAATATTATTTTTATATCAATCTTTA
TTGATAATTAGAAACCATATTTTTTTTATTTAAAAATTTAGATAGTTTTC
ATCAGATTATAGTTACGAGATTTTTCACACTAATTCCAATTATGTTTGAA
ATGTTATTTAATGGTGAAATGCATGGTTAATAAATGGCATCATTTATATG
AGAATTATTGTGTGTATTCTTGTATCGATATTGGCAAGCATTTGCAGAGC
TTGTCTATTAGTTCCTCGACATATTCCATCAATAAAATATTGTTATGGAA
ATTAATTGCAGATTAGTTCTATTTTTACTGATTTCTGAAATATGCCACAT
AGTTTTTCTGTTGTCAGATTATATTTAATAATAAATTTTTCCCAATTATG
TTATGGG
back to top

protein sequence of SMED30031631-orf-1

>SMED30031631-orf-1 ID=SMED30031631-orf-1|Name=SMED30031631-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=484bp
MEKADIGLIGLAVMGQNLVLNMNEHGYKVCVFNRTLSTVQKFLDNEAKNT
KVIGATSLEDLVDKLVSPRKIILLVKAGQPVDDFIQKLVPLLHPGDIIID
GGNSEYHDSTRRCQDLAAKKILFVGSGVSGGEEGARNGPSLMPGGNAEAW
KHIQLIFQDIAAKANNGEPCCDWVGSDGAGHFVKMVHNGIEYGDMQLICE
AYHLMRDLLDMGNEEISNAFANWNNSELESFLIEITSQITKFKANDGAYL
VEDIYDSAGQKGTGKWTAITALDFGVPVTLIAESVFARSLSALKTLRVEA
SKRFPSDDIQTFTGNKTEFLNQIKYALYASKIISYTQGFMMMRSAAQEFK
WDLDLGKIALMWRGGCIIRSRFLQNIKEAYDKNKNLPILLFDEFFQKEVL
KCQKSWRQVVSVAALHGIPTPAFSCALSFYDGLRTEKLPANLIQAQRDLF
GAHQYQLLEHPGTYEHTDWTGHGGNAAASTYQA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0050661NADP binding
GO:0004616phosphogluconate dehydrogenase (decarboxylating) activity
GO:0016491oxidoreductase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR006183Pgluconate_DH
IPR0061146PGDH_C
IPR0133286PGD_dom2
IPR0122846PGD_dom_3
IPR0061136PGDH_Gnd/GntZ
IPR016040NAD(P)-bd_dom
IPR0061156PGDH_NADP-bd
IPR0061846PGdom_BS
IPR0089276-PGluconate_DH-like_C_sf
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006098pentose-phosphate shunt
GO:0009051pentose-phosphate shunt, oxidative branch
GO:0019322pentose biosynthetic process
GO:0019521D-gluconate metabolic process
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0070062extracellular exosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR0061836-phosphogluconate dehydrogenasePRINTSPR000766PGDHDRGNASEcoord: 169..197
score: 80.36
coord: 67..96
score: 54.42
coord: 120..145
score: 75.33
coord: 250..277
score: 62.42
coord: 4..27
score: 63.04
coord: 358..380
score: 66.07
IPR0061836-phosphogluconate dehydrogenasePANTHERPTHR118116-PHOSPHOGLUCONATE DEHYDROGENASEcoord: 2..482
IPR0061146-phosphogluconate dehydrogenase, C-terminalSMARTSM013506PGD_2coord: 180..470
e-value: 5.6E-192
score: 653.7
IPR0061146-phosphogluconate dehydrogenase, C-terminalPFAMPF003936PGDcoord: 180..469
e-value: 4.4E-122
score: 407.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 1..181
e-value: 2.4E-55
score: 189.4
NoneNo IPR availableGENE3DG3DSA:1.20.5.320coord: 437..483
e-value: 3.7E-21
score: 76.8
NoneNo IPR availablePANTHERPTHR11811:SF506-PHOSPHOGLUCONATE DEHYDROGENASE, DECARBOXYLATINGcoord: 2..482
IPR0061136-phosphogluconate dehydrogenase, decarboxylatingPIRSFPIRSF0001096PGDcoord: 1..478
e-value: 9.9E-230
score: 760.7
IPR0061136-phosphogluconate dehydrogenase, decarboxylatingTIGRFAMTIGR00873TIGR00873coord: 5..470
e-value: 9.6E-216
score: 715.0
IPR0061156-phosphogluconate dehydrogenase, NADP-bindingPFAMPF03446NAD_binding_2coord: 5..170
e-value: 7.2E-50
score: 169.2
IPR0133286-phosphogluconate dehydrogenase, domain 2GENE3DG3DSA:1.10.1040.10coord: 182..436
e-value: 8.4E-104
score: 348.4
IPR0061846-phosphogluconate-binding sitePROSITEPS004616PGDcoord: 254..266
IPR0089276-phosphogluconate dehydrogenase-like, C-terminal domain superfamilySUPERFAMILYSSF481796-phosphogluconate dehydrogenase C-terminal domain-likecoord: 178..473
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 4..175