Collagen F-8

Overview
NameCollagen F-8
Smed IDSMED30031625
Length (bp)5275
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Collagen F-8 (SMED30031625) t-SNE clustered cells

Violin plots show distribution of expression levels for Collagen F-8 (SMED30031625) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Collagen F-8 (SMED30031625) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Collagen F-8 (SMED30031625) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031625

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30031625h1SMcG0022555 Contig39837newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031625h1SMcG0022555 Contig39837uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031625h1SMcG0022555 Contig39838newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031625h1SMcG0022555 Contig39838uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031625h1SMcG0022554 Contig17787newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031625h1SMcG0022554 Contig17787uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031625h1SMcG0022556 Contig17787newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031625h1SMcG0022556 Contig17787uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031625h1SMcG0022553 Contig17787newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031625h1SMcG0022553 Contig17787uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031625h1SMcG0022554 Contig39837newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031625h1SMcG0022554 Contig39837uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30031625h1SMcG0022555 dd_Smed_v4_402_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031625h1SMcG0022555 dd_Smed_v4_402_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031625h1SMcG0022555 dd_Smed_v4_402_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031625h1SMcG0022555 dd_Smed_v4_402_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031625h1SMcG0022555 dd_Smed_v4_402_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30031625h1SMcG0022555 dd_Smed_v4_402_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031625h1SMcG0022555 Contig17787newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031625h1SMcG0022555 Contig17787uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
enteric muscle cellSMED30031625h1SMcG0022555 dd_Smed_v4_402_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30031625h1SMcG0022555 dd_Smed_v6_402_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30031625h1SMcG0022555 dd_Smed_v6_402_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031625h1SMcG0022555 dd_Smed_v4_402_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult fluorescence in situ hybridization evidence
muscle cellSMED30031625h1SMcG0022555 dd_Smed_v4_402_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Collagen F-8 vs. Ensembl Human
Match: COL11A1 (collagen type XI alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2186])

HSP 1 Score: 144.821 bits (364), Expect = 7.589e-34
Identity = 71/239 (29.71%), Postives = 127/239 (53.14%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L++++  ++ P+G+++NPAR C+D+ LS+P    G +WIDPN G   DS +V C F     +TC+   K+S    ++S+ K E P  W+       L   LD  GN +       M Q+ FL++L   A Q  T  C+++A +YD  + ++D A+R    ND  +    +  +K+          + D C  R +    +  +I+  K + +PIVD+ + DFG+ NQK 
Sbjct: 1460 MEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTSGG-ETCIYPDKKSEGVRISSWPK-EKPGSWFSEFKRGKLLSYLDVEGNSIN------MVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFIKT----------LYDGCASR-KGYEKTVIEINTPKIDQVPIVDVMINDFGDQNQKF 1679          

HSP 2 Score: 98.9821 bits (245), Expect = 6.809e-20
Identity = 60/227 (26.43%), Postives = 95/227 (41.85%), Query Frame = 2
Query:  269 FSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCS----MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTR------EIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDC 904
            F++   ++T        R ++  D+L+ +     P  I   TG C+      GS   Y V  +A L   +  +F        FSIL T K  +     + S+ + +G   +  ++GR  V  F +  G     ++       + D  WHRVA+SV    + + VDC+     PL R      + + I V G   L  + + G IQ   I    +AAY  CE Y+ DC
Sbjct:   17 FTVTTLALTFLFQAREVRGAAPVDVLKALDFHNSPEGISKTTGFCTNRKNSKGSDTAYRVSKQAQLSAPTKQLFPGGTFPEDFSILFTVKPKKGIQSFLLSIYNEHGIQQIGVEVGRSPVFLFEDHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIVDCKKKTTKPLDRSERAIVDTNGITVFGTRILDEEVFEGDIQQFLITGDPKAAYDYCEHYSPDC 243          

HSP 3 Score: 58.151 bits (139), Expect = 2.156e-7
Identity = 52/120 (43.33%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLS------GIDGNPGAKGAVGPRGT------PGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +G  G  GE+GE G PG  G  GL G  G  G  G  G DG  G  G  GPTGDPG  G +      G+ G PG  G  GP+G+      PGA G  G RG  G PGP G  G  G +G+
Sbjct:  655 RGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGS 774          

HSP 4 Score: 54.299 bits (129), Expect = 2.501e-6
Identity = 43/95 (45.26%), Postives = 50/95 (52.63%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP 2695
            GP G  G  G TG+PG  G  G  G +G PG  G PG  G +GS G  G  G  G+ G  G+ G PG +G  GP G    RG+ G RG  G PGP
Sbjct:  695 GPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTG---PRGSRGARGPTGKPGP 786          

HSP 5 Score: 53.5286 bits (127), Expect = 4.743e-6
Identity = 44/92 (47.83%), Postives = 50/92 (54.35%), Query Frame = 2
Query: 3827 SMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAI---GPRGQRGDPGLAGER 4093
             +G+ GP GE G  GP+G  GPTGD G  G  G +G  GV G+ G  G QG KG  G  G  G  GE G +G     GPRGQRG  G  G R
Sbjct:  684 EVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSR 775          

HSP 6 Score: 52.7582 bits (125), Expect = 7.861e-6
Identity = 40/96 (41.67%), Postives = 52/96 (54.17%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGL---------KGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G+ GP G  G +GP G+ GP+G  G KG +G+ G+ G  G +GP+G  G          KG  G +GK GP G+ GP G  G RG RG  G  G +
Sbjct:  692 GEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSRGARGPTGKPGPK 787          
BLAST of Collagen F-8 vs. Ensembl Human
Match: COL11A1 (collagen type XI alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2186])

HSP 1 Score: 143.665 bits (361), Expect = 2.008e-33
Identity = 71/239 (29.71%), Postives = 127/239 (53.14%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L++++  ++ P+G+++NPAR C+D+ LS+P    G +WIDPN G   DS +V C F     +TC+   K+S    ++S+ K E P  W+       L   LD  GN +       M Q+ FL++L   A Q  T  C+++A +YD  + ++D A+R    ND  +    +  +K+          + D C  R +    +  +I+  K + +PIVD+ + DFG+ NQK 
Sbjct: 1537 MEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNF-TSGGETCIYPDKKSEGVRISSWPK-EKPGSWFSEFKRGKLLSYLDVEGNSIN------MVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFIKT----------LYDGCASR-KGYEKTVIEINTPKIDQVPIVDVMINDFGDQNQKF 1756          

HSP 2 Score: 98.5969 bits (244), Expect = 9.931e-20
Identity = 60/227 (26.43%), Postives = 95/227 (41.85%), Query Frame = 2
Query:  269 FSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCS----MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTR------EIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDC 904
            F++   ++T        R ++  D+L+ +     P  I   TG C+      GS   Y V  +A L   +  +F        FSIL T K  +     + S+ + +G   +  ++GR  V  F +  G     ++       + D  WHRVA+SV    + + VDC+     PL R      + + I V G   L  + + G IQ   I    +AAY  CE Y+ DC
Sbjct:   17 FTVTTLALTFLFQAREVRGAAPVDVLKALDFHNSPEGISKTTGFCTNRKNSKGSDTAYRVSKQAQLSAPTKQLFPGGTFPEDFSILFTVKPKKGIQSFLLSIYNEHGIQQIGVEVGRSPVFLFEDHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIVDCKKKTTKPLDRSERAIVDTNGITVFGTRILDEEVFEGDIQQFLITGDPKAAYDYCEHYSPDC 243          

HSP 3 Score: 58.151 bits (139), Expect = 1.835e-7
Identity = 52/120 (43.33%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLS------GIDGNPGAKGAVGPRGT------PGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +G  G  GE+GE G PG  G  GL G  G  G  G  G DG  G  G  GPTGDPG  G +      G+ G PG  G  GP+G+      PGA G  G RG  G PGP G  G  G +G+
Sbjct:  732 RGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGS 851          

HSP 4 Score: 54.6842 bits (130), Expect = 2.413e-6
Identity = 43/95 (45.26%), Postives = 50/95 (52.63%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP 2695
            GP G  G  G TG+PG  G  G  G +G PG  G PG  G +GS G  G  G  G+ G  G+ G PG +G  GP G    RG+ G RG  G PGP
Sbjct:  772 GPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTG---PRGSRGARGPTGKPGP 863          

HSP 5 Score: 53.9138 bits (128), Expect = 3.676e-6
Identity = 44/92 (47.83%), Postives = 50/92 (54.35%), Query Frame = 2
Query: 3827 SMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAI---GPRGQRGDPGLAGER 4093
             +G+ GP GE G  GP+G  GPTGD G  G  G +G  GV G+ G  G QG KG  G  G  G  GE G +G     GPRGQRG  G  G R
Sbjct:  761 EVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSR 852          

HSP 6 Score: 53.1434 bits (126), Expect = 6.196e-6
Identity = 40/96 (41.67%), Postives = 52/96 (54.17%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGL---------KGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G+ GP G  G +GP G+ GP+G  G KG +G+ G+ G  G +GP+G  G          KG  G +GK GP G+ GP G  G RG RG  G  G +
Sbjct:  769 GEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSRGARGPTGKPGPK 864          
BLAST of Collagen F-8 vs. Ensembl Human
Match: COL11A1 (collagen type XI alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2186])

HSP 1 Score: 143.28 bits (360), Expect = 2.408e-33
Identity = 71/239 (29.71%), Postives = 127/239 (53.14%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L++++  ++ P+G+++NPAR C+D+ LS+P    G +WIDPN G   DS +V C F     +TC+   K+S    ++S+ K E P  W+       L   LD  GN +       M Q+ FL++L   A Q  T  C+++A +YD  + ++D A+R    ND  +    +  +K+          + D C  R +    +  +I+  K + +PIVD+ + DFG+ NQK 
Sbjct: 1576 MEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNF-TSGGETCIYPDKKSEGVRISSWPK-EKPGSWFSEFKRGKLLSYLDVEGNSIN------MVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFIKT----------LYDGCASR-KGYEKTVIEINTPKIDQVPIVDVMINDFGDQNQKF 1795          

HSP 2 Score: 98.2117 bits (243), Expect = 1.343e-19
Identity = 60/227 (26.43%), Postives = 95/227 (41.85%), Query Frame = 2
Query:  269 FSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCS----MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTR------EIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDC 904
            F++   ++T        R ++  D+L+ +     P  I   TG C+      GS   Y V  +A L   +  +F        FSIL T K  +     + S+ + +G   +  ++GR  V  F +  G     ++       + D  WHRVA+SV    + + VDC+     PL R      + + I V G   L  + + G IQ   I    +AAY  CE Y+ DC
Sbjct:   17 FTVTTLALTFLFQAREVRGAAPVDVLKALDFHNSPEGISKTTGFCTNRKNSKGSDTAYRVSKQAQLSAPTKQLFPGGTFPEDFSILFTVKPKKGIQSFLLSIYNEHGIQQIGVEVGRSPVFLFEDHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIVDCKKKTTKPLDRSERAIVDTNGITVFGTRILDEEVFEGDIQQFLITGDPKAAYDYCEHYSPDC 243          

HSP 3 Score: 58.5362 bits (140), Expect = 1.678e-7
Identity = 52/120 (43.33%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLS------GIDGNPGAKGAVGPRGT------PGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +G  G  GE+GE G PG  G  GL G  G  G  G  G DG  G  G  GPTGDPG  G +      G+ G PG  G  GP+G+      PGA G  G RG  G PGP G  G  G +G+
Sbjct:  771 RGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGS 890          

HSP 4 Score: 54.6842 bits (130), Expect = 2.263e-6
Identity = 43/95 (45.26%), Postives = 50/95 (52.63%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP 2695
            GP G  G  G TG+PG  G  G  G +G PG  G PG  G +GS G  G  G  G+ G  G+ G PG +G  GP G    RG+ G RG  G PGP
Sbjct:  811 GPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTG---PRGSRGARGPTGKPGP 902          

HSP 5 Score: 53.9138 bits (128), Expect = 3.447e-6
Identity = 44/92 (47.83%), Postives = 50/92 (54.35%), Query Frame = 2
Query: 3827 SMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAI---GPRGQRGDPGLAGER 4093
             +G+ GP GE G  GP+G  GPTGD G  G  G +G  GV G+ G  G QG KG  G  G  G  GE G +G     GPRGQRG  G  G R
Sbjct:  800 EVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSR 891          

HSP 6 Score: 53.5286 bits (127), Expect = 5.617e-6
Identity = 40/96 (41.67%), Postives = 52/96 (54.17%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGL---------KGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G+ GP G  G +GP G+ GP+G  G KG +G+ G+ G  G +GP+G  G          KG  G +GK GP G+ GP G  G RG RG  G  G +
Sbjct:  808 GEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSRGARGPTGKPGPK 903          
BLAST of Collagen F-8 vs. Ensembl Human
Match: COL11A1 (collagen type XI alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2186])

HSP 1 Score: 143.28 bits (360), Expect = 2.416e-33
Identity = 71/239 (29.71%), Postives = 127/239 (53.14%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L++++  ++ P+G+++NPAR C+D+ LS+P    G +WIDPN G   DS +V C F     +TC+   K+S    ++S+ K E P  W+       L   LD  GN +       M Q+ FL++L   A Q  T  C+++A +YD  + ++D A+R    ND  +    +  +K+          + D C  R +    +  +I+  K + +PIVD+ + DFG+ NQK 
Sbjct: 1588 MEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNF-TSGGETCIYPDKKSEGVRISSWPK-EKPGSWFSEFKRGKLLSYLDVEGNSIN------MVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFIKT----------LYDGCASR-KGYEKTVIEINTPKIDQVPIVDVMINDFGDQNQKF 1807          

HSP 2 Score: 98.5969 bits (244), Expect = 1.128e-19
Identity = 60/227 (26.43%), Postives = 95/227 (41.85%), Query Frame = 2
Query:  269 FSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCS----MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTR------EIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDC 904
            F++   ++T        R ++  D+L+ +     P  I   TG C+      GS   Y V  +A L   +  +F        FSIL T K  +     + S+ + +G   +  ++GR  V  F +  G     ++       + D  WHRVA+SV    + + VDC+     PL R      + + I V G   L  + + G IQ   I    +AAY  CE Y+ DC
Sbjct:   17 FTVTTLALTFLFQAREVRGAAPVDVLKALDFHNSPEGISKTTGFCTNRKNSKGSDTAYRVSKQAQLSAPTKQLFPGGTFPEDFSILFTVKPKKGIQSFLLSIYNEHGIQQIGVEVGRSPVFLFEDHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIVDCKKKTTKPLDRSERAIVDTNGITVFGTRILDEEVFEGDIQQFLITGDPKAAYDYCEHYSPDC 243          

HSP 3 Score: 58.5362 bits (140), Expect = 1.531e-7
Identity = 52/120 (43.33%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLS------GIDGNPGAKGAVGPRGT------PGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +G  G  GE+GE G PG  G  GL G  G  G  G  G DG  G  G  GPTGDPG  G +      G+ G PG  G  GP+G+      PGA G  G RG  G PGP G  G  G +G+
Sbjct:  783 RGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGS 902          

HSP 4 Score: 54.6842 bits (130), Expect = 2.064e-6
Identity = 43/95 (45.26%), Postives = 50/95 (52.63%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP 2695
            GP G  G  G TG+PG  G  G  G +G PG  G PG  G +GS G  G  G  G+ G  G+ G PG +G  GP G    RG+ G RG  G PGP
Sbjct:  823 GPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTG---PRGSRGARGPTGKPGP 914          

HSP 5 Score: 54.299 bits (129), Expect = 3.253e-6
Identity = 44/92 (47.83%), Postives = 50/92 (54.35%), Query Frame = 2
Query: 3827 SMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAI---GPRGQRGDPGLAGER 4093
             +G+ GP GE G  GP+G  GPTGD G  G  G +G  GV G+ G  G QG KG  G  G  G  GE G +G     GPRGQRG  G  G R
Sbjct:  812 EVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSR 903          

HSP 6 Score: 53.5286 bits (127), Expect = 5.345e-6
Identity = 40/96 (41.67%), Postives = 52/96 (54.17%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGL---------KGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G+ GP G  G +GP G+ GP+G  G KG +G+ G+ G  G +GP+G  G          KG  G +GK GP G+ GP G  G RG RG  G  G +
Sbjct:  820 GEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGSRGARGPTGKPGPK 915          
BLAST of Collagen F-8 vs. Ensembl Human
Match: COL5A1 (collagen type V alpha 1 chain [Source:HGNC Symbol;Acc:HGNC:2209])

HSP 1 Score: 137.502 bits (345), Expect = 1.603e-31
Identity = 69/239 (28.87%), Postives = 119/239 (49.79%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L+  +  ++RP+G++ NPAR C+D+ L +P    G +W+DPN G   DS +V C F      TCV   K+S    +TS+ K ENP  W+       L   +D  GN +  +      Q+ FL++L   A Q VT  C ++  + D+   ++D A+R    ND  +    +  +++          + D C  + +    +  +I   K E +PIVDI   DFG  +QK 
Sbjct: 1608 MEEIFGSLNSLKLEIEQMKRPLGTQQNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGG-STCVFPDKKSEGARITSWPK-ENPGSWFSEFKRGKLLSYVDAEGNPVGVV------QMTFLRLLSASAHQNVTYHCYQSVAWQDAATGSYDKALRFLGSNDEEMSYDNNPYIRA----------LVDGCATK-KGYQKTVLEIDTPKVEQVPIVDIMFNDFGEASQKF 1827          

HSP 2 Score: 98.9821 bits (245), Expect = 7.677e-20
Identity = 65/225 (28.89%), Postives = 97/225 (43.11%), Query Frame = 2
Query:  317 NRTSSHGDILQFIKIAQRPF-IQTQTGMC----SMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVL----HFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTR------EIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDC-PGLHDIMMNQQPD 943
            +R +   D+L+ +     P  I   TG C    S  G  + Y V  +A L   +  ++ A      FSIL T K  + S   + S+ +  G   +  ++GR  V     H  +PG     +     L D  WHR+ALSV    + L +DC+      L R      +I+ I+V G   L  + + G IQ L  V    AAY  CE Y+ DC   + D   +Q P+
Sbjct:   34 SRAAQPADLLKVLDFHNLPDGITKTTGFCATRRSSKGPDVAYRVTKDAQLSAPTKQLYPASAFPEDFSILTTVKAKKGSQAFLVSIYNEQGIQQIGLELGRSPVFLYEDHTGKPGPEDYPLFRGINLSDGKWHRIALSVHKKNVTLILDCKKKTTKFLDRSDHPMIDINGIIVFGTRILDEEVFEGDIQQLLFVSDHRAAYDYCEHYSPDCDTAVPDTPQSQDPN 258          
BLAST of Collagen F-8 vs. Ensembl Celegans
Match: col-135 (COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58])

HSP 1 Score: 85.8853 bits (211), Expect = 1.356e-16
Identity = 140/352 (39.77%), Postives = 175/352 (49.72%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNIGLDGDFGPIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMGPQGPNGPIGSPGLP------------GIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTK 3427
            +G  G  GE+G  G PGS G  G  G+ G PG  GD G+DG +G+ G+ G  GD G DG  G DGNPG+KG  G +G  G+ G  G +G +G PG  G  G KG  G  G  G  G KG +G  G  G  G  G  G +G  G  G KG+ G DG  G  GD G +G +G  G  G  G  G  G  G KG  G  G+ GDKG  G  GP G  G+ G P            G +G+ G PG  G+ G  G  GP+G +G+ G PG +G  G  G++G  G+KGD+               G  G  G+ G  G  G  G  G+KG+ G  G  G+ G PG  G  G+PG K
Sbjct:  162 KGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDK---------------GEKGQDGQPGQKGQDGQPGQKGDKGDKG-QGEKGQDGQPGQKGQDGQPGQK 497          

HSP 2 Score: 67.0106 bits (162), Expect = 9.989e-11
Identity = 48/100 (48.00%), Postives = 58/100 (58.00%), Query Frame = 2
Query: 2432 ERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            E+GE G PG  G  G  G  G+ GS G  G  GE+G+ G+ GP GD G DG  G DG PG+KG  G  G  GA GN G +G  G  G  G +GAKG++G 
Sbjct:  152 EKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGA 251          

HSP 3 Score: 63.5438 bits (153), Expect = 1.113e-9
Identity = 47/109 (43.12%), Postives = 64/109 (58.72%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            ++G +G PG +G+ GE G+    G  G+ G PGS GD G+DG +G+ G+ G  GD G+ GL G  G+ GA G  G +G  G +G  G +G DG PG  G  GA G +G 
Sbjct:  248 DKGANGTPGSKGDKGEKGA---DGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGA 353          

HSP 4 Score: 61.2326 bits (147), Expect = 4.864e-9
Identity = 46/105 (43.81%), Postives = 61/105 (58.10%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            ++G  G PG +G+ GE G+    G  G+ G PGS GD G+DG +G+ G+ G  GD G+ GL G  G+ GA G  G +G  G +G  G +G DG PG  G  G KG
Sbjct:  311 DKGADGTPGAKGDKGEKGA---DGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKG 412          

HSP 5 Score: 59.3066 bits (142), Expect = 1.915e-8
Identity = 51/121 (42.15%), Postives = 65/121 (53.72%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAK------GAVGPRGTPGARGNIGYRGFD------GIPGPPGPNGAKGEQGT 2731
            ++G  G  G +G  G PGS G TG  G  G+ G+ GD G+    G+ GS+G  G+ G DG  G DG PG+K      GA G  GTPG +G+ G +G D      G  G PG  G KGE+G 
Sbjct:  212 SKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGA---NGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGA 329          
BLAST of Collagen F-8 vs. Ensembl Celegans
Match: col-135 (COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58])

HSP 1 Score: 72.0182 bits (175), Expect = 3.232e-12
Identity = 50/108 (46.30%), Postives = 62/108 (57.41%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +G  G  GE+G  G PGS G  G  G+ G PG  GD G+DG +G+ G+ G  GD G DG  G DGNPG+KG  G +G  G+ G  G +G +G PG  G  G KG  G 
Sbjct:  162 KGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGA 269          

HSP 2 Score: 70.8626 bits (172), Expect = 6.031e-12
Identity = 52/110 (47.27%), Postives = 69/110 (62.73%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPG---SDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +G  G PG++G+ GE G  GP G  G+ G PG+ GD G   +DG +G+ G+ G  GD G+ GL G  G+ GA GA G  GTPGA+G+ G +G DG  G  G  GAKG++G
Sbjct:  288 KGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKG 397          

HSP 3 Score: 66.6254 bits (161), Expect = 1.496e-10
Identity = 54/124 (43.55%), Postives = 71/124 (57.26%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSG------IDGNPGAKG---------AVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            ++G +G PG +G+ GE G+    G  G+ G PGS GD G+DG +G+ G+ G  GD G+ GL G       DG PGAKG         A G  GTPG++G+ G +G DG  G  G +GAKG  GT
Sbjct:  248 DKGANGTPGSKGDKGEKGA---DGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGT 368          

HSP 4 Score: 66.2402 bits (160), Expect = 1.657e-10
Identity = 48/100 (48.00%), Postives = 58/100 (58.00%), Query Frame = 2
Query: 2432 ERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            E+GE G PG  G  G  G  G+ GS G  G  GE+G+ G+ GP GD G DG  G DG PG+KG  G  G  GA GN G +G  G  G  G +GAKG++G 
Sbjct:  152 EKGEKGSPGQKGDKGEKGEKGSNGSPGSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGA 251          

HSP 5 Score: 65.0846 bits (157), Expect = 3.634e-10
Identity = 52/122 (42.62%), Postives = 68/122 (55.74%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPG---SDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRG------------TPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +G  G PG +G+ GE G  GP G  G+ G PG+ GD G   +DG +G+ G+ G  GD G DG  G DG PG KG  G +G            TPGA+G+ G +G DG  G  G  G+KG++G
Sbjct:  384 KGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKG 505          

HSP 6 Score: 64.3142 bits (155), Expect = 7.252e-10
Identity = 48/107 (44.86%), Postives = 67/107 (62.62%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGI---DGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            G  G++GE G  G+ GP G  G+ GA G+ G PGS G++GS G++G  G+PG  G +G     G+ GAKG  G  GTPG++G+ G +G DG  G  G  G+KG++G 
Sbjct:  178 GSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGA 284          

HSP 7 Score: 63.929 bits (154), Expect = 1.020e-9
Identity = 48/107 (44.86%), Postives = 65/107 (60.75%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +G  G  G++G  G PGS G  G  G+ GA G+ G PGS G++G+ G++G  G PG+ G  G  G  G KG  G  GTPGA+G+ G +G DG  G  G  G+KG++G
Sbjct:  240 KGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKG 346          

HSP 8 Score: 62.7734 bits (151), Expect = 2.142e-9
Identity = 49/110 (44.55%), Postives = 63/110 (57.27%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPR---GTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +G  G  G +G  G PG+ G  G  G+ GA G+ G PG+ G++G  G  GP GD G DG  G  G+ G KGA G +   GTPG++G+ G  G  G  G PG  G KGE+G
Sbjct:  354 KGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKG 463          

HSP 9 Score: 61.2326 bits (147), Expect = 5.910e-9
Identity = 51/113 (45.13%), Postives = 62/113 (54.87%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGA---PGSTGDPGSDGERGSIG---SRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            G  G  GE+G  G PG  G  G  G+ GA   PGS GD GSDG +G+ G   S+G TGD G+ G  G  G+ GA G  G +G  G +G  G +G DG PG  G  GA G +G 
Sbjct:  178 GSKGDKGEKGADGNPGPKGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGA 290          

HSP 10 Score: 61.2326 bits (147), Expect = 6.602e-9
Identity = 54/129 (41.86%), Postives = 70/129 (54.26%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLS------GIDGNPGAK---------GAVGPRGTPGARGNIGYRGFD------GIPGPPGPNGAKGEQG 2728
            ++G  G PG +G+ GE G+    G  G+ G PGS GD G+DG +G+ G+ G  GD G+ GL       G DG PGAK         GA G  GTPG++G+ G +G D      G  G PG  G KGE+G
Sbjct:  407 DKGADGTPGAKGDKGEKGA---DGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKG 532          

HSP 11 Score: 60.8474 bits (146), Expect = 7.763e-9
Identity = 49/111 (44.14%), Postives = 65/111 (58.56%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDG---ERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +G  G PG +G+ GE G  GP G  G+ GA G+ G PG+ G   E+G+ G++G  G PG  G  G  G  G KG  G  GTPGA+G+ G +G DG  G  G  G+KG++G 
Sbjct:  333 KGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGA 443          

HSP 12 Score: 60.4622 bits (145), Expect = 9.689e-9
Identity = 51/110 (46.36%), Postives = 61/110 (55.45%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGA---PGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +G  G  G +G  G PGS G  G  G+ GA   PGS GD G  GE+GS G++G  G  G  G  G  G  GA GA G  GTPG++G+ G  G  G  G PG  G KGE+G
Sbjct:  195 KGDKGADGAKGADGTPGSKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGANGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKG 304          

HSP 13 Score: 58.5362 bits (140), Expect = 4.126e-8
Identity = 50/119 (42.02%), Postives = 68/119 (57.14%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPG---SDGERGSIGSRGPTGDPGKDGLS------GIDGNPGAKGAVGPRGT---PGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +G  G PG++G+ GE G  GP G  G+ G PG+ GD G   +DG +G+ G+ G  GD G  GL       G DG PG+KG  G +G    PG +G+ G +G DG PG  G +G  G++G
Sbjct:  447 KGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGDKGLDGPKGDKGADGTPGSKGDKGEKGDIGQPGQKGDKGEKGQDGQPGQKGQDGQPGQKG 565          

HSP 14 Score: 58.5362 bits (140), Expect = 4.493e-8
Identity = 49/121 (40.50%), Postives = 63/121 (52.07%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERG------------SIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            ++G  G  G +G  G PGS G  G  G+ GA G+ G  G  GE+G            + G++G  GD G DG  G DG PG+KG  G +G  G +G+ G  G  G  G PG  G KGE+GT
Sbjct:  260 DKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGADGAKGADGTPGSKGDKGEKGLDGPKGDKGADGAKGANGTPGAKGDKGEKGT 380          

HSP 15 Score: 58.151 bits (139), Expect = 5.801e-8
Identity = 51/126 (40.48%), Postives = 67/126 (53.17%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGS------RGPTGDPGKDGLSGIDGNPGAK------GAVGPRGTPGARGNIGYRGFD------GIPGPPGPNGAKGEQGT 2731
            +G +G PG +G+ GE G+ G  G  G+ GA G  G+ G DG +G  G+      +G  G+ G DG  G DG PG+K      GA G  GTPG +G+ G +G D      G  G PG  G KGE+G 
Sbjct:  363 KGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGA 488          

HSP 16 Score: 57.7658 bits (138), Expect = 6.997e-8
Identity = 50/121 (41.32%), Postives = 65/121 (53.72%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAK------GAVGPRGTPGARGNIGYRGFD------GIPGPPGPNGAKGEQGT 2731
            ++G  G  G +G  G PGS G TG  G  G+ G+ GD G+    G+ GS+G  G+ G DG  G DG PG+K      GA G  GTPG +G+ G +G D      G  G PG  G KG++G 
Sbjct:  212 SKGDKGSDGAKGADGNPGSKGDTGDKGEKGSDGAKGDKGA---NGTPGSKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGDKGA 329          

HSP 17 Score: 55.8398 bits (133), Expect = 2.977e-7
Identity = 57/135 (42.22%), Postives = 75/135 (55.56%), Query Frame = 2
Query: 3032 GPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQ---GEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTK 3427
            GP G  G+ G  G  G+PG  GD GE G  G KG +GT G+ G+ G++G+ G  G+ G     G KGD+G+ G  G+ G+ G  G  G  G +G  G  G  G  G+KGE G  GP G+ G  G PG +G+ G K
Sbjct:  352 GPKGDKGADGAKGANGTPGAKGDKGEKGTDGAKGADGTPGAKGDKGEKGLDGPKGDKGADGTPGAKGDKGEKGADGAKGADGTPGSKGDKGADGAKGADGTPGQKGDKGEKGLDGPKGDKGADGTPGAKGDKGEK 486          
BLAST of Collagen F-8 vs. Ensembl Celegans
Match: col-54 (COLlagen [Source:UniProtKB/TrEMBL;Acc:O44774])

HSP 1 Score: 59.6918 bits (143), Expect = 5.731e-9
Identity = 54/126 (42.86%), Postives = 62/126 (49.21%), Query Frame = 2
Query: 2408 QGPSGYP---------------------GERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTP---GARGNIGYRGFDGIPGPPGPNGA 2713
            QGP G P                     GE+G  GEPG  G TG IG  GAPG  G+ GS G  G+ G  GP G+PGKDG  G  G+ G  G  G +G P   G  G+ G  G DG PG PGP+ A
Sbjct:  140 QGPDGAPGAPGPDGQPGAPGSNGNPGSAGEQGSEGEPGDAGATGEIGVAGAPGKNGNRGS-GAPGAPGPEGPIGEPGKDGQQGPHGDVGGDGTEGIQGAPGKDGENGSDGVAGSDGAPGAPGPDAA 264          

HSP 2 Score: 54.299 bits (129), Expect = 3.330e-7
Identity = 51/120 (42.50%), Postives = 63/120 (52.50%), Query Frame = 2
Query: 2414 PSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGI--------DGNPGAKGAVGPRGTPGA------RGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            P+G PG +G  G PG+ GP G     GAPGS G+PGS GE+GS G  G  G  G+ G++G          G PGA G  GP G PG        G++G  G +GI G PG +G  G  G 
Sbjct:  133 PAGEPGPQGPDGAPGAPGPDG---QPGAPGSNGNPGSAGEQGSEGEPGDAGATGEIGVAGAPGKNGNRGSGAPGAPGPEGPIGEPGKDGQQGPHGDVGGDGTEGIQGAPGKDGENGSDGV 249          

HSP 3 Score: 50.8322 bits (120), Expect = 4.252e-6
Identity = 50/130 (38.46%), Postives = 59/130 (45.38%), Query Frame = 2
Query: 3032 GPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPG 3421
            GP GP G+PG PG  G PG PG  G        G  G +GS G PGD G  G  G  G  G+ G+R                        G  G  GP G +GE G++G  GP G+VG  G  G+QG PG
Sbjct:  138 GPQGPDGAPGAPGPDGQPGAPGSNGN------PGSAGEQGSEGEPGDAGATGEIGVAGAPGKNGNR----------------------GSGAPGAPGPEGPIGEPGKDGQQGPHGDVGGDGTEGIQGAPG 239          
BLAST of Collagen F-8 vs. Ensembl Celegans
Match: col-149 (COLlagen [Source:UniProtKB/TrEMBL;Acc:Q17417])

HSP 1 Score: 59.3066 bits (142), Expect = 8.562e-9
Identity = 50/106 (47.17%), Postives = 54/106 (50.94%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGA---PGSTGDPGSDGERG--SIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGE 2722
            G PG RG  G PG  GP G  G  G    PG  G PG DG RG  S G+ G  G PG+ G  G  G PG +G  GP G  G  G  G RG DG PG PG  G +G 
Sbjct:  174 GQPGRRGNDGRPGQPGPQGNAGQPGRDGNPGQPGHPGKDGRRGHGSPGAPGRAGQPGRQGAPGNPGRPGERGPSGPCGPAGRSGQPGNRGSDGHPGAPGNPGLQGS 279          
BLAST of Collagen F-8 vs. Ensembl Celegans
Match: dpy-17 (DumPY: shorter than wild-type [Source:UniProtKB/TrEMBL;Acc:Q20778])

HSP 1 Score: 59.3066 bits (142), Expect = 1.154e-8
Identity = 61/153 (39.87%), Postives = 69/153 (45.10%), Query Frame = 2
Query: 3023 GPQGPNGPIGSPG------------LPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGN--------PGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPG 3421
            GPQGP G  G PG            +PG  GSPG+PG +G  GPPG  G EG  G  G         PG +G PG PGE G QGE+GDRG                          G+ GP G  G +GE G  GP G  G    PG +GEPG
Sbjct:  202 GPQGPPGSQGKPGARGMRGARGQAAMPGRDGSPGMPGSLGPIGPPGAAGEEGPTGEPGADVEHQIGLPGAKGTPGAPGESGDQGEQGDRGA------------------------TGIAGPPGERGPQGEKGDDGPNGAAGS---PGEEGEPG 327          

HSP 2 Score: 56.225 bits (134), Expect = 1.200e-7
Identity = 49/107 (45.79%), Postives = 57/107 (53.27%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +G +  PG  G  G PGS+GP G  G+ G  G TG+PG+D E   IG  G  G PG  G SG  G  G +GA G  G PG RG  G +G D      GPNGA G  G
Sbjct:  222 RGQAAMPGRDGSPGMPGSLGPIGPPGAAGEEGPTGEPGADVEH-QIGLPGAKGTPGAPGESGDQGEQGDRGATGIAGPPGERGPQGEKGDD------GPNGAAGSPG 321          

HSP 3 Score: 54.6842 bits (130), Expect = 3.515e-7
Identity = 49/107 (45.79%), Postives = 58/107 (54.21%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            QGP G  G+ G  G  G+ G   + G  G+PG  G  G  G  G+ G  GPTG+PG D    I G PGAKG  G  G  G +G  G RG  GI GPPG  G +GE+G
Sbjct:  204 QGPPGSQGKPGARGMRGARGQAAMPGRDGSPGMPGSLGPIGPPGAAGEEGPTGEPGADVEHQI-GLPGAKGTPGAPGESGDQGEQGDRGATGIAGPPGERGPQGEKG 309          

HSP 4 Score: 51.2174 bits (121), Expect = 4.853e-6
Identity = 40/84 (47.62%), Postives = 48/84 (57.14%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGS-----VGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPG 2647
            GP G  GE G TGEPG+     +G  G  G+ GAPG +GD G  G+RG+ G  GP G+ G  G  G DG  GA G+ G  G PG
Sbjct:  244 GPPGAAGEEGPTGEPGADVEHQIGLPGAKGTPGAPGESGDQGEQGDRGATGIAGPPGERGPQGEKGDDGPNGAAGSPGEEGEPG 327          
BLAST of Collagen F-8 vs. Ensembl Fly
Match: CG42342 (gene:FBgn0259244 transcript:FBtr0303650)

HSP 1 Score: 59.3066 bits (142), Expect = 3.629e-8
Identity = 47/99 (47.47%), Postives = 54/99 (54.55%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPG 2701
            +QGP G PG  G  GE G  GP+G  G  G PG  G  G+ GE G  G RG  G PG DG+ G +G  G +G+ G  G PG RG  G RG  G  G PG
Sbjct:  655 DQGPMGLPGPMGMRGESGPSGPSGKAGIPGPPGLDGMKGAQGETGHKGERGDPGLPGTDGIPGQEGPRGEQGSRGDAGPPGKRGRKGDRGDKGEQGVPG 753          

HSP 2 Score: 51.9878 bits (123), Expect = 5.352e-6
Identity = 43/93 (46.24%), Postives = 55/93 (59.14%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGE---QGPTGDRGIKGGVGIQGMKGVE---GVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G QGP+G PG  G +GE    GP+G  GI G  G+ GMKG +   G +G +G  GL G  G  G+EGP GE G +G  GP G+RG  G  G++
Sbjct:  654 GDQGPMGLPGPMGMRGESGPSGPSGKAGIPGPPGLDGMKGAQGETGHKGERGDPGLPGTDGIPGQEGPRGEQGSRGDAGPPGKRGRKGDRGDK 746          
BLAST of Collagen F-8 vs. Ensembl Fly
Match: CG42342 (gene:FBgn0259244 transcript:FBtr0336781)

HSP 1 Score: 58.9214 bits (141), Expect = 3.905e-8
Identity = 47/99 (47.47%), Postives = 54/99 (54.55%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPG 2701
            +QGP G PG  G  GE G  GP+G  G  G PG  G  G+ GE G  G RG  G PG DG+ G +G  G +G+ G  G PG RG  G RG  G  G PG
Sbjct:  632 DQGPMGLPGPMGMRGESGPSGPSGKAGIPGPPGLDGMKGAQGETGHKGERGDPGLPGTDGIPGQEGPRGEQGSRGDAGPPGKRGRKGDRGDKGEQGVPG 730          

HSP 2 Score: 51.9878 bits (123), Expect = 5.723e-6
Identity = 43/93 (46.24%), Postives = 55/93 (59.14%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGE---QGPTGDRGIKGGVGIQGMKGVE---GVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G QGP+G PG  G +GE    GP+G  GI G  G+ GMKG +   G +G +G  GL G  G  G+EGP GE G +G  GP G+RG  G  G++
Sbjct:  631 GDQGPMGLPGPMGMRGESGPSGPSGKAGIPGPPGLDGMKGAQGETGHKGERGDPGLPGTDGIPGQEGPRGEQGSRGDAGPPGKRGRKGDRGDK 723          
BLAST of Collagen F-8 vs. Ensembl Fly
Match: CG42342 (gene:FBgn0259244 transcript:FBtr0336782)

HSP 1 Score: 58.9214 bits (141), Expect = 4.561e-8
Identity = 47/99 (47.47%), Postives = 54/99 (54.55%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPG 2701
            +QGP G PG  G  GE G  GP+G  G  G PG  G  G+ GE G  G RG  G PG DG+ G +G  G +G+ G  G PG RG  G RG  G  G PG
Sbjct:  637 DQGPMGLPGPMGMRGESGPSGPSGKAGIPGPPGLDGMKGAQGETGHKGERGDPGLPGTDGIPGQEGPRGEQGSRGDAGPPGKRGRKGDRGDKGEQGVPG 735          

HSP 2 Score: 51.9878 bits (123), Expect = 6.295e-6
Identity = 43/93 (46.24%), Postives = 55/93 (59.14%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGE---QGPTGDRGIKGGVGIQGMKGVE---GVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G QGP+G PG  G +GE    GP+G  GI G  G+ GMKG +   G +G +G  GL G  G  G+EGP GE G +G  GP G+RG  G  G++
Sbjct:  636 GDQGPMGLPGPMGMRGESGPSGPSGKAGIPGPPGLDGMKGAQGETGHKGERGDPGLPGTDGIPGQEGPRGEQGSRGDAGPPGKRGRKGDRGDK 728          
BLAST of Collagen F-8 vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079003)

HSP 1 Score: 56.225 bits (134), Expect = 3.972e-7
Identity = 49/109 (44.95%), Postives = 58/109 (53.21%), Query Frame = 2
Query: 2432 ERGETGEPGSVGPTGLIGSIGAP---GSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIP------GPPGPNGAKGEQGT 2731
            E+G  G PG +GPTGL G +G P   G +GD G  G+ G  G RG  G+ G  GL G  G PG +G  G  G PG  G  G  G DGIP      G PGP G  G+ G+
Sbjct:   87 EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGS 195          

HSP 2 Score: 55.4546 bits (132), Expect = 5.378e-7
Identity = 64/140 (45.71%), Postives = 73/140 (52.14%), Query Frame = 2
Query: 3047 IGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPG---ELGPQ------------GEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPG 3421
            IG  GLPG+ G PG+ G  G  GP G KG  G  GS G PG  G PG PG   + GPQ            G+KGD+G  G  G  G  G +G  G  G  G  G  GP+G  GE+G  GP G  G  G PGLPG +GEPG
Sbjct: 1320 IGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPG 1459          

HSP 3 Score: 54.299 bits (129), Expect = 1.207e-6
Identity = 50/112 (44.64%), Postives = 58/112 (51.79%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGL---------IGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GYPG+RG+ G PG  G  G+         IG  G  G  G PG DG RG  G++G  G PG  G+ G  G+ GA G  GP+G  G  G  G RG  GIPG  G  G KG  G
Sbjct:  887 GYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATG 998          

HSP 4 Score: 53.9138 bits (128), Expect = 1.763e-6
Identity = 54/125 (43.20%), Postives = 65/125 (52.00%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSD------GERGSIGSRGPTGDPGK--DGLSGIDGNP---------GAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +QG  GY GE+GE GE G  GP G+ G+ G  G  G PG+       G +G IG RG  G PG    G  G+ G P         GA G +G RG PG  G     G  G+PGP GP G+KGE+G
Sbjct: 1230 SQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEP---GLVGLPGPIGPAGSKGERG 1351          

HSP 5 Score: 53.5286 bits (127), Expect = 2.176e-6
Identity = 49/109 (44.95%), Postives = 56/109 (51.38%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGID------GNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            GP G+PG  G  G PG  G  GL G  G PG  G+ G  G  G  G  GP G PG DG+ G D      G+PG  G  G +G  GA GN G +GF G+ G PG  G  G
Sbjct:  875 GPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAG 983          

HSP 6 Score: 53.5286 bits (127), Expect = 2.327e-6
Identity = 60/135 (44.44%), Postives = 70/135 (51.85%), Query Frame = 2
Query: 3020 MGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGT 3424
             G +G  G  GSPGL G  G PGV G  G  G PG  G +G  G  G PG +G+ G+PG  G  G+ G +G+ G P         G  G PG  G AG+ GP G  GEKGE G  GP G  G  G  GL+GE G 
Sbjct:  127 YGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGA 261          

HSP 7 Score: 53.1434 bits (126), Expect = 3.073e-6
Identity = 53/118 (44.92%), Postives = 58/118 (49.15%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGER------------GSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GP+G  GERG  G PG  G  G  G+ G  G TG  G  GER            G  G +GP+G PG  G  G  G PG  G  GP G PG RG  G +G DG  G PG  G KGE G
Sbjct: 1342 GPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPG 1459          

HSP 8 Score: 52.7582 bits (125), Expect = 3.825e-6
Identity = 48/106 (45.28%), Postives = 57/106 (53.77%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGA---KGEQG 2728
            G PG+ G  G PG  G  G  G  G  G TG PG  GE G  G  G TG+PGK  L  +      KG  G  G PGA+G  G++G +G+PG PGP G    KGE+G
Sbjct:  588 GIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKG 693          

HSP 9 Score: 51.9878 bits (123), Expect = 6.723e-6
Identity = 51/115 (44.35%), Postives = 59/115 (51.30%), Query Frame = 2
Query: 2408 QGPSGYPGER--GETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSR------GPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +G +G PG+   G  G PG+ G  G  G  G PG+ G  G  G +G +G +      GP GD G  GL GI G  GA      RG PG RG  G RG DGI G  GP G KGE G
Sbjct:  519 KGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGA------RGPPGERGYPGERGHDGINGQTGPPGEKGEDG 627          

HSP 10 Score: 51.6026 bits (122), Expect = 7.956e-6
Identity = 47/105 (44.76%), Postives = 54/105 (51.43%), Query Frame = 2
Query: 2417 SGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            SG PG  GE G+ G +GP G+ G  G PG  G  G DG +G  GS G  G PG  G  G  GN G KG  G  G PG RG  G          PG +GAKG++G 
Sbjct:  901 SGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGI---------PGVSGAKGDKGA 996          

HSP 11 Score: 51.6026 bits (122), Expect = 8.298e-6
Identity = 54/122 (44.26%), Postives = 60/122 (49.18%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIG------SIGAPGSTGD---------PGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            GP G PG  G  GE G  GPTG IG      S+G PG  GD         PG  GE+G +G  GP G  G  G+ GIDG  G  GA G  G+PG  G  G +G  G PG  GP G  G  G 
Sbjct:  854 GPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGA 975          

HSP 12 Score: 51.6026 bits (122), Expect = 9.027e-6
Identity = 47/109 (43.12%), Postives = 58/109 (53.21%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTG------LIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            G  GE G  G PG +GP G      L GS G PG  G PG+ G +G  G +G  G+ G +G  G  G+ G +G  GP G PG  G  G  G+ G+ G  GP GA GE+G
Sbjct: 1327 GLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERG 1435          
BLAST of Collagen F-8 vs. Ensembl Fly
Match: Col4a1 (gene:FBgn0000299 transcript:FBtr0079002)

HSP 1 Score: 56.225 bits (134), Expect = 3.972e-7
Identity = 49/109 (44.95%), Postives = 58/109 (53.21%), Query Frame = 2
Query: 2432 ERGETGEPGSVGPTGLIGSIGAP---GSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIP------GPPGPNGAKGEQGT 2731
            E+G  G PG +GPTGL G +G P   G +GD G  G+ G  G RG  G+ G  GL G  G PG +G  G  G PG  G  G  G DGIP      G PGP G  G+ G+
Sbjct:   87 EKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGDPGPYGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGS 195          

HSP 2 Score: 55.4546 bits (132), Expect = 5.378e-7
Identity = 64/140 (45.71%), Postives = 73/140 (52.14%), Query Frame = 2
Query: 3047 IGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPG---ELGPQ------------GEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPG 3421
            IG  GLPG+ G PG+ G  G  GP G KG  G  GS G PG  G PG PG   + GPQ            G+KGD+G  G  G  G  G +G  G  G  G  G  GP+G  GE+G  GP G  G  G PGLPG +GEPG
Sbjct: 1320 IGERGLPGLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPG 1459          

HSP 3 Score: 54.299 bits (129), Expect = 1.207e-6
Identity = 50/112 (44.64%), Postives = 58/112 (51.79%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGL---------IGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GYPG+RG+ G PG  G  G+         IG  G  G  G PG DG RG  G++G  G PG  G+ G  G+ GA G  GP+G  G  G  G RG  GIPG  G  G KG  G
Sbjct:  887 GYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGIPGVSGAKGDKGATG 998          

HSP 4 Score: 53.9138 bits (128), Expect = 1.763e-6
Identity = 54/125 (43.20%), Postives = 65/125 (52.00%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSD------GERGSIGSRGPTGDPGK--DGLSGIDGNP---------GAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +QG  GY GE+GE GE G  GP G+ G+ G  G  G PG+       G +G IG RG  G PG    G  G+ G P         GA G +G RG PG  G     G  G+PGP GP G+KGE+G
Sbjct: 1230 SQGERGYTGEKGEQGERGLTGPAGVAGAKGDRGLQGPPGASGLNGIPGAKGDIGPRGEIGYPGVTIKGEKGLPGRPGRNGRQGLIGAPGLIGERGLPGLAGEP---GLVGLPGPIGPAGSKGERG 1351          

HSP 5 Score: 53.5286 bits (127), Expect = 2.176e-6
Identity = 49/109 (44.95%), Postives = 56/109 (51.38%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGID------GNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            GP G+PG  G  G PG  G  GL G  G PG  G+ G  G  G  G  GP G PG DG+ G D      G+PG  G  G +G  GA GN G +GF G+ G PG  G  G
Sbjct:  875 GPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAG 983          

HSP 6 Score: 53.5286 bits (127), Expect = 2.327e-6
Identity = 60/135 (44.44%), Postives = 70/135 (51.85%), Query Frame = 2
Query: 3020 MGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGT 3424
             G +G  G  GSPGL G  G PGV G  G  G PG  G +G  G  G PG +G+ G+PG  G  G+ G +G+ G P         G  G PG  G AG+ GP G  GEKGE G  GP G  G  G  GL+GE G 
Sbjct:  127 YGQRGDKGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKGEKGEPAKENGDYAKGEKGEPGWRGTAGLAGPQGFPGEKGERGDSGPYGAKGPRGEHGLKGEKGA 261          

HSP 7 Score: 53.1434 bits (126), Expect = 3.073e-6
Identity = 53/118 (44.92%), Postives = 58/118 (49.15%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGER------------GSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GP+G  GERG  G PG  G  G  G+ G  G TG  G  GER            G  G +GP+G PG  G  G  G PG  G  GP G PG RG  G +G DG  G PG  G KGE G
Sbjct: 1342 GPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERGFTGPKGRDGRDGTPGLPGQKGEPG 1459          

HSP 8 Score: 52.7582 bits (125), Expect = 3.825e-6
Identity = 48/106 (45.28%), Postives = 57/106 (53.77%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGA---KGEQG 2728
            G PG+ G  G PG  G  G  G  G  G TG PG  GE G  G  G TG+PGK  L  +      KG  G  G PGA+G  G++G +G+PG PGP G    KGE+G
Sbjct:  588 GIPGKDGARGPPGERGYPGERGHDGINGQTGPPGEKGEDGRTGLPGATGEPGKPALCDLSLIEPLKGDKGYPGAPGAKGVQGFKGAEGLPGIPGPKGEFGFKGEKG 693          

HSP 9 Score: 51.9878 bits (123), Expect = 6.723e-6
Identity = 51/115 (44.35%), Postives = 59/115 (51.30%), Query Frame = 2
Query: 2408 QGPSGYPGER--GETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSR------GPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +G +G PG+   G  G PG+ G  G  G  G PG+ G  G  G +G +G +      GP GD G  GL GI G  GA      RG PG RG  G RG DGI G  GP G KGE G
Sbjct:  519 KGNAGAPGDSKLGRPGTPGAAGAPGQKGDAGRPGTPGQKGDMGIKGDVGGKCSSCRAGPKGDKGTSGLPGIPGKDGA------RGPPGERGYPGERGHDGINGQTGPPGEKGEDG 627          

HSP 10 Score: 51.6026 bits (122), Expect = 7.956e-6
Identity = 47/105 (44.76%), Postives = 54/105 (51.43%), Query Frame = 2
Query: 2417 SGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            SG PG  GE G+ G +GP G+ G  G PG  G  G DG +G  GS G  G PG  G  G  GN G KG  G  G PG RG  G          PG +GAKG++G 
Sbjct:  901 SGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGAPGKRGPAGI---------PGVSGAKGDKGA 996          

HSP 11 Score: 51.6026 bits (122), Expect = 8.298e-6
Identity = 54/122 (44.26%), Postives = 60/122 (49.18%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIG------SIGAPGSTGD---------PGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            GP G PG  G  GE G  GPTG IG      S+G PG  GD         PG  GE+G +G  GP G  G  G+ GIDG  G  GA G  G+PG  G  G +G  G PG  GP G  G  G 
Sbjct:  854 GPMGPPGLNGLQGEKGDRGPTGPIGFPGADGSVGYPGDRGDAGLPGVSGRPGIVGEKGDVGPIGPAGVAGPPGVPGIDGVRGRDGAKGEPGSPGLVGMPGNKGDRGAPGNDGPKGFAGVTGA 975          

HSP 12 Score: 51.6026 bits (122), Expect = 9.027e-6
Identity = 47/109 (43.12%), Postives = 58/109 (53.21%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTG------LIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            G  GE G  G PG +GP G      L GS G PG  G PG+ G +G  G +G  G+ G +G  G  G+ G +G  GP G PG  G  G  G+ G+ G  GP GA GE+G
Sbjct: 1327 GLAGEPGLVGLPGPIGPAGSKGERGLAGSPGQPGQDGFPGAPGLKGDTGPQGFKGERGLNGFEGQKGDKGDRGLQGPSGLPGLVGQKGDTGYPGLNGNDGPVGAPGERG 1435          
BLAST of Collagen F-8 vs. Ensembl Zebrafish
Match: col5a3a (collagen, type V, alpha 3a [Source:ZFIN;Acc:ZDB-GENE-030131-968])

HSP 1 Score: 145.976 bits (367), Expect = 2.137e-34
Identity = 70/239 (29.29%), Postives = 125/239 (52.30%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLS-------EILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++++++ ++  +  +++P+G+  +PAR C+++ L +P    G +WIDPN G   DSI V C F  E  +TC+   K+     L ++ K E P  W+           +D  GN +      P+ Q+ FL++L   A QT T  C  +  +YD  N NH +A+R R  ND  +         ++  S  +   + D C  R    T +  QI++ ++E LP++D+ + DFG++NQK 
Sbjct: 1657 MEEVFASLNSMKTEVELMRKPLGTFESPARTCKELMLCHPDYKDGEYWIDPNQGCHRDSIRVFCNFTAEG-ETCLHPDKRFETVKLAAWNK-EKPGSWYSQYRKGKQFSYIDTEGNPV------PVVQMTFLKLLSATAMQTFTFSCQNSIGWYDMSNHNHQHALRFRGSNDEEM---------TQDKSPFI-TALYDGCQTRKGLDT-TVLQINSPRSELLPLIDVAISDFGSNNQKF 1876          

HSP 2 Score: 90.8929 bits (224), Expect = 1.479e-17
Identity = 51/204 (25.00%), Postives = 92/204 (45.10%), Query Frame = 2
Query:  338 DILQFIKIAQ-RPFIQTQTGMCS----MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVL----HFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTR------EIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDC 904
            D+L+ +++++    +  + G+C+       + + Y +  +  L   +  +F       +FS++ T K  R S   + S+ D  G   L  ++GR  V     H  +P      +  K  L D  WHR+A SV   ++ L++DC+  + + L R        D ++V G   L  + + G IQ L +V   +AA   C+ Y  DC
Sbjct:   31 DVLRALELSEDMEGVTVEAGLCTERKGTSETDMAYRIDKKIQLSAPTKQLFPDSAFPENFSLMTTVKAKRNSQFFLLSLYDEQGVQQLGLEMGRSPVFLYEDHKGQPAPDLYPLFRKINLSDGKWHRIAYSVEGKSVTLYLDCKKVQTLELMRGDDPVVSTDGVIVFGTRLLDEEVFEGEIQQLLLVDDPQAASDYCQDYIPDC 234          

HSP 3 Score: 67.0106 bits (162), Expect = 2.400e-10
Identity = 50/110 (45.45%), Postives = 63/110 (57.27%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGT---PGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            QGP G PGE+G  G+PG  G  G+ G  G PG  G PG  G +G  G++GP G PG  G+ G DG  G KG+ G +G    PGA+G +G +G  G  G PG  G  G +G
Sbjct:  766 QGPIGLPGEKGPEGKPGMQGLPGIDGPPGHPGREGPPGEKGHQGLSGAQGPVGYPGPRGVKGADGVRGLKGSKGEKGEDGFPGAKGEMGIKGDRGDNGSPGSRGEDGPEG 875          

HSP 4 Score: 59.6918 bits (143), Expect = 4.220e-8
Identity = 51/108 (47.22%), Postives = 59/108 (54.63%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            QGP GYPG RG  G   + G  GL GS G  G  G PG+ GE G  G RG  G PG     G DG  G KG  GP G PG+ G  G +G  G+PG PG  G +G +G+
Sbjct:  814 QGPVGYPGPRGVKG---ADGVRGLKGSKGEKGEDGFPGAKGEMGIKGDRGDNGSPGS---RGEDGPEGPKGQSGPLGEPGSAGIAGEKGKLGVPGLPGYPGRQGSKGS 915          

HSP 5 Score: 58.9214 bits (141), Expect = 8.001e-8
Identity = 48/107 (44.86%), Postives = 59/107 (55.14%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            GP G+PG  G  GE G  G +G  G +G PG  G  G+DG RG  GS+G  G+         DG PGAKG +G +G  G  G+ G RG DG  GP G +G  GE G+
Sbjct:  791 GPPGHPGREGPPGEKGHQGLSGAQGPVGYPGPRGVKGADGVRGLKGSKGEKGE---------DGFPGAKGEMGIKGDRGDNGSPGSRGEDGPEGPKGQSGPLGEPGS 888          

HSP 6 Score: 57.7658 bits (138), Expect = 1.678e-7
Identity = 47/107 (43.93%), Postives = 54/107 (50.47%), Query Frame = 2
Query: 2465 GPTGLIGSIGAPGSTGDPGSDGERGSIG------------SRGPTGDPGKDGLSGIDGNPGAKGAVGPRG------TPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            GP G +G  G PG  G PG  G +G IG            S GP G PGK G SG DG  GA G  G +G       PG  GN G+RG  G PGP GP+G  G +G+
Sbjct:  590 GPPGPLGLTGRPGPVGLPGPSGLKGDIGENGPPGPRGLPGSAGPNGKPGKRGRSGADGGRGAPGETGAKGDRGFDGLPGLPGNKGHRGDRGKPGPQGPHGEPGHKGS 696          

HSP 7 Score: 56.6102 bits (135), Expect = 3.520e-7
Identity = 51/118 (43.22%), Postives = 61/118 (51.69%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIG------------SRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GP G  G+ G  GEPGS G  G  G +G PG  G PG  G +GS+G             RGP G  G DG  G +G  G +GA GP G PGA+G+ G+ G  G  G  GP G +G  G
Sbjct:  872 GPEGPKGQSGPLGEPGSAGIAGEKGKLGVPGLPGYPGRQGSKGSVGFPGTAGLEGEKGKRGPAGQAGADGERGPNGARGGRGARGPTGKPGAKGSAGHDGPPGATGERGPQGPQGRNG 989          

HSP 8 Score: 56.6102 bits (135), Expect = 3.641e-7
Identity = 55/130 (42.31%), Postives = 60/130 (46.15%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERG------SIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPR---------------------GTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GYPG +G  G  G  G  GL G  G  G  G  G+DGERG        G+RGPTG PG  G +G DG PGA G  GP+                     G PG  G  G  GF G  GPPGP G  G QG
Sbjct:  905 GYPGRQGSKGSVGFPGTAGLEGEKGKRGPAGQAGADGERGPNGARGGRGARGPTGKPGAKGSAGHDGPPGATGERGPQGPQGRNGEAGPKGPNGPPGKDGLPGHPGQRGEPGFQGKTGPPGPAGVVGPQG 1034          

HSP 9 Score: 56.6102 bits (135), Expect = 3.894e-7
Identity = 44/99 (44.44%), Postives = 57/99 (57.58%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTG---DRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEI---------GSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G++GP GE G  G  G QGP G    RG+KG  G++G+KG +G +G  G  G KGE+         GS G  G  G +GPKG  GP G+ G  G+AGE+
Sbjct:  797 GREGPPGEKGHQGLSGAQGPVGYPGPRGVKGADGVRGLKGSKGEKGEDGFPGAKGEMGIKGDRGDNGSPGSRGEDGPEGPKGQSGPLGEPGSAGIAGEK 895          

HSP 10 Score: 56.225 bits (134), Expect = 4.345e-7
Identity = 39/80 (48.75%), Postives = 48/80 (60.00%), Query Frame = 2
Query: 3851 GEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGE 4090
            GEPGL G QG  GP GD G +G  G  G  G++G+ GP G +G  G +GS G  G  G  GP+GAIG  G +G PG  G+
Sbjct: 1229 GEPGLRGQQGMYGPKGDEGERGFKGATGPPGLQGMPGPPGEKGESGHVGSMGPPGQHGPRGPQGAIGGEGPQGMPGAVGQ 1308          

HSP 11 Score: 53.1434 bits (126), Expect = 3.717e-6
Identity = 50/126 (39.68%), Postives = 61/126 (48.41%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDG------------------LSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            + GP G  G RG  G  G  GP G+ G++G PG  G+ G DGE G+ G+ G TG  G+ G                  + GI G+ G KG  GP G PG  G  G  G +GI G PG  G  GE G
Sbjct: 1278 SMGPPGQHGPRGPQGAIGGEGPQGMPGAVGQPGVVGEKGEDGEAGNPGNVGETGLVGEKGEVGEKGDAGPPGAAGPPGIRGIPGSDGPKGNPGPLGFPGDSGPSGEPGVNGIDGGPGAKGDNGEPG 1403          

HSP 12 Score: 52.373 bits (124), Expect = 7.730e-6
Identity = 65/167 (38.92%), Postives = 79/167 (47.31%), Query Frame = 2
Query: 3017 FMGPQGP------NGPIGSPG---LPGIQGSPGVPGD------------------MGEHGPPGFKGPEGTR---GSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTK 3427
            F GPQGP       GP G PG   LPGI G PG PG                   +G  GP G KG +G R   GS G  G+ G PG  GE+G +G++GD                G  G  G++GP G +G  G +GE G  G  G  G++GVPGLPG  G  G+K
Sbjct:  762 FPGPQGPIGLPGEKGPEGKPGMQGLPGIDGPPGHPGREGPPGEKGHQGLSGAQGPVGYPGPRGVKGADGVRGLKGSKGEKGEDGFPGAKGEMGIKGDRGDN---------------GSPGSRGEDGPEGPKGQSGPLGEPGSAGIAGEKGKLGVPGLPGYPGRQGSK 913          
BLAST of Collagen F-8 vs. Ensembl Zebrafish
Match: col2a1a (collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-980526-192])

HSP 1 Score: 137.502 bits (345), Expect = 8.470e-32
Identity = 74/271 (27.31%), Postives = 123/271 (45.39%), Query Frame = 2
Query: 4259 TRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMS--------QLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            + F   ++ E+G D L      + ++ +     ++ + +  +   +  I+ P GS+ NPAR CRD+ L +P+  SG++W+DPNLGS  D+I+V C    E+ +TCV  +     +      K++  +  W  E +    N      Y   S        QL FL++L T+A QT+T  C  +  Y D    N   AI ++  ND  I        ++E  S      ++D C         +  +   +KT  LPI+DI   D G  +Q+ 
Sbjct: 1155 SAFAGLSQPEKGPDPLRYMRADEASSSLRQHDVEVDATLKSINGQIEDIRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNM--ETGETCVKPSTPKIPRKNWWTSKSKAQKHVWFGESM----NGGFHFSYADGSQTPSTTTIQLNFLRLLSTEATQTITYHCKNSVAYMDQATGNLKKAILLQGSNDVEI--------RAEGNSRFTYGVLEDGCKKHTGQWAKTVIEYKTQKTSRLPIMDIAPMDIGGADQEF 1411          

HSP 2 Score: 55.8398 bits (133), Expect = 5.866e-7
Identity = 41/91 (45.05%), Postives = 50/91 (54.95%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPG 2692
            G PG RG  G+ G +G  G  G  G PG+ G PG+ GE+G  G +G +G PG  G SG  G  G  G  GP+G  GA+G  G  GF G  G
Sbjct:  747 GAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATGFPGAAG 837          

HSP 3 Score: 53.1434 bits (126), Expect = 3.812e-6
Identity = 40/81 (49.38%), Postives = 45/81 (55.56%), Query Frame = 2
Query: 2429 GERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYR 2671
            GERGE G+PG  G  GL G  GAPG  G PG  G  G  G+ GPTG  G+ G  G  G  G +G  GPRG PG  G  G +
Sbjct:  585 GERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDGPK 665          

HSP 4 Score: 53.1434 bits (126), Expect = 4.254e-6
Identity = 55/130 (42.31%), Postives = 64/130 (49.23%), Query Frame = 2
Query: 2429 GERGETGEPGSVGPTGLIGSIGAPGSTGDPGSD---------GERGSIGSRGP---TGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIG------------------YRGFDGIPGPPGPNGAKGEQG 2728
            G+RG  GEPGS GP G  G  GAPG+ G PG D         G+RG  G  GP   TGDPG+ G  G+   PGA+G  G  G  GA+G +G                   RG  G+ G PGP GA GE G
Sbjct:  423 GKRGPRGEPGSAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGL---PGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANGEPG 549          
BLAST of Collagen F-8 vs. Ensembl Zebrafish
Match: col11a1a (collagen, type XI, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-070209-167])

HSP 1 Score: 135.961 bits (341), Expect = 2.563e-31
Identity = 66/239 (27.62%), Postives = 128/239 (53.56%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            ++ ++S+++ L++++  ++ P+G+++NPAR C+D+ L++P+   G ++IDPN G   DS +V C F     +TC+   K+S+   ++S+ K E P  W+       +   +D  GN +       M Q+ FL++L   A Q +T  C+++  ++D+   ++D A+     ND  I    +  +K+          + D C  R +    +  +I+  K + +PIVD++  DFG+ NQK 
Sbjct: 1583 MEDIFSSLNNLKQDIERMKYPMGTQNNPARSCKDLQLAHPEFPDGEYYIDPNQGCSGDSFKVYCNFTAGG-ETCIFPDKKSNGVRISSWPK-EVPGSWFSEFKRGKILSYVDAEGNSIN------MVQMTFLKLLTASARQNLTYSCHQSVAWHDATTDSYDRALHFLGSNDEEISYDNNPYIKA----------LSDGCAVR-KGYGKTVLEINTPKIDQVPIVDVKFTDFGDPNQKF 1802          

HSP 2 Score: 93.9745 bits (232), Expect = 1.516e-18
Identity = 66/246 (26.83%), Postives = 100/246 (40.65%), Query Frame = 2
Query:  263 VLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCS---MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTRE----IDE--ILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLH-DIMMNQQPDDSNT 955
             +F L   S+   +   H R     D+L+ ++    P  ++  +G C+          Y +   A L   +  +F        FSIL T K        + S+ +  G   L  ++GR  V  + +  G     ++       L D  WHRV +SV    + + VDC+     PL R     ID   I V G   L  + + G IQ L IV   +AAY  CE Y+ DC   H D +  Q+P +  T
Sbjct:   20 TVFKLITVSLVLVLQAPHVRAEPV-DVLKVLEFPTVPEGVEKTSGFCTNRRASQPDAAYKISKNAQLSAPTKQLFPDGVFPEDFSILTTIKPKAGIQSFLLSIYNEKGVQQLGVEVGRSPVFLYEDQEGKPAPEDYPLFRALNLADGKWHRVGISVEKKTVTIVVDCKKKLTKPLGRSDHASIDTKGITVFGTRILDEESFEGDIQQLLIVADPKAAYDYCEHYSPDCDVPHKDTLQAQEPGEEYT 264          

HSP 3 Score: 54.299 bits (129), Expect = 1.763e-6
Identity = 41/96 (42.71%), Postives = 51/96 (53.12%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGL---------KGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G+ GP G  G +GP GE GP G  G KG +G+ G+ G  G +GP+G  G          KG  G +GK GP G+ GP G  G RG RG  G  G +
Sbjct:  816 GEDGPEGPKGRAGPNGESGPQGSAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGGRGVAGKAGPRGQRGPTGPRGARGARGPTGKPGPK 911          

HSP 4 Score: 53.5286 bits (127), Expect = 2.777e-6
Identity = 48/125 (38.40%), Postives = 63/125 (50.40%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGER------------------GSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            GP G+PG+ G  GE G++G  G  G IG PG  G  G+DG R                  G +G +G  G+ G  G  G DG  G KG  GP G  G +G+ G +G  G+PG PG  G +G +G+
Sbjct:  738 GPPGHPGKEGPPGEKGALGQPGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGELGLAGPRGEDGPEGPKGRAGPNGESGPQGSAGEKGKLGVPGLPGYPGRQGPKGS 862          

HSP 5 Score: 52.7582 bits (125), Expect = 4.965e-6
Identity = 50/120 (41.67%), Postives = 57/120 (47.50%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPT------------GLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            QGP GYPG RG  G  G  G              G  G +G  G  G+ G  G RG  G  GP G  G +G SG  G+ G KG +G  G PG  G  G +G  G PG PG NG KG +G 
Sbjct:  761 QGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGELGLAGPRGEDGPEGPKGRAGPNGESGPQGSAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGGRGV 880          
BLAST of Collagen F-8 vs. Ensembl Zebrafish
Match: col2a1a (collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-980526-192])

HSP 1 Score: 135.576 bits (340), Expect = 2.727e-31
Identity = 71/270 (26.30%), Postives = 126/270 (46.67%), Query Frame = 2
Query: 4259 TRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILD-------QNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            + F   ++ E+G D L      + ++ +     ++ + +  +   +  I+ P GS+ NPAR CRD+ L +P+  SG++W+DPNLGS  D+I+V C    E+ +TCV  +     +      K++  +  W  E ++        +G++          QL FL++L T+A QT+T  C  +  Y D    N   AI ++  N        D ++++E  S      ++D C         +  +   +KT  LPI+DI   D G  +Q+ 
Sbjct: 1225 SAFAGLSQPEKGPDPLRYMRADEASSSLRQHDVEVDATLKSINGQIEDIRSPDGSRKNPARSCRDLKLCHPEWKSGDYWVDPNLGSAADAIKVFCNM--ETGETCVKPSTPKIPRKNWWTSKSKAQKHVWFGESMNGGFHFSYADGSQTPSTTTI---QLNFLRLLSTEATQTITYHCKNSVAYMDQATGNLKKAILLQGSN--------DVEIRAEGNSRFTYGVLEDGCKKHTGQWAKTVIEYKTQKTSRLPIMDIAPMDIGGADQEF 1481          

HSP 2 Score: 56.6102 bits (135), Expect = 3.392e-7
Identity = 41/91 (45.05%), Postives = 50/91 (54.95%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPG 2692
            G PG RG  G+ G +G  G  G  G PG+ G PG+ GE+G  G +G +G PG  G SG  G  G  G  GP+G  GA+G  G  GF G  G
Sbjct:  817 GAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGAPGATGFPGAAG 907          

HSP 3 Score: 53.9138 bits (128), Expect = 2.357e-6
Identity = 53/117 (45.30%), Postives = 59/117 (50.43%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIG---------YRGFDGIPGPPGPNGAKGEQG 2728
            + GP G PGERG  G  G  G  GL G+ GAPG  G PG  G +G  G  G  G+PG  G  G+ G PG  GA G  G  GA G  G          RG  G+ G PGP GA GE G
Sbjct:  503 SAGPLGPPGERGAPGNRGFPGQDGLAGAKGAPGDRGVPGLSGPKGGTGDPGRPGEPGLPGARGLTGRPGDAGAQGKVGATGAPGEDGRPGPPGPLGARGQPGVMGFPGPKGANGEPG 619          

HSP 4 Score: 53.9138 bits (128), Expect = 2.500e-6
Identity = 40/81 (49.38%), Postives = 45/81 (55.56%), Query Frame = 2
Query: 2429 GERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYR 2671
            GERGE G+PG  G  GL G  GAPG  G PG  G  G  G+ GPTG  G+ G  G  G  G +G  GPRG PG  G  G +
Sbjct:  655 GERGEQGQPGPSGFQGLPGPTGAPGEPGKPGDQGVPGEGGAAGPTGPRGERGFPGERGGAGPQGLQGPRGLPGTPGTDGPK 735          

HSP 5 Score: 52.373 bits (124), Expect = 7.231e-6
Identity = 44/91 (48.35%), Postives = 49/91 (53.85%), Query Frame = 2
Query: 2459 SVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            + G TG IGSIGAPG+ G PG  GE G+ G  G  G PG DG  G  G  G  G  G  G PG +G  G  G  G  G  GP GA+G QG 
Sbjct:  806 AKGETGPIGSIGAPGARGAPGDRGEIGAPGPAGFAGPPGADGQPGNKGEQGESGQKGDSGAPGPQGPSGAPGPVGPTGVTGPKGARGAQGA 896          
BLAST of Collagen F-8 vs. Ensembl Zebrafish
Match: col5a1 (procollagen, type V, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-041105-6])

HSP 1 Score: 135.576 bits (340), Expect = 3.379e-31
Identity = 75/275 (27.27%), Postives = 131/275 (47.64%), Query Frame = 2
Query: 4244 YVNTGTRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            Y ++  R KR     +  D+  +       +G    +++++ +++ L+  +  ++ P+G++SNPAR C+D+ L +P    G +WIDPN G   DS +V C F     ++C+   K+S    LTS+ K ENP  W+       L   +D  GN +  +      Q+ FL++L   A Q +T  C ++  ++D    ++D AIR    ND  +    +  +++          V D C  + +    +  +I+  K E +P VDI   DFG   QK 
Sbjct: 1749 YQSSPKRAKRNIDASQVMDEATDANYKDYEDG----MEEIFGSLNSLKLEIEQMKHPLGTESNPARTCKDLQLCHPDFPDGEYWIDPNQGCSRDSFKVYCNFTAGG-ESCIFPDKKSEGARLTSWPK-ENPGTWFSEYKRGKLLSYVDAEGNAIGVV------QMTFLRLLSATARQNLTYNCYQSVAWHDQDQDSYDKAIRFLGSNDEEMSYDNNPYIRA----------VVDGCALK-KGYEKTILEINTPKVEQVPFVDIMFNDFGGATQKF 2000          

HSP 2 Score: 96.2857 bits (238), Expect = 3.281e-19
Identity = 67/223 (30.04%), Postives = 98/223 (43.95%), Query Frame = 2
Query:  338 DILQFIKIAQRPF-IQTQTGMC----SMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVL----HFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTRE----IDE--ILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQP--DDSNT 955
            D+L+ +     P  +   TG C    S  G  + Y V  +A L   +  ++ +      FSIL T +  + S   + SV +  G   L  ++GR  V     H  +PG     +     L D  WHRVA+SV   +I L +DC+      L+R     ID   I+V G   L  + + G IQ L IV    AA+  CE Y+ DC    ++   +QP   D NT
Sbjct:    5 DLLKILDFHSLPDGVTKTTGFCTHRKSSKGPDVAYRVTKDAQLSAPTKQLYPSSMFPEDFSILATVRPKKGSQSFLLSVYNEQGIQQLGLEVGRSPVFLYEDHLGKPGPEDYPLFRGINLADGKWHRVAISVHKQSITLILDCKKKVTRTLSRSPHPIIDTKGIVVFGTRILDEEVFEGDIQQLMIVSDHRAAFDYCEHYSPDC----EVSAPEQPQNQDPNT 223          

HSP 3 Score: 69.3218 bits (168), Expect = 5.025e-11
Identity = 52/110 (47.27%), Postives = 64/110 (58.18%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGD---PGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            GP G+PG+ G +GE G++GP G  G IG PG  G  G+DG RG  G++G  G+   PG  G  G+ G+ G  GA GPRG  G  G  G  G  G PGP GP G KG+ G 
Sbjct:  931 GPPGHPGKEGPSGEKGNLGPHGPQGPIGYPGPRGVKGADGVRGLKGNKGEKGEDGFPGFKGDMGVKGDKGELGAAGPRGEDGPEGPKGRSGLPGDPGPLGPLGEKGKLGV 1040          

HSP 4 Score: 62.7734 bits (151), Expect = 4.774e-9
Identity = 42/89 (47.19%), Postives = 56/89 (62.92%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTG---DRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGE 4090
            GK+GP GE G  GP G QGP G    RG+KG  G++G+KG +G +G  G  G KG++G  G +G +G  GP+G  GP G +G  GL G+
Sbjct:  937 GKEGPSGEKGNLGPHGPQGPIGYPGPRGVKGADGVRGLKGNKGEKGEDGFPGFKGDMGVKGDKGELGAAGPRGEDGPEGPKGRSGLPGD 1025          

HSP 5 Score: 62.3882 bits (150), Expect = 6.145e-9
Identity = 52/105 (49.52%), Postives = 59/105 (56.19%), Query Frame = 2
Query: 2417 SGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTP------GARGNIGYRGFDGIPGPPGPNGA 2713
            SG  GE GE+G  G  GP G  G  G PG  G PGSDG RG  G  GP GD G DGL+G+ G  G +G  GP+G P      G RG+ G  G  G+PG PGP G 
Sbjct:  750 SGLKGESGESGPQGPRGPMGSAGPTGKPGRRGRPGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHRGETGPQGPPGPSGEDGERGDDGEVGPRGLPGEPGPRGV 854          

HSP 6 Score: 58.5362 bits (140), Expect = 9.551e-8
Identity = 61/154 (39.61%), Postives = 75/154 (48.70%), Query Frame = 2
Query: 3029 QGPNGPIGSPGLPGIQGSPGVPG---------DMGEHGPPG---------FKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGE---VGVPGLPGLQGEPGTK 3427
            +GP G  G PG+PG  G PG PG         ++G HGP G          KG +G RG  GN G++G  G PG  G  G KGD+G+ G  G  G                 G +GP G  G  G+ GP+GP+GE   +GVPGLPG  G  G K
Sbjct:  915 KGPTGKPGLPGMPGADGPPGHPGKEGPSGEKGNLGPHGPQGPIGYPGPRGVKGADGVRGLKGNKGEKGEDGFPGFKGDMGVKGDKGELGAAGPRGED---------------GPEGPKGRSGLPGDPGPLGPLGEKGKLGVPGLPGYPGRQGPK 1053          

HSP 7 Score: 57.3806 bits (137), Expect = 2.350e-7
Identity = 48/110 (43.64%), Postives = 59/110 (53.64%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGA---PGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            QGP GYPG RG  G  G  G  G  G  G    PG  GD G  G++G +G+ GP G+ G +G  G  G PG  G +GP G    +G +G  G  G PG  GP G++G QG
Sbjct:  954 QGPIGYPGPRGVKGADGVRGLKGNKGEKGEDGFPGFKGDMGVKGDKGELGAAGPRGEDGPEGPKGRSGLPGDPGPLGPLGE---KGKLGVPGLPGYPGRQGPKGSQGFQG 1060          

HSP 8 Score: 55.4546 bits (132), Expect = 8.166e-7
Identity = 42/87 (48.28%), Postives = 52/87 (59.77%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G+ G  G+PG  GP GE+G  G  G+ G  G QG KG +G +G QG  G KG  G++GK GP G+ GP G  G RG RG  G AG +
Sbjct: 1018 GRSGLPGDPGPLGPLGEKGKLGVPGLPGYPGRQGPKGSQGFQGFQGTSGEKGTRGTAGKPGPRGQRGPTGPRGERGPRGPTGKAGPK 1104          

HSP 9 Score: 52.7582 bits (125), Expect = 5.609e-6
Identity = 41/90 (45.56%), Postives = 53/90 (58.89%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGI---QGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G  GP G PG  GP GE+G  G  G +G +G    +G+KG +GVRG +G +G KGE G  G +G MG  G KG +G  G RG+ G  G +
Sbjct:  928 GADGPPGHPGKEGPSGEKGNLGPHGPQGPIGYPGPRGVKGADGVRGLKGNKGEKGEDGFPGFKGDMGVKGDKGELGAAGPRGEDGPEGPK 1017          
BLAST of Collagen F-8 vs. Ensembl Xenopus
Match: COL11A1 (collagen, type V, alpha 3 [Source:NCBI gene;Acc:733808])

HSP 1 Score: 150.984 bits (380), Expect = 1.126e-35
Identity = 73/239 (30.54%), Postives = 128/239 (53.56%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ ++  L++++ S++ PIGS+SNPAR C+D+ L +P++  G +WIDPN G   DS +V C F     +TC++  K+S    ++S+ K ENP  W+       L   +D  GN + ++      Q+ FL++L   A Q  T  C ++  +YDS+ K++D A+R    ND  I       ++           + D C  + +    +  +I+  K + LPI D+ + DFG+ NQK 
Sbjct: 1542 MEEIFGSLTSLKQDIESMKFPIGSQSNPARTCKDLQLCHPELPDGEYWIDPNQGCSGDSFKVYCNFTAGG-ETCINPDKKSEGVRISSWPK-ENPGSWFSEFKRGKLLSYVDIQGNAINQV------QMTFLKLLSQSARQNFTYTCQQSVAWYDSVGKHYDKALRFLGSNDEEISYDNSPYIRP----------LHDGCALK-KGFARTVLEINTLKIDQLPIADVMISDFGDQNQKF 1761          

HSP 2 Score: 93.2041 bits (230), Expect = 3.743e-18
Identity = 55/228 (24.12%), Postives = 94/228 (41.23%), Query Frame = 2
Query:  266 LFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCS----MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQG------YTGVIQDLFIVPGQEAAYRQCEIYTQDC 904
            L SL + ++T     +  R +   D+L+ ++    P  +    G C+      GS   + V   A L + +  +F        FS+LLT K  +     + S+ +      L  +IG   +  + +  G     ++       + D  WHRVA+SV    + + VDC+    +PL R    I+ +  + + G        + G IQ L I    +AAY  CE +  DC
Sbjct:   19 LSSLVLITLTFLYQAAEVRGAGPVDVLKSLEFHSLPEGVSKTAGFCTNRRAAKGSDTAFRVQKHAQLSIPTKKLFPGGVFPKDFSVLLTVKPKKGLQSFLLSIYNDQKVQQLGVEIGSSPIFQYEDHNGKPAPKDYPMFSSVNIADGKWHRVAISVEKKTVTIIVDCKKKATLPLPRSDKPIVYTNGIVVFGTSLLEEDVFEGDIQQLLISDDSKAAYDYCEHFMPDC 246          

HSP 3 Score: 57.3806 bits (137), Expect = 2.852e-7
Identity = 45/97 (46.39%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGL---------KGEIGSSGKEGPMGE---DGPKGAIGPRGQRGDPGLAG 4087
            G+ GP G  G SGP GE GPTG  G KG +G+ G+ G  G +GP+G  G          KG  G +GK GP G+    GP+GA GPRG  G PG  G
Sbjct:  774 GEDGPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFAGANGEKGARGVAGKPGPRGQRGPTGPRGARGPRGPTGKPGPKG 870          

HSP 4 Score: 57.3806 bits (137), Expect = 3.000e-7
Identity = 48/103 (46.60%), Postives = 52/103 (50.49%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            GP G  G  G  GEPG  G  G+      PG  G PG  G  G  G +GP G PG  GL+G DG PG  G  GP G  GA G  G +G  G PGP G  GA G
Sbjct:  639 GPQGPKGNMGPQGEPGPAGQQGI------PGPQGLPGPQGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADG 735          

HSP 5 Score: 56.9954 bits (136), Expect = 3.797e-7
Identity = 49/127 (38.58%), Postives = 58/127 (45.67%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGER------------------------GSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            GP G+PG+ G  GE G++GPTG  G IG PG  G  G+DG R                        G  G  GP G  G+DG  G  G  G  G  GP G  G +G +G  G  G PG  GP G+ G
Sbjct:  696 GPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTG 822          

HSP 6 Score: 56.6102 bits (135), Expect = 5.834e-7
Identity = 51/122 (41.80%), Postives = 59/122 (48.36%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDG---------------NPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            QG  G PGE+G  G+PG  G  G  G  G PG  G PG  G  G  G +GP G PG  G+ G DG                PG KG +G +G  G  G +G RG DG  GP G +G  GE G
Sbjct:  671 QGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESG 792          

HSP 7 Score: 54.6842 bits (130), Expect = 1.849e-6
Identity = 49/109 (44.95%), Postives = 54/109 (49.54%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            N GP G PG  G+ G PG  G  G  GSIG PG  G  G  G  G  G+ GP G PGK      +G PG KGA+GP    G +G IGY         PGP G KG  G 
Sbjct:  646 NMGPQGEPGPAGQQGIPGPQGLPGPQGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGK------EGPPGEKGALGPT---GPQGPIGY---------PGPRGVKGADGV 736          

HSP 8 Score: 54.6842 bits (130), Expect = 2.012e-6
Identity = 49/109 (44.95%), Postives = 58/109 (53.21%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQG---PTGDRGIKGGVGIQGMKGVEGVR---------------GPQGPQGLKGEIGSSGKEGPMGEDGP---KGAIGPRGQRGDPGLAGER 4093
             G  GP G PG  GP GE+G   PTG +G  G  G +G+KG +GVR               G +G  GLKG+ G  G  GP GEDGP   KG  GP G+ G  GLAGE+
Sbjct:  692 AGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESGPTGLAGEK 800          

HSP 9 Score: 53.1434 bits (126), Expect = 5.714e-6
Identity = 43/87 (49.43%), Postives = 49/87 (56.32%), Query Frame = 2
Query: 2447 GEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPN 2707
            G PG +G TG  G +GAPG+ G  G  G+ G  G RG  G  G  G SG  G  GA GA   RG PG  G+ G RGFDG+PG PG  
Sbjct:  495 GPPGPMGLTGRSGPVGAPGAAGIKGDPGDPGPQGPRGIQGTLGSMGKSGKRGRSGADGA---RGMPGEPGSKGDRGFDGLPGLPGEK 578          

HSP 10 Score: 52.373 bits (124), Expect = 9.470e-6
Identity = 43/95 (45.26%), Postives = 49/95 (51.58%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP 2695
            GP G  G  G +GE G  G  G  G +G PG  G PG  G +GS G  G  G  G+ G  G+ G PG +G  GP G  GARG    RG  G PGP
Sbjct:  777 GPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFAGANGEKGARGVAGKPGPRGQRGPTGPRGARGP---RGPTGKPGP 868          
BLAST of Collagen F-8 vs. Ensembl Xenopus
Match: COL11A1 (collagen, type V, alpha 3 [Source:NCBI gene;Acc:733808])

HSP 1 Score: 150.599 bits (379), Expect = 1.189e-35
Identity = 73/239 (30.54%), Postives = 128/239 (53.56%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ ++  L++++ S++ PIGS+SNPAR C+D+ L +P++  G +WIDPN G   DS +V C F     +TC++  K+S    ++S+ K ENP  W+       L   +D  GN + ++      Q+ FL++L   A Q  T  C ++  +YDS+ K++D A+R    ND  I       ++           + D C  + +    +  +I+  K + LPI D+ + DFG+ NQK 
Sbjct: 1553 MEEIFGSLTSLKQDIESMKFPIGSQSNPARTCKDLQLCHPELPDGEYWIDPNQGCSGDSFKVYCNFTAGG-ETCINPDKKSEGVRISSWPK-ENPGSWFSEFKRGKLLSYVDIQGNAINQV------QMTFLKLLSQSARQNFTYTCQQSVAWYDSVGKHYDKALRFLGSNDEEISYDNSPYIRP----------LHDGCALK-KGFARTVLEINTLKIDQLPIADVMISDFGDQNQKF 1772          

HSP 2 Score: 93.5893 bits (231), Expect = 3.141e-18
Identity = 59/248 (23.79%), Postives = 104/248 (41.94%), Query Frame = 2
Query:  266 LFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCS----MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQG------YTGVIQDLFIVPGQEAAYRQCEIYTQDCPG-LHDIMMNQQP--DDSNT 955
            L SL + ++T     +  R +   D+L+ ++    P  +    G C+      GS   + V   A L + +  +F        FS+LLT K  +     + S+ +      L  +IG   +  + +  G     ++       + D  WHRVA+SV    + + VDC+    +PL R    I+ +  + + G        + G IQ L I    +AAY  CE +  DC   + ++   Q+P  D++N 
Sbjct:   19 LSSLVLITLTFLYQAAEVRGAGPVDVLKSLEFHSLPEGVSKTAGFCTNRRAAKGSDTAFRVQKHAQLSIPTKKLFPGGVFPKDFSVLLTVKPKKGLQSFLLSIYNDQKVQQLGVEIGSSPIFQYEDHNGKPAPKDYPMFSSVNIADGKWHRVAISVEKKTVTIIVDCKKKATLPLPRSDKPIVYTNGIVVFGTSLLEEDVFEGDIQQLLISDDSKAAYDYCEHFMPDCDAPVPNLPQAQEPQVDEANV 266          

HSP 3 Score: 57.3806 bits (137), Expect = 3.105e-7
Identity = 48/103 (46.60%), Postives = 52/103 (50.49%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            GP G  G  G  GEPG  G  G+      PG  G PG  G  G  G +GP G PG  GL+G DG PG  G  GP G  GA G  G +G  G PGP G  GA G
Sbjct:  650 GPQGPKGNMGPQGEPGPAGQQGI------PGPQGLPGPQGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADG 746          

HSP 4 Score: 57.3806 bits (137), Expect = 3.185e-7
Identity = 45/97 (46.39%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGL---------KGEIGSSGKEGPMGE---DGPKGAIGPRGQRGDPGLAG 4087
            G+ GP G  G SGP GE GPTG  G KG +G+ G+ G  G +GP+G  G          KG  G +GK GP G+    GP+GA GPRG  G PG  G
Sbjct:  785 GEDGPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFAGANGEKGARGVAGKPGPRGQRGPTGPRGARGPRGPTGKPGPKG 881          

HSP 5 Score: 56.9954 bits (136), Expect = 4.135e-7
Identity = 49/127 (38.58%), Postives = 58/127 (45.67%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGER------------------------GSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            GP G+PG+ G  GE G++GPTG  G IG PG  G  G+DG R                        G  G  GP G  G+DG  G  G  G  G  GP G  G +G +G  G  G PG  GP G+ G
Sbjct:  707 GPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTG 833          

HSP 6 Score: 56.225 bits (134), Expect = 6.515e-7
Identity = 51/122 (41.80%), Postives = 59/122 (48.36%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDG---------------NPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            QG  G PGE+G  G+PG  G  G  G  G PG  G PG  G  G  G +GP G PG  G+ G DG                PG KG +G +G  G  G +G RG DG  GP G +G  GE G
Sbjct:  682 QGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESG 803          

HSP 7 Score: 54.6842 bits (130), Expect = 2.030e-6
Identity = 49/109 (44.95%), Postives = 54/109 (49.54%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            N GP G PG  G+ G PG  G  G  GSIG PG  G  G  G  G  G+ GP G PGK      +G PG KGA+GP    G +G IGY         PGP G KG  G 
Sbjct:  657 NMGPQGEPGPAGQQGIPGPQGLPGPQGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGK------EGPPGEKGALGPT---GPQGPIGY---------PGPRGVKGADGV 747          

HSP 8 Score: 54.299 bits (129), Expect = 2.304e-6
Identity = 49/109 (44.95%), Postives = 58/109 (53.21%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQG---PTGDRGIKGGVGIQGMKGVEGVR---------------GPQGPQGLKGEIGSSGKEGPMGEDGP---KGAIGPRGQRGDPGLAGER 4093
             G  GP G PG  GP GE+G   PTG +G  G  G +G+KG +GVR               G +G  GLKG+ G  G  GP GEDGP   KG  GP G+ G  GLAGE+
Sbjct:  703 AGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESGPTGLAGEK 811          

HSP 9 Score: 53.1434 bits (126), Expect = 5.816e-6
Identity = 43/87 (49.43%), Postives = 49/87 (56.32%), Query Frame = 2
Query: 2447 GEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPN 2707
            G PG +G TG  G +GAPG+ G  G  G+ G  G RG  G  G  G SG  G  GA GA   RG PG  G+ G RGFDG+PG PG  
Sbjct:  506 GPPGPMGLTGRSGPVGAPGAAGIKGDPGDPGPQGPRGIQGTLGSMGKSGKRGRSGADGA---RGMPGEPGSKGDRGFDGLPGLPGEK 589          
BLAST of Collagen F-8 vs. Ensembl Xenopus
Match: COL11A1 (collagen, type V, alpha 3 [Source:NCBI gene;Acc:733808])

HSP 1 Score: 150.214 bits (378), Expect = 1.540e-35
Identity = 73/239 (30.54%), Postives = 128/239 (53.56%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ ++  L++++ S++ PIGS+SNPAR C+D+ L +P++  G +WIDPN G   DS +V C F     +TC++  K+S    ++S+ K ENP  W+       L   +D  GN + ++      Q+ FL++L   A Q  T  C ++  +YDS+ K++D A+R    ND  I       ++           + D C  + +    +  +I+  K + LPI D+ + DFG+ NQK 
Sbjct: 1592 MEEIFGSLTSLKQDIESMKFPIGSQSNPARTCKDLQLCHPELPDGEYWIDPNQGCSGDSFKVYCNFTAGG-ETCINPDKKSEGVRISSWPK-ENPGSWFSEFKRGKLLSYVDIQGNAINQV------QMTFLKLLSQSARQNFTYTCQQSVAWYDSVGKHYDKALRFLGSNDEEISYDNSPYIRP----------LHDGCALK-KGFARTVLEINTLKIDQLPIADVMISDFGDQNQKF 1811          

HSP 2 Score: 92.4337 bits (228), Expect = 6.693e-18
Identity = 55/228 (24.12%), Postives = 94/228 (41.23%), Query Frame = 2
Query:  266 LFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCS----MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQG------YTGVIQDLFIVPGQEAAYRQCEIYTQDC 904
            L SL + ++T     +  R +   D+L+ ++    P  +    G C+      GS   + V   A L + +  +F        FS+LLT K  +     + S+ +      L  +IG   +  + +  G     ++       + D  WHRVA+SV    + + VDC+    +PL R    I+ +  + + G        + G IQ L I    +AAY  CE +  DC
Sbjct:   19 LSSLVLITLTFLYQAAEVRGAGPVDVLKSLEFHSLPEGVSKTAGFCTNRRAAKGSDTAFRVQKHAQLSIPTKKLFPGGVFPKDFSVLLTVKPKKGLQSFLLSIYNDQKVQQLGVEIGSSPIFQYEDHNGKPAPKDYPMFSSVNIADGKWHRVAISVEKKTVTIIVDCKKKATLPLPRSDKPIVYTNGIVVFGTSLLEEDVFEGDIQQLLISDDSKAAYDYCEHFMPDC 246          

HSP 3 Score: 57.3806 bits (137), Expect = 2.792e-7
Identity = 48/103 (46.60%), Postives = 52/103 (50.49%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            GP G  G  G  GEPG  G  G+      PG  G PG  G  G  G +GP G PG  GL+G DG PG  G  GP G  GA G  G +G  G PGP G  GA G
Sbjct:  689 GPQGPKGNMGPQGEPGPAGQQGI------PGPQGLPGPQGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADG 785          

HSP 4 Score: 57.3806 bits (137), Expect = 3.115e-7
Identity = 45/97 (46.39%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGL---------KGEIGSSGKEGPMGE---DGPKGAIGPRGQRGDPGLAG 4087
            G+ GP G  G SGP GE GPTG  G KG +G+ G+ G  G +GP+G  G          KG  G +GK GP G+    GP+GA GPRG  G PG  G
Sbjct:  824 GEDGPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFAGANGEKGARGVAGKPGPRGQRGPTGPRGARGPRGPTGKPGPKG 920          

HSP 5 Score: 57.3806 bits (137), Expect = 3.417e-7
Identity = 49/127 (38.58%), Postives = 58/127 (45.67%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGER------------------------GSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            GP G+PG+ G  GE G++GPTG  G IG PG  G  G+DG R                        G  G  GP G  G+DG  G  G  G  G  GP G  G +G +G  G  G PG  GP G+ G
Sbjct:  746 GPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTG 872          

HSP 6 Score: 56.6102 bits (135), Expect = 5.476e-7
Identity = 51/122 (41.80%), Postives = 59/122 (48.36%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDG---------------NPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            QG  G PGE+G  G+PG  G  G  G  G PG  G PG  G  G  G +GP G PG  G+ G DG                PG KG +G +G  G  G +G RG DG  GP G +G  GE G
Sbjct:  721 QGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESG 842          

HSP 7 Score: 54.6842 bits (130), Expect = 1.872e-6
Identity = 49/109 (44.95%), Postives = 54/109 (49.54%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            N GP G PG  G+ G PG  G  G  GSIG PG  G  G  G  G  G+ GP G PGK      +G PG KGA+GP    G +G IGY         PGP G KG  G 
Sbjct:  696 NMGPQGEPGPAGQQGIPGPQGLPGPQGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGK------EGPPGEKGALGPT---GPQGPIGY---------PGPRGVKGADGV 786          

HSP 8 Score: 54.6842 bits (130), Expect = 2.036e-6
Identity = 49/109 (44.95%), Postives = 58/109 (53.21%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQG---PTGDRGIKGGVGIQGMKGVEGVR---------------GPQGPQGLKGEIGSSGKEGPMGEDGP---KGAIGPRGQRGDPGLAGER 4093
             G  GP G PG  GP GE+G   PTG +G  G  G +G+KG +GVR               G +G  GLKG+ G  G  GP GEDGP   KG  GP G+ G  GLAGE+
Sbjct:  742 AGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESGPTGLAGEK 850          

HSP 9 Score: 53.5286 bits (127), Expect = 4.929e-6
Identity = 43/87 (49.43%), Postives = 49/87 (56.32%), Query Frame = 2
Query: 2447 GEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPN 2707
            G PG +G TG  G +GAPG+ G  G  G+ G  G RG  G  G  G SG  G  GA GA   RG PG  G+ G RGFDG+PG PG  
Sbjct:  545 GPPGPMGLTGRSGPVGAPGAAGIKGDPGDPGPQGPRGIQGTLGSMGKSGKRGRSGADGA---RGMPGEPGSKGDRGFDGLPGLPGEK 628          

HSP 10 Score: 52.373 bits (124), Expect = 9.913e-6
Identity = 43/95 (45.26%), Postives = 49/95 (51.58%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP 2695
            GP G  G  G +GE G  G  G  G +G PG  G PG  G +GS G  G  G  G+ G  G+ G PG +G  GP G  GARG    RG  G PGP
Sbjct:  827 GPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFAGANGEKGARGVAGKPGPRGQRGPTGPRGARGP---RGPTGKPGP 918          
BLAST of Collagen F-8 vs. Ensembl Xenopus
Match: COL11A1 (collagen, type V, alpha 3 [Source:NCBI gene;Acc:733808])

HSP 1 Score: 150.214 bits (378), Expect = 1.571e-35
Identity = 73/239 (30.54%), Postives = 128/239 (53.56%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ ++  L++++ S++ PIGS+SNPAR C+D+ L +P++  G +WIDPN G   DS +V C F     +TC++  K+S    ++S+ K ENP  W+       L   +D  GN + ++      Q+ FL++L   A Q  T  C ++  +YDS+ K++D A+R    ND  I       ++           + D C  + +    +  +I+  K + LPI D+ + DFG+ NQK 
Sbjct: 1603 MEEIFGSLTSLKQDIESMKFPIGSQSNPARTCKDLQLCHPELPDGEYWIDPNQGCSGDSFKVYCNFTAGG-ETCINPDKKSEGVRISSWPK-ENPGSWFSEFKRGKLLSYVDIQGNAINQV------QMTFLKLLSQSARQNFTYTCQQSVAWYDSVGKHYDKALRFLGSNDEEISYDNSPYIRP----------LHDGCALK-KGFARTVLEINTLKIDQLPIADVMISDFGDQNQKF 1822          

HSP 2 Score: 92.8189 bits (229), Expect = 4.666e-18
Identity = 55/228 (24.12%), Postives = 94/228 (41.23%), Query Frame = 2
Query:  266 LFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCS----MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQG------YTGVIQDLFIVPGQEAAYRQCEIYTQDC 904
            L SL + ++T     +  R +   D+L+ ++    P  +    G C+      GS   + V   A L + +  +F        FS+LLT K  +     + S+ +      L  +IG   +  + +  G     ++       + D  WHRVA+SV    + + VDC+    +PL R    I+ +  + + G        + G IQ L I    +AAY  CE +  DC
Sbjct:   19 LSSLVLITLTFLYQAAEVRGAGPVDVLKSLEFHSLPEGVSKTAGFCTNRRAAKGSDTAFRVQKHAQLSIPTKKLFPGGVFPKDFSVLLTVKPKKGLQSFLLSIYNDQKVQQLGVEIGSSPIFQYEDHNGKPAPKDYPMFSSVNIADGKWHRVAISVEKKTVTIIVDCKKKATLPLPRSDKPIVYTNGIVVFGTSLLEEDVFEGDIQQLLISDDSKAAYDYCEHFMPDC 246          

HSP 3 Score: 57.7658 bits (138), Expect = 2.382e-7
Identity = 48/103 (46.60%), Postives = 52/103 (50.49%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            GP G  G  G  GEPG  G  G+      PG  G PG  G  G  G +GP G PG  GL+G DG PG  G  GP G  GA G  G +G  G PGP G  GA G
Sbjct:  700 GPQGPKGNMGPQGEPGPAGQQGI------PGPQGLPGPQGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADG 796          

HSP 4 Score: 57.7658 bits (138), Expect = 2.613e-7
Identity = 45/97 (46.39%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGL---------KGEIGSSGKEGPMGE---DGPKGAIGPRGQRGDPGLAG 4087
            G+ GP G  G SGP GE GPTG  G KG +G+ G+ G  G +GP+G  G          KG  G +GK GP G+    GP+GA GPRG  G PG  G
Sbjct:  835 GEDGPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFAGANGEKGARGVAGKPGPRGQRGPTGPRGARGPRGPTGKPGPKG 931          

HSP 5 Score: 57.3806 bits (137), Expect = 2.964e-7
Identity = 49/127 (38.58%), Postives = 58/127 (45.67%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGER------------------------GSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            GP G+PG+ G  GE G++GPTG  G IG PG  G  G+DG R                        G  G  GP G  G+DG  G  G  G  G  GP G  G +G +G  G  G PG  GP G+ G
Sbjct:  757 GPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTG 883          

HSP 6 Score: 56.6102 bits (135), Expect = 4.790e-7
Identity = 51/122 (41.80%), Postives = 59/122 (48.36%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDG---------------NPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            QG  G PGE+G  G+PG  G  G  G  G PG  G PG  G  G  G +GP G PG  G+ G DG                PG KG +G +G  G  G +G RG DG  GP G +G  GE G
Sbjct:  732 QGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESG 853          

HSP 7 Score: 55.0694 bits (131), Expect = 1.693e-6
Identity = 49/109 (44.95%), Postives = 54/109 (49.54%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            N GP G PG  G+ G PG  G  G  GSIG PG  G  G  G  G  G+ GP G PGK      +G PG KGA+GP    G +G IGY         PGP G KG  G 
Sbjct:  707 NMGPQGEPGPAGQQGIPGPQGLPGPQGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGK------EGPPGEKGALGPT---GPQGPIGY---------PGPRGVKGADGV 797          

HSP 8 Score: 54.6842 bits (130), Expect = 1.811e-6
Identity = 49/109 (44.95%), Postives = 58/109 (53.21%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQG---PTGDRGIKGGVGIQGMKGVEGVR---------------GPQGPQGLKGEIGSSGKEGPMGEDGP---KGAIGPRGQRGDPGLAGER 4093
             G  GP G PG  GP GE+G   PTG +G  G  G +G+KG +GVR               G +G  GLKG+ G  G  GP GEDGP   KG  GP G+ G  GLAGE+
Sbjct:  753 AGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESGPTGLAGEK 861          

HSP 9 Score: 53.5286 bits (127), Expect = 4.459e-6
Identity = 43/87 (49.43%), Postives = 49/87 (56.32%), Query Frame = 2
Query: 2447 GEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPN 2707
            G PG +G TG  G +GAPG+ G  G  G+ G  G RG  G  G  G SG  G  GA GA   RG PG  G+ G RGFDG+PG PG  
Sbjct:  556 GPPGPMGLTGRSGPVGAPGAAGIKGDPGDPGPQGPRGIQGTLGSMGKSGKRGRSGADGA---RGMPGEPGSKGDRGFDGLPGLPGEK 639          

HSP 10 Score: 52.7582 bits (125), Expect = 8.313e-6
Identity = 43/95 (45.26%), Postives = 49/95 (51.58%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP 2695
            GP G  G  G +GE G  G  G  G +G PG  G PG  G +GS G  G  G  G+ G  G+ G PG +G  GP G  GARG    RG  G PGP
Sbjct:  838 GPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFAGANGEKGARGVAGKPGPRGQRGPTGPRGARGP---RGPTGKPGP 929          
BLAST of Collagen F-8 vs. Ensembl Xenopus
Match: COL11A1 (collagen, type V, alpha 3 [Source:NCBI gene;Acc:733808])

HSP 1 Score: 149.828 bits (377), Expect = 2.156e-35
Identity = 73/239 (30.54%), Postives = 128/239 (53.56%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ ++  L++++ S++ PIGS+SNPAR C+D+ L +P++  G +WIDPN G   DS +V C F     +TC++  K+S    ++S+ K ENP  W+       L   +D  GN + ++      Q+ FL++L   A Q  T  C ++  +YDS+ K++D A+R    ND  I       ++           + D C  + +    +  +I+  K + LPI D+ + DFG+ NQK 
Sbjct: 1642 MEEIFGSLTSLKQDIESMKFPIGSQSNPARTCKDLQLCHPELPDGEYWIDPNQGCSGDSFKVYCNFTAGG-ETCINPDKKSEGVRISSWPK-ENPGSWFSEFKRGKLLSYVDIQGNAINQV------QMTFLKLLSQSARQNFTYTCQQSVAWYDSVGKHYDKALRFLGSNDEEISYDNSPYIRP----------LHDGCALK-KGFARTVLEINTLKIDQLPIADVMISDFGDQNQKF 1861          

HSP 2 Score: 92.4337 bits (228), Expect = 6.303e-18
Identity = 55/228 (24.12%), Postives = 94/228 (41.23%), Query Frame = 2
Query:  266 LFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCS----MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQG------YTGVIQDLFIVPGQEAAYRQCEIYTQDC 904
            L SL + ++T     +  R +   D+L+ ++    P  +    G C+      GS   + V   A L + +  +F        FS+LLT K  +     + S+ +      L  +IG   +  + +  G     ++       + D  WHRVA+SV    + + VDC+    +PL R    I+ +  + + G        + G IQ L I    +AAY  CE +  DC
Sbjct:   19 LSSLVLITLTFLYQAAEVRGAGPVDVLKSLEFHSLPEGVSKTAGFCTNRRAAKGSDTAFRVQKHAQLSIPTKKLFPGGVFPKDFSVLLTVKPKKGLQSFLLSIYNDQKVQQLGVEIGSSPIFQYEDHNGKPAPKDYPMFSSVNIADGKWHRVAISVEKKTVTIIVDCKKKATLPLPRSDKPIVYTNGIVVFGTSLLEEDVFEGDIQQLLISDDSKAAYDYCEHFMPDC 246          

HSP 3 Score: 57.7658 bits (138), Expect = 2.105e-7
Identity = 48/103 (46.60%), Postives = 52/103 (50.49%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            GP G  G  G  GEPG  G  G+      PG  G PG  G  G  G +GP G PG  GL+G DG PG  G  GP G  GA G  G +G  G PGP G  GA G
Sbjct:  739 GPQGPKGNMGPQGEPGPAGQQGI------PGPQGLPGPQGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADG 835          

HSP 4 Score: 57.7658 bits (138), Expect = 2.310e-7
Identity = 45/97 (46.39%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGL---------KGEIGSSGKEGPMGE---DGPKGAIGPRGQRGDPGLAG 4087
            G+ GP G  G SGP GE GPTG  G KG +G+ G+ G  G +GP+G  G          KG  G +GK GP G+    GP+GA GPRG  G PG  G
Sbjct:  874 GEDGPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFAGANGEKGARGVAGKPGPRGQRGPTGPRGARGPRGPTGKPGPKG 970          

HSP 5 Score: 57.7658 bits (138), Expect = 2.620e-7
Identity = 49/127 (38.58%), Postives = 58/127 (45.67%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGER------------------------GSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            GP G+PG+ G  GE G++GPTG  G IG PG  G  G+DG R                        G  G  GP G  G+DG  G  G  G  G  GP G  G +G +G  G  G PG  GP G+ G
Sbjct:  796 GPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTG 922          

HSP 6 Score: 56.9954 bits (136), Expect = 4.306e-7
Identity = 51/122 (41.80%), Postives = 59/122 (48.36%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDG---------------NPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            QG  G PGE+G  G+PG  G  G  G  G PG  G PG  G  G  G +GP G PG  G+ G DG                PG KG +G +G  G  G +G RG DG  GP G +G  GE G
Sbjct:  771 QGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESG 892          

HSP 7 Score: 55.0694 bits (131), Expect = 1.484e-6
Identity = 49/109 (44.95%), Postives = 54/109 (49.54%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            N GP G PG  G+ G PG  G  G  GSIG PG  G  G  G  G  G+ GP G PGK      +G PG KGA+GP    G +G IGY         PGP G KG  G 
Sbjct:  746 NMGPQGEPGPAGQQGIPGPQGLPGPQGSIGPPGEKGPQGKPGLPGLAGADGPPGHPGK------EGPPGEKGALGPT---GPQGPIGY---------PGPRGVKGADGV 836          

HSP 8 Score: 55.0694 bits (131), Expect = 1.588e-6
Identity = 49/109 (44.95%), Postives = 58/109 (53.21%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQG---PTGDRGIKGGVGIQGMKGVEGVR---------------GPQGPQGLKGEIGSSGKEGPMGEDGP---KGAIGPRGQRGDPGLAGER 4093
             G  GP G PG  GP GE+G   PTG +G  G  G +G+KG +GVR               G +G  GLKG+ G  G  GP GEDGP   KG  GP G+ G  GLAGE+
Sbjct:  792 AGADGPPGHPGKEGPPGEKGALGPTGPQGPIGYPGPRGVKGADGVRGLKGGKGEKGEDGFPGFKGDMGLKGDRGEVGPLGPRGEDGPEGPKGRSGPSGESGPTGLAGEK 900          

HSP 9 Score: 53.9138 bits (128), Expect = 3.842e-6
Identity = 43/87 (49.43%), Postives = 49/87 (56.32%), Query Frame = 2
Query: 2447 GEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPN 2707
            G PG +G TG  G +GAPG+ G  G  G+ G  G RG  G  G  G SG  G  GA GA   RG PG  G+ G RGFDG+PG PG  
Sbjct:  595 GPPGPMGLTGRSGPVGAPGAAGIKGDPGDPGPQGPRGIQGTLGSMGKSGKRGRSGADGA---RGMPGEPGSKGDRGFDGLPGLPGEK 678          

HSP 10 Score: 52.7582 bits (125), Expect = 7.346e-6
Identity = 43/95 (45.26%), Postives = 49/95 (51.58%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP 2695
            GP G  G  G +GE G  G  G  G +G PG  G PG  G +GS G  G  G  G+ G  G+ G PG +G  GP G  GARG    RG  G PGP
Sbjct:  877 GPEGPKGRSGPSGESGPTGLAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFAGANGEKGARGVAGKPGPRGQRGPTGPRGARGP---RGPTGKPGP 968          
BLAST of Collagen F-8 vs. Ensembl Mouse
Match: Col11a1 (collagen, type XI, alpha 1 [Source:MGI Symbol;Acc:MGI:88446])

HSP 1 Score: 146.362 bits (368), Expect = 1.702e-34
Identity = 70/239 (29.29%), Postives = 128/239 (53.56%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L++++  ++ P+G+++NPAR C+D+ LS+P    G +WIDPN G   DS +V C F     +TC+   K+S    ++S+ K E P  W+       L   LD  GN +       M Q+ FL++L   A Q  T  C+++A +YD ++ ++D A+R    ND  +    +  +K+          + D C  R +    +  +I+  K + +PI+D+ + DFG+ NQK 
Sbjct: 1574 MEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTAGG-ETCIYPDKKSEGVRISSWPK-EKPGSWYSEFKRGKLLSYLDVEGNSIN------MVQMTFLKLLTASARQNFTYNCHQSAAWYDVLSGSYDKALRFLGSNDEEMSYENNPHIKA----------LYDGCASR-KGYEKTVIEINTPKIDQVPIIDVMINDFGDQNQKF 1793          

HSP 2 Score: 94.7449 bits (234), Expect = 1.090e-18
Identity = 61/254 (24.02%), Postives = 102/254 (40.16%), Query Frame = 2
Query:  224 IKPNNVFGMYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCS----MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTR------EIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQP 940
            ++P + +         +++  ++T        R ++  DIL+ +     P  I   TG C+         + Y V  EA +   +  +F        FSIL T K  + +   + S+ + +G   L  ++GR  V  F +  G      +       + D  WHRVA+SV    + + VDC+     PL R      + + I+V G   L    + G IQ   I    +AAY  C+ Y+ DC         Q+P
Sbjct:    1 MEPWSRWKTKRWIWDLTISTLALTFLFQAREVRGAAPVDILKALDFHNSPVGISKTTGFCTNRKNSKDPDVAYRVTEEAQISAPTKQLFPGGIFPQDFSILFTIKPKKGTQAFLLSLYNEHGIQQLGVEVGRSPVFLFEDHTGKPTPENYPLFSTVNIADGKWHRVAISVEKKTVTMIVDCKKKITKPLDRSERSIVDTNGIMVFGTRILETDVFQGDIQQFLITGDPKAAYDYCDHYSPDCDLTSKAAQAQEP 254          

HSP 3 Score: 58.9214 bits (141), Expect = 8.293e-8
Identity = 52/120 (43.33%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLS------GIDGNPGAKGAVGPRGT------PGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +G  G  GE+GE G PG  G  GL G  G  G  G  G DG  G  G  GPTGDPG  G +      G+ G PG  G  GP+G+      PGA G  G RG  G PGP G  G  G +G+
Sbjct:  769 RGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQVGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGIAGKPGPRGQRGPTGPRGS 888          

HSP 4 Score: 55.0694 bits (131), Expect = 1.227e-6
Identity = 44/95 (46.32%), Postives = 50/95 (52.63%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP 2695
            GP G  G  G TG+PG  G  G  G +G PG  G PG  G +GS G  G  G  G+ G  GI G PG +G  GP G    RG+ G RG  G PGP
Sbjct:  809 GPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGIAGKPGPRGQRGPTG---PRGSRGARGPTGKPGP 900          

HSP 5 Score: 53.9138 bits (128), Expect = 2.447e-6
Identity = 44/92 (47.83%), Postives = 50/92 (54.35%), Query Frame = 2
Query: 3827 SMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAI---GPRGQRGDPGLAGER 4093
             +G+ GP GE G  GP+G  GPTGD G  G  G +G  GV G+ G  G QG KG  G  G  G  GE G +G     GPRGQRG  G  G R
Sbjct:  798 EVGQVGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGIAGKPGPRGQRGPTGPRGSR 889          

HSP 6 Score: 53.1434 bits (126), Expect = 4.679e-6
Identity = 40/96 (41.67%), Postives = 52/96 (54.17%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGL---------KGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G+ GP G  G +GP G+ GP+G  G KG +G+ G+ G  G +GP+G  G          KG  G +GK GP G+ GP G  G RG RG  G  G +
Sbjct:  806 GEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGIAGKPGPRGQRGPTGPRGSRGARGPTGKPGPK 901          

HSP 7 Score: 52.7582 bits (125), Expect = 5.399e-6
Identity = 49/125 (39.20%), Postives = 63/125 (50.40%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGS---RGPTGDPGKD---------------GLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP------PGPNGAKGE 2722
            G PGE+G  G  G  G  G +G  G  G  G PG DG++G IG    +G  GD G++               G++G DG PG +G    +G  G +G+ G RGF G+PGP      PGP G KGE
Sbjct: 1088 GAPGEKGPQGPAGRDGVQGPVGLPGPAGPAGSPGEDGDKGEIGEPGQKGSKGDKGENGPPGPPGLQGPVGAPGIAGGDGEPGPRGQ---QGMFGQKGDEGARGFPGLPGPIGLQGLPGPPGEKGE 1209          
BLAST of Collagen F-8 vs. Ensembl Mouse
Match: Col5a1 (collagen, type V, alpha 1 [Source:MGI Symbol;Acc:MGI:88457])

HSP 1 Score: 138.272 bits (347), Expect = 5.233e-32
Identity = 70/239 (29.29%), Postives = 119/239 (49.79%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L+  +  ++RP+G++ NPAR C+D+ L +P    G +W+DPN G   DS +V C F      TCV   K+S    +TS+ K ENP  W+       L   +D  GN +  +      Q+ FL++L   A Q VT  C ++  + D+   ++D AIR    ND  +    +  +++          + D C  + +    +  +I   K E +PIVDI   DFG  +QK 
Sbjct: 1608 MEEIFGSLNSLKLEIEQMKRPLGTQQNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGG-STCVFPDKKSEGARITSWPK-ENPGSWFSEFKRGKLLSYVDAEGNPVGVV------QMTFLRLLSASAHQNVTYNCYQSVAWQDAATGSYDKAIRFLGSNDEEMSYDNNPYIRA----------LVDGCATK-KGYQKTVLEIDTPKVEQVPIVDIMFNDFGEASQKF 1827          

HSP 2 Score: 94.7449 bits (234), Expect = 1.060e-18
Identity = 60/225 (26.67%), Postives = 97/225 (43.11%), Query Frame = 2
Query:  317 NRTSSHGDILQFIKIAQRPF-IQTQTGMCSMPGSK----LGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFK----TQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTR------EIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDC-PGLHDIMMNQQPD 943
            +R +   D+L+ +     P  +   TG C+   S     + Y V  +A L + +  ++        FSIL T K  + S   + S+ +  G   L  ++GR  V  + +  G     E+       L D  WHR+ALSV    + L +DC+      L+R      + + I++ G   L  + + G IQ L  V    AAY  CE Y+ DC   + D   +Q P+
Sbjct:   34 SRAAQPADLLEMLDFHNLPSGVTKTTGFCATRRSSSEPDVAYRVSKDAQLSMPTKQLYPESGFPEDFSILTTVKAKKGSQAFLVSIYNEQGIQQLGLELGRSPVFLYEDHTGKPGPEEYPLFPGINLSDGKWHRIALSVYKKNVTLILDCKKKITKFLSRSDHPIIDTNGIVMFGSRILDDEIFEGDIQQLLFVSDNRAAYDYCEHYSPDCDTAVPDTPQSQDPN 258          

HSP 3 Score: 59.6918 bits (143), Expect = 4.170e-8
Identity = 46/95 (48.42%), Postives = 51/95 (53.68%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP 2695
            GP G  G  G  G+PG +GPTG  G +G PG  G PG  G +GSIG     G PG +G  G  G PG  G  G RG  G RG  G RG  G PGP
Sbjct:  841 GPEGPKGRGGPNGDPGPLGPTGEKGKLGVPGLPGYPGRQGPKGSIGF---PGFPGANGEKGGRGTPGKPGPRGQRGPTGPRGERGPRGITGKPGP 932          

HSP 4 Score: 55.8398 bits (133), Expect = 6.710e-7
Identity = 93/276 (33.70%), Postives = 110/276 (39.86%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDP------------GKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNIGLDGDFGPIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMGPQGPNGPIGSPGLPGI------QGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQG 3178
            N G  G PG +G  G PG  GP G  G  G PG+ G PG  G+ G  G +G  G P            G  G  GI G  G KG  G  G PG +G++G +G  G  GPPGP G  G +G                                        KG  G +GD GP+G T                           G  G  G PG  G+ G QGP G IG PG PG       +G+PG PG  G+ GP G +G  G RG TG PG +G
Sbjct:  725 NPGAQGLPGPQGAIGPPGEKGPLGKPGLPGMPGADGPPGHPGKEGPPGEKGGQGPPGPQGPIGYPGPRGVKGADGIRGLKGTKGEKGEDGFPGFKGDMGIKGDRGEIGPPGPRGEDGPEGP---------------------------------------KGRGGPNGDPGPLGPT---------------------------GEKGKLGVPGLPGYPGRQGPKGSIGFPGFPGANGEKGGRGTPGKPGPRGQRGPTGPRGERGPRGITGKPGPKG 934          

HSP 5 Score: 52.373 bits (124), Expect = 7.972e-6
Identity = 45/92 (48.91%), Postives = 50/92 (54.35%), Query Frame = 2
Query: 3827 SMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGA---IGPRGQRGDPGLAGER 4093
             +G  GP GE G  GP+G  GP GD G  G  G +G  GV G+ G  G QG KG IG  G  G  GE G +G     GPRGQRG  G  GER
Sbjct:  830 EIGPPGPRGEDGPEGPKGRGGPNGDPGPLGPTGEKGKLGVPGLPGYPGRQGPKGSIGFPGFPGANGEKGGRGTPGKPGPRGQRGPTGPRGER 921          
BLAST of Collagen F-8 vs. Ensembl Mouse
Match: Col5a2 (collagen, type V, alpha 2 [Source:MGI Symbol;Acc:MGI:88458])

HSP 1 Score: 134.42 bits (337), Expect = 7.053e-31
Identity = 78/257 (30.35%), Postives = 120/257 (46.69%), Query Frame = 2
Query: 4304 LENPEIPKDTN----GIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQN-GNKMRKIKY----CPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
             E+   P DTN    GI   LK L S I+       +++ P GSK +PAR C D+ L +P   SG +WIDPN GS  D+I+V C    E+ +TC+SA   S  +      K+ + +  W    LD N G++     Y      ++Q+ FL++L  +A Q +T +C     Y D   KN   A+ ++  N        D ++K E         ++D C  R      + F+   +    LPI+D+   D GN +Q+ 
Sbjct: 1250 TEDQAAPDDTNKTDPGIHVTLKSLSSQIE-------TMRSPDGSKKHPARTCDDLKLCHPTKQSGEYWIDPNQGSAEDAIKVYCNM--ETGETCISANPASVPRKTWWASKSPDNKPVWYG--LDMNRGSQFTYGDYQSPNTAITQMTFLRLLSKEASQNLTYICRNTVGYMDDQAKNLKKAVVLKGSN--------DLEIKGEGNIRFRYTVLQDTCSKRNGNVGKTIFEYRTQNVARLPIIDVGPVDIGNADQEF 1487          

HSP 2 Score: 68.5514 bits (166), Expect = 8.266e-11
Identity = 59/123 (47.97%), Postives = 71/123 (57.72%), Query Frame = 2
Query: 2408 QGPSGYPGE---RGETGEPGSVGPTGLIGSIGAPGSTGDPGSD---------GERGSIGSRGPT---GDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            QGP G PGE   RG  G+PG+VGP G +G  GAPG+ G PGSD         GERG +GS GP    GDPG+ G  G+ G  G  G  G +G  G  G +G  G DG PGPPG  G +G+ G+
Sbjct:  489 QGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGS 611          

HSP 3 Score: 60.077 bits (144), Expect = 3.153e-8
Identity = 41/83 (49.40%), Postives = 49/83 (59.04%), Query Frame = 2
Query: 2429 GERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGF 2677
            GERG+ G+PG  G  G  G+ G PG  G PG  G+RG  GSRGP G PG+ G  G+ G  G +G  G  G  G RG  G+RGF
Sbjct: 1063 GERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGEPGSRGPVGPPGRAGKRGLPGPQGPRGDKGDNGDRGDRGQKGHRGF 1145          

HSP 4 Score: 58.9214 bits (141), Expect = 7.141e-8
Identity = 133/348 (38.22%), Postives = 160/348 (45.98%), Query Frame = 2
Query: 1715 TGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQG------VKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGGRGIAGLKXXXXXXXXXXXXXXXXEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDXXXXXXXXXXXXXXXXXXXXLKGDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGD---PGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +G  G RG  G+PG+PG  G  G+ G++G +G       KG++G  G  G  G  G RG  GERG+    GP+G  GK G                                G PG  GP+G  GI G  G  G  G  G +GP G +GP GP G RG  G  G  G +G  G +G               + G  G KG  G  G  GPPG  G  GS GP G  G  G  G  G+ G  G+ GE G  GEP   GP G+ G IG PG  G  G  G+ G++G  GP G+   PG  G  G DG PG KGA G RG  G+ G  G +G  G PG PG  GA+G  G 
Sbjct:  279 SGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEIGAPGAKGEAGPTGPMGAMGPLGPRGMPGERGR---LGPQGAPGKRG------------------------------AHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGPTGARGPEGPQGQRGETGPPGPAGSQGLPGAVG---------------TDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGEP---GPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGN 575          

HSP 5 Score: 56.9954 bits (136), Expect = 2.798e-7
Identity = 54/135 (40.00%), Postives = 64/135 (47.41%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGL------------------IGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGP------RGTPGARGNI---GYRGFDGIPGPPGPNGAKGEQG 2728
             +G  G PG  G  G PG VGPTG                   +G  G  G  G+ G+ G  G++G RG  GDPG  GL G  G PG  G VG       RG PG+RG +   G  G  G+PGP GP G KG+ G
Sbjct:  998 QRGERGMPGLPGPAGTPGKVGPTGATGDKGPPGPVGPPGSNGPVGEPGPEGPAGNDGTPGRDGAVGERGDRGDPGPAGLPGSQGAPGTPGPVGAPGDAGQRGEPGSRGPVGPPGRAGKRGLPGPQGPRGDKGDNG 1132          

HSP 6 Score: 55.4546 bits (132), Expect = 9.028e-7
Identity = 52/113 (46.02%), Postives = 61/113 (53.98%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGD---PGKDGLSGIDGNPGAKGAVGPRGTPGARGNI------GYRGFDGIPGPPGPNGAKGEQGT 2731
            G PG  G TGE   VG +G  G+ G PG+ G PG  G RG  G  GP G+   PG  G +G  G  GA G +GPRG PG RG +      G RG  G+PG PGP G  G  G+
Sbjct:  265 GEPGRNGNTGE---VGFSGSPGARGFPGAPGLPGLKGHRGHKGLEGPKGEIGAPGAKGEAGPTGPMGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMPGKPGPMGPLGIPGS 374          

HSP 7 Score: 53.9138 bits (128), Expect = 2.320e-6
Identity = 51/133 (38.35%), Postives = 62/133 (46.62%), Query Frame = 2
Query: 3023 GPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPG 3421
            GP G +GP G  G PG  G PG+PG  G  G PG +GPEG  G  G PG+ G PG PG +G +G+ G                                  MGL G KG +G +G  GE G  G+PG +G PG
Sbjct:  544 GPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGS---------------------------------MGLPGPKGSSGDLGKPGEAGNAGVPGQRGAPG 643          

HSP 8 Score: 53.5286 bits (127), Expect = 3.751e-6
Identity = 56/159 (35.22%), Postives = 70/159 (44.03%), Query Frame = 2
Query: 3023 GPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGST------------------------GNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTK 3427
            GP+GP G  G  G PG  GS G+PG +G  G PG KGP G+ G++                        G  GD G+PG  GE GP+GE G                             G+QGP+G  GE+G+ GP G  G VG PG  G +G PG +
Sbjct:  394 GPEGPQGQRGETGPPGPAGSQGLPGAVGTDGTPGAKGPTGSAGTSGPPGLAGPPGSPGPQGSTGPQGIRGQSGDPGVPGFKGEAGPKGEPGPH---------------------------GIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNR 525          

HSP 9 Score: 52.7582 bits (125), Expect = 4.954e-6
Identity = 62/138 (44.93%), Postives = 79/138 (57.25%), Query Frame = 2
Query: 3029 QGPNGPIGSPGLPGIQGSPGVPGDMGEHGP---PGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLP---GLQGEPGT 3424
            +G  GP G PG  GIQG  G PG+ G+ GP   PG  GP G  G  G PG++G PG  G  GP+G +G+RG  G  G  G  G  G  G PG  G  G+ G  G+ G +G+ GP+G  GE G PG P   G++G+PG+
Sbjct:  474 KGEAGPKGEPGPHGIQGPIGPPGEEGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGARGLTGNPGVQGPEGKLGPLGAPGEDGRPGPPGSIGIRGQPGS 611          

HSP 10 Score: 52.7582 bits (125), Expect = 5.574e-6
Identity = 41/87 (47.13%), Postives = 51/87 (58.62%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G QGP+G PG    +G++GP GD G  G  G  G +G  G RG  G  GL G  G+ G+ GP+G  GPKG  G  G+ G+PGL G R
Sbjct:  487 GIQGPIGPPGE---EGKRGPRGDPGTVGPPGPMGERGAPGNRGFPGSDGLPGPKGAQGERGPVGSSGPKGGQGDPGRPGEPGLPGAR 570          

HSP 11 Score: 52.373 bits (124), Expect = 8.076e-6
Identity = 52/136 (38.24%), Postives = 58/136 (42.65%), Query Frame = 2
Query: 3020 MGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTK 3427
            MG  GP GP G PG  G  G  G PG  G HG PG  GP G  G  G+ G  G PG+ GE GP                                  G +GP G  G++GE GP GP G  G+PG  G  G PG K
Sbjct:  327 MGAMGPLGPRGMPGERGRLGPQGAPGKRGAHGMPGKPGPMGPLGIPGSSGFPGNPGMKGEAGP---------------------------------TGARGPEGPQGQRGETGPPGPAGSQGLPGAVGTDGTPGAK 429          

HSP 12 Score: 51.9878 bits (123), Expect = 8.567e-6
Identity = 45/103 (43.69%), Postives = 53/103 (51.46%), Query Frame = 2
Query: 2432 ERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDG---ERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            ++G  GEPG+VGP G  G  G PG  G+PG  G   E+G  G  GP          G  GNPG  G +G  G PG +G  G RG  G PGP G  G  GE+G 
Sbjct:  692 DQGVPGEPGAVGPLGPRGERGNPGERGEPGITGLPGEKGMAGGHGP---------DGPKGNPGPTGTIGDTGPPGLQGMPGERGIAGTPGPKGDRGGIGEKGA 785          
BLAST of Collagen F-8 vs. Ensembl Mouse
Match: Col5a1 (collagen, type V, alpha 1 [Source:MGI Symbol;Acc:MGI:88457])

HSP 1 Score: 125.561 bits (314), Expect = 2.097e-30
Identity = 70/239 (29.29%), Postives = 119/239 (49.79%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L+  +  ++RP+G++ NPAR C+D+ L +P    G +W+DPN G   DS +V C F      TCV   K+S    +TS+ K ENP  W+       L   +D  GN +  +      Q+ FL++L   A Q VT  C ++  + D+   ++D AIR    ND  +    +  +++          + D C  + +    +  +I   K E +PIVDI   DFG  +QK 
Sbjct:  119 MEEIFGSLNSLKLEIEQMKRPLGTQQNPARTCKDLQLCHPDFPDGEYWVDPNQGCSRDSFKVYCNFTAGG-STCVFPDKKSEGARITSWPK-ENPGSWFSEFKRGKLLSYVDAEGNPVGVV------QMTFLRLLSASAHQNVTYNCYQSVAWQDAATGSYDKAIRFLGSNDEEMSYDNNPYIRA----------LVDGCATK-KGYQKTVLEIDTPKVEQVPIVDIMFNDFGEASQKF 338          
BLAST of Collagen F-8 vs. Ensembl Mouse
Match: Col2a1 (collagen, type II, alpha 1 [Source:MGI Symbol;Acc:MGI:88452])

HSP 1 Score: 130.568 bits (327), Expect = 9.609e-30
Identity = 67/245 (27.35%), Postives = 113/245 (46.12%), Query Frame = 2
Query: 4346 SILKKLYSNIDKLEKNMN----SIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILD-------QNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            S L++    +D   K++N    SI+ P GS+ NPAR C+D+ L +P+  SG++WIDPN G   D+++V C    E+ +TCV     +  +      K++  +  W  E ++        +GN           Q+ FL++L T+  Q +T  C  +  Y D    N   A+ ++  N        D ++++E  S      +KD C         +  +  ++KT  LPI+DI   D G   Q+ 
Sbjct: 1178 STLRQHDVEVDATLKSLNNQIESIRSPDGSRKNPARTCQDLKLCHPEWKSGDYWIDPNQGCTLDAMKVFCNM--ETGETCVYPNPATVPRKNWWSSKSKEKKHIWFGETMNGGFHFSYGDGNLAPNTANV---QMTFLRLLSTEGSQNITYHCKNSIAYLDEAAGNLKKALLIQGSN--------DVEMRAEGNSRFTYTALKDGCTKHTGKWGKTVIEYRSQKTSRLPIIDIAPMDIGGAEQEF 1409          

HSP 2 Score: 58.5362 bits (140), Expect = 1.033e-7
Identity = 43/89 (48.31%), Postives = 51/89 (57.30%), Query Frame = 2
Query: 2465 GPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            GP G+ G  G PG  GDPG  G  G+ G +G   +PG DG SG+DG PG +G  G RG  G  G  G RGF G+PGP G  G +G  G 
Sbjct:  859 GPKGVRGDSGPPGRAGDPGLQGPAGAPGEKG---EPGDDGPSGLDGPPGPQGLAGQRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPGA 944          

HSP 3 Score: 57.3806 bits (137), Expect = 2.482e-7
Identity = 43/92 (46.74%), Postives = 55/92 (59.78%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGS---RGPTGDPGKDGLSGIDGNPGAKGAVGPRGT---PGARGNI 2662
            + G  G PGERGETG PG  G  G  G+ G PG+ GD G  G++G  G+   +GP+G PG  G +G+ G  GA+GA GP G    PGA G +
Sbjct:  746 STGARGAPGERGETGPPGPAGFAGPPGADGQPGAKGDQGEAGQKGDAGAPGPQGPSGAPGPQGPTGVTGPKGARGAQGPPGATGFPGAAGRV 837          
BLAST of Collagen F-8 vs. UniProt/SwissProt
Match: sp|Q61245|COBA1_MOUSE (Collagen alpha-1(XI) chain OS=Mus musculus OX=10090 GN=Col11a1 PE=1 SV=2)

HSP 1 Score: 146.362 bits (368), Expect = 1.191e-33
Identity = 70/239 (29.29%), Postives = 128/239 (53.56%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L++++  ++ P+G+++NPAR C+D+ LS+P    G +WIDPN G   DS +V C F     +TC+   K+S    ++S+ K E P  W+       L   LD  GN +       M Q+ FL++L   A Q  T  C+++A +YD ++ ++D A+R    ND  +    +  +K+          + D C  R +    +  +I+  K + +PI+D+ + DFG+ NQK 
Sbjct: 1574 MEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTAGG-ETCIYPDKKSEGVRISSWPK-EKPGSWYSEFKRGKLLSYLDVEGNSIN------MVQMTFLKLLTASARQNFTYNCHQSAAWYDVLSGSYDKALRFLGSNDEEMSYENNPHIKA----------LYDGCASR-KGYEKTVIEINTPKIDQVPIIDVMINDFGDQNQKF 1793          

HSP 2 Score: 94.7449 bits (234), Expect = 7.624e-18
Identity = 61/254 (24.02%), Postives = 102/254 (40.16%), Query Frame = 2
Query:  224 IKPNNVFGMYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCS----MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTR------EIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQP 940
            ++P + +         +++  ++T        R ++  DIL+ +     P  I   TG C+         + Y V  EA +   +  +F        FSIL T K  + +   + S+ + +G   L  ++GR  V  F +  G      +       + D  WHRVA+SV    + + VDC+     PL R      + + I+V G   L    + G IQ   I    +AAY  C+ Y+ DC         Q+P
Sbjct:    1 MEPWSRWKTKRWIWDLTISTLALTFLFQAREVRGAAPVDILKALDFHNSPVGISKTTGFCTNRKNSKDPDVAYRVTEEAQISAPTKQLFPGGIFPQDFSILFTIKPKKGTQAFLLSLYNEHGIQQLGVEVGRSPVFLFEDHTGKPTPENYPLFSTVNIADGKWHRVAISVEKKTVTMIVDCKKKITKPLDRSERSIVDTNGIMVFGTRILETDVFQGDIQQFLITGDPKAAYDYCDHYSPDCDLTSKAAQAQEP 254          

HSP 3 Score: 58.9214 bits (141), Expect = 5.801e-7
Identity = 52/120 (43.33%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLS------GIDGNPGAKGAVGPRGT------PGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +G  G  GE+GE G PG  G  GL G  G  G  G  G DG  G  G  GPTGDPG  G +      G+ G PG  G  GP+G+      PGA G  G RG  G PGP G  G  G +G+
Sbjct:  769 RGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQVGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGIAGKPGPRGQRGPTGPRGS 888          

HSP 4 Score: 55.0694 bits (131), Expect = 8.583e-6
Identity = 44/95 (46.32%), Postives = 50/95 (52.63%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP 2695
            GP G  G  G TG+PG  G  G  G +G PG  G PG  G +GS G  G  G  G+ G  GI G PG +G  GP G    RG+ G RG  G PGP
Sbjct:  809 GPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGIAGKPGPRGQRGPTG---PRGSRGARGPTGKPGP 900          
BLAST of Collagen F-8 vs. UniProt/SwissProt
Match: sp|P20909|COBA1_RAT (Collagen alpha-1(XI) chain OS=Rattus norvegicus OX=10116 GN=Col11a1 PE=1 SV=2)

HSP 1 Score: 145.206 bits (365), Expect = 2.819e-33
Identity = 70/239 (29.29%), Postives = 127/239 (53.14%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L++++  ++ P+G+++NPAR C+D+ LS+P    G +WIDPN G   DS +V C F     +TC+   K+S    L+S+ K E P  W+       L   LD  GN +       M Q+ FL++L   A Q  T  C+++  +YD ++ ++D A+R    ND  +    +  +K+          + D C  R +    +  +I+  K + +PI+D+ + DFG+ NQK 
Sbjct: 1574 MEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNFTAGG-ETCIYPDKKSEGVRLSSWPK-EKPGSWYSEFKRGKLLSYLDVEGNSIN------MVQMTFLKLLTASARQNFTYNCHQSTAWYDVLSGSYDKALRFLGSNDEEMSYENNPHIKA----------LYDGCASR-KGYEKTVIEINTPKIDQVPIIDVMINDFGDQNQKF 1793          

HSP 2 Score: 94.3597 bits (233), Expect = 8.365e-18
Identity = 64/254 (25.20%), Postives = 103/254 (40.55%), Query Frame = 2
Query:  224 IKPNNVFGMYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMC-SMPGSK---LGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTR------EIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQP 940
            ++P + +         +++   +T        R ++  DIL+ +     P  I   TG C S   SK   + Y V  EA +   +  +F        FSIL T K  + +   + S+ + +G   L  ++GR  V  F +  G      +       + D  WHRVA+SV    + + VDC+     PL R      + + I+V G   L    + G IQ   I    +AAY  C+ Y+ DC         Q+P
Sbjct:    1 MEPWSRWKTKRWIWDLTISTLVLTFLFQAREVRGAAPVDILKALDFHNSPVGISKTTGFCTSRKNSKDPDIAYRVTEEAQISAPTKQLFPGGIFPQDFSILFTIKPKKGTQAFLLSLYNEHGIQQLGVEVGRSPVFLFEDHTGKPTPENYPLFSTVNIADGKWHRVAISVEKKTVTMIVDCKKKITKPLDRSERSIVDTNGIMVFGTRILETDVFQGDIQQFLITGDPKAAYDYCDHYSPDCDLTSKAAQAQEP 254          

HSP 3 Score: 59.3066 bits (142), Expect = 4.660e-7
Identity = 52/120 (43.33%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLS------GIDGNPGAKGAVGPRGT------PGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +G  G  GE+GE G PG  G  GL G  G  G  G  G DG  G  G  GPTGDPG  G +      G+ G PG  G  GP+G+      PGA G  G RG  G PGP G  G  G +G+
Sbjct:  769 RGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQVGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGIAGKPGPRGQRGPTGPRGS 888          

HSP 4 Score: 55.4546 bits (132), Expect = 7.012e-6
Identity = 44/95 (46.32%), Postives = 50/95 (52.63%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP 2695
            GP G  G  G TG+PG  G  G  G +G PG  G PG  G +GS G  G  G  G+ G  GI G PG +G  GP G    RG+ G RG  G PGP
Sbjct:  809 GPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGIAGKPGPRGQRGPTG---PRGSRGARGPTGKPGP 900          
BLAST of Collagen F-8 vs. UniProt/SwissProt
Match: sp|P12107|COBA1_HUMAN (Collagen alpha-1(XI) chain OS=Homo sapiens OX=9606 GN=COL11A1 PE=1 SV=4)

HSP 1 Score: 143.28 bits (360), Expect = 1.156e-32
Identity = 71/239 (29.71%), Postives = 127/239 (53.14%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L++++  ++ P+G+++NPAR C+D+ LS+P    G +WIDPN G   DS +V C F     +TC+   K+S    ++S+ K E P  W+       L   LD  GN +       M Q+ FL++L   A Q  T  C+++A +YD  + ++D A+R    ND  +    +  +K+          + D C  R +    +  +I+  K + +PIVD+ + DFG+ NQK 
Sbjct: 1576 MEEIFGSLNSLKQDIEHMKFPMGTQTNPARTCKDLQLSHPDFPDGEYWIDPNQGCSGDSFKVYCNF-TSGGETCIYPDKKSEGVRISSWPK-EKPGSWFSEFKRGKLLSYLDVEGNSIN------MVQMTFLKLLTASARQNFTYHCHQSAAWYDVSSGSYDKALRFLGSNDEEMSYDNNPFIKT----------LYDGCASR-KGYEKTVIEINTPKIDQVPIVDVMINDFGDQNQKF 1795          

HSP 2 Score: 98.2117 bits (243), Expect = 6.451e-19
Identity = 60/227 (26.43%), Postives = 95/227 (41.85%), Query Frame = 2
Query:  269 FSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCS----MPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEF----KTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTR------EIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDC 904
            F++   ++T        R ++  D+L+ +     P  I   TG C+      GS   Y V  +A L   +  +F        FSIL T K  +     + S+ + +G   +  ++GR  V  F +  G     ++       + D  WHRVA+SV    + + VDC+     PL R      + + I V G   L  + + G IQ   I    +AAY  CE Y+ DC
Sbjct:   17 FTVTTLALTFLFQAREVRGAAPVDVLKALDFHNSPEGISKTTGFCTNRKNSKGSDTAYRVSKQAQLSAPTKQLFPGGTFPEDFSILFTVKPKKGIQSFLLSIYNEHGIQQIGVEVGRSPVFLFEDHTGKPAPEDYPLFRTVNIADGKWHRVAISVEKKTVTMIVDCKKKTTKPLDRSERAIVDTNGITVFGTRILDEEVFEGDIQQFLITGDPKAAYDYCEHYSPDC 243          

HSP 3 Score: 58.5362 bits (140), Expect = 8.057e-7
Identity = 52/120 (43.33%), Postives = 60/120 (50.00%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLS------GIDGNPGAKGAVGPRGT------PGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +G  G  GE+GE G PG  G  GL G  G  G  G  G DG  G  G  GPTGDPG  G +      G+ G PG  G  GP+G+      PGA G  G RG  G PGP G  G  G +G+
Sbjct:  771 RGLKGSKGEKGEDGFPGFKGDMGLKGDRGEVGQIGPRGEDGPEGPKGRAGPTGDPGPSGQAGEKGKLGVPGLPGYPGRQGPKGSTGFPGFPGANGEKGARGVAGKPGPRGQRGPTGPRGS 890          
BLAST of Collagen F-8 vs. UniProt/SwissProt
Match: sp|P02460|CO2A1_CHICK (Collagen alpha-1(II) chain (Fragment) OS=Gallus gallus OX=9031 GN=COL2A1 PE=2 SV=2)

HSP 1 Score: 139.428 bits (350), Expect = 6.437e-32
Identity = 77/268 (28.73%), Postives = 126/268 (47.01%), Query Frame = 2
Query: 4259 TRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILD-----QNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            + F    +TE+G D +      +   G+     ++ + +  L   + SI+ P GSK NPAR CRDI L +P+  SG++WIDPN G   D+I+V C    E+ +TCV  T  S  +      KT++ +  W +E ++       G++        + Q+ FL++L T+  Q VT  C  +  Y D    N   AI ++  N        D ++++E  S      ++D C         +  +  ++KT  LPIVDI   D G  +Q+ 
Sbjct:  593 SAFAGLGQTEKGPDPIRYMRADEAAGGLRQHDVEVDATLKSLNNQIESIRSPEGSKKNPARTCRDIKLCHPEWKSGDYWIDPNQGCTLDAIKVFCNM--ETGETCVYPTPSSIPRKNWWTSKTKDKKHVWFAETINGGFHFSYGDENLSPNTASI-QMTFLRLLSTEGSQNVTYHCKNSIAYMDEETGNLKKAILIQGSN--------DVEIRAEGNSRFTYSVLEDGCTKHTGKWGKTVIEYRSQKTSRLPIVDIAPMDIGGADQEF 849          
BLAST of Collagen F-8 vs. UniProt/SwissProt
Match: sp|O93484|CO1A2_ONCMY (Collagen alpha-2(I) chain OS=Oncorhynchus mykiss OX=8022 GN=col1a2 PE=2 SV=2)

HSP 1 Score: 138.272 bits (347), Expect = 3.075e-31
Identity = 73/245 (29.80%), Postives = 112/245 (45.71%), Query Frame = 2
Query: 4346 SILKKLY---SNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKY-----CPMS---QLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            S   K Y   + I  L   + ++  P GSK NPAR CRDI LS+P  +SG +WIDPN G I D+I+  C F   +  TC+    +S +     ++ +EN +  W  E +    N   +  Y      P S   QL F+++L  +A Q +T  C  +  Y D  N N   A+ ++  N        D +L++E  S      ++D C       + +  +    K   LPI+DI   D G  +Q+ 
Sbjct: 1117 SFRAKDYEVDATIKSLNSQIENLLTPEGSKKNPARTCRDIRLSHPDWSSGFYWIDPNQGCIADAIKAYCDF--STGHTCIHPHPES-IARKNWYRSSENKKHVWFGETI----NGGTEFAYNDETLSPQSMATQLAFMRLLANQATQNITYHCKNSVAYMDGENGNLKKAVLLQGSN--------DVELRAEGNSRFTFNVLEDGCTRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGEADQEF 1346          

HSP 2 Score: 58.5362 bits (140), Expect = 6.414e-7
Identity = 49/107 (45.79%), Postives = 62/107 (57.94%), Query Frame = 2
Query: 2417 SGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPR---GTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +G PGE G+TG  G+ GPTG  G  G  G+ G PG  G+RG  G++G  G PG  GL G+ G+ G  G  G +   GT GA+G  G  G +G PGP G  G  GE+G
Sbjct:  111 AGEPGEPGQTGSIGARGPTGSAGKPGEDGNNGRPGKPGDRGGPGTQGARGFPGTPGLPGMKGHRGYNGLDGRKGESGTAGAKGETGAHGANGSPGPAGSRGLNGERG 217          
BLAST of Collagen F-8 vs. TrEMBL
Match: A0A4D6FZN3 (Collagen F-8 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=colF-8 PE=2 SV=1)

HSP 1 Score: 433.335 bits (1113), Expect = 4.169e-137
Identity = 204/206 (99.03%), Postives = 205/206 (99.51%), Query Frame = 2
Query: 4370 NIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKT 4987
            NIDKLEKNMNSIQRPIGSK NPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKD+CMDRLRTPTNSQFQISAKKT
Sbjct:    1 NIDKLEKNMNSIQRPIGSKXNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDNCMDRLRTPTNSQFQISAKKT 206          
BLAST of Collagen F-8 vs. TrEMBL
Match: A0A564Z6L2 (Fibrillar collagen NC1 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS12507 PE=4 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 3.674e-73
Identity = 182/450 (40.44%), Postives = 258/450 (57.33%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGV---------EGVRGPQGPQGLKGEIGSSGKEG------PMGEDGPKG------------AIGPRGQRGDPGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX------DMQEGSSKYVNTGTRFKREAKTEEGKDKL-----ENPE---IPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKV---TSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +G QGP GE G  G  G  GP G RG  G  G QG +GV         EG+ GP GP+G +GE G  G++G      PMG  GP+G             IGP+G +G PG  G +GP G  GPPGP GP+G  GP G  G +GP G  G  GP          D+  G  K+  T T+        + +D L     ++P+    P +   I ++L++LY+ I+ LE  +   QRPIG+++ PARHCR+I  +        SG +WIDPNLGS  D+I+VECKF     KTCV AT +S    L + KK+ +   WW S +L+ N N  +++ Y P +Q+ FLQ+LH KAEQ++T +C  + VYYDS NK++++A  +  FN ++I+TH+DR+++ E G   LE+ VKDDCMDR  T + + F + A   E LP++D+++ DFG DNQ++
Sbjct: 1213 VGPQGPPGETGPVGAAGLSGPPGLRGSPGSPGPQGPQGVTGPDGEDGPEGLPGPAGPEGARGETGPKGEKGAYGPVGPMGPSGPRGERGVTGVVGERGGIGPKGAQGPPGPIGNQGPPGDVGPPGPEGPMGARGPTGLSGPRGPKGKQGPQGPQGPPGPVKILDLNAGYFKFEPTRTKRSVNPDESDIEDDLYDGYMKDPDANLFPNNVPAIGAVLRRLYARIEGLENAVKYYQRPIGTRAYPARHCREIAEATDSPHGPVSGEYWIDPNLGSSRDAIKVECKFSGNVAKTCVHATPESKALRLMNLKKSSSEGSWWFSRLLEDNNNGTQRLFYAPRNQMNFLQLLHHKAEQSITALCRGSVVYYDSRNKDYNSAANLLLFNGKVINTHLDRRVRGEGGFVELEVNVKDDCMDRSLTGSTASFDLVASHPELLPVMDMKMFDFGEDNQQI 1662          

HSP 2 Score: 202.216 bits (513), Expect = 3.686e-48
Identity = 227/627 (36.20%), Postives = 296/627 (47.21%), Query Frame = 2
Query:  236 NVFGMYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGS--------------KLGYIVGPEANLHLKSSF-------IFKAEKLLGSFSILLTAKVDRLSSDTIFS--------VNDINGHLNLAFKIGRKTVLHFR--EPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGL-HDIMMNQQPDD--SNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFG------------FKGENGPPGDTGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGSKGDFGQIGVKGDN------------GIIGEDGPRGPFGDSGDQGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGL 1942
                + +  V   L+   V S      +  +S  D+L   K+  +  +Q   G C    S              + GY+V   + L +K          I  + ++   F++ +   +++    TIFS        V   +GH  +++      V   R    G    + +    LDD  WHRV L+     + L +DC+  E       I  I     + LL  G+ GV+QDL  V G  +  +QC IYT +CP    D MMN  P       G +G  GD GE GEKG+ GK G  G  G +G PGP G +F++PLNLG GG   AR A+FR  L  H+  ++GVRG RG TG  GPDG +G  G            F+G  GP G TG  GPRG +G  G RG  G SG  G                          G  GD G +G KG N            G  GE+GPRGP GD GDQG+ G  G +G  G  GP GP G  G++G  G +GE G  G  G+ GP GP GP GPEG +GPRG+ GP G  G++G PG  G +G PGY G KG+ G KGD+G  GQ+G+ G  G RG KG RG  G  GPKGDIGK G +
Sbjct:   17 TCLALILFSVFLILSSSLVVSAKTFLLDLPASSVDLLAAFKLGDQANVQITAGKCGQVPSEDEVSSKVPIPDEFRPGYLV--PSGLEMKKLLSEVLPETIDWSHEMSVFFTLKMKPSLEKAEFFTIFSSQGRILLSVGIESGHFVVSYHEAAAGVRAARISTSGNAIHSEKISPALDD-QWHRVGLNFKEGRVHLALDCKTLESYTTVLPIKFIDPRNTLSLLPSGFEGVLQDLMFVQGDRSLEQQCLIYTPNCPTDGDDAMMNDGPVPLAPGQGEQGEQGDPGEQGEKGDPGKPGPRGPDGLQGLPGPVGSLFVVPLNLGIGGGAHARAAHFRQLLQQHLESLRGVRGPRGLTGPTGPDGPMGPVGPKGETGPQGDAGFQGRRGPIGPTGLPGPRGKTGRDGDRGDPGPSGPKGPD------------------------GLPGDSGLMGPKGLNGPRGPPGPVGEQGAPGEEGPRGPTGDQGDQGDTGPYGPRGPVGLQGPLGPRGKTGSRGSVGLQGEAGEPGPTGMAGPMGPAGPAGPEGPAGPRGAVGPPGPTGKEGPPGATGPEGRPGYPGPKGEIGPKGDTGASGQKGEPGLPGPRGVKGSRGIIGVTGPKGDIGKPGAV 616          

HSP 3 Score: 76.6406 bits (187), Expect = 7.462e-10
Identity = 138/345 (40.00%), Postives = 160/345 (46.38%), Query Frame = 2
Query: 2429 GERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFD------------GIPGPPGPNGAKGEQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNIGLDGDFGPIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTK 3427
            G RG TG  G  GP G +G  G  G  GD G  G RG IG  G  G  GK G  G  G+PG  G  GP G PG  G +G +G +            G PG  GP G  G+QG  G+ GP G                               +G +GL G  GP G TG+RG  G  G  G  G  G AG  G  G  G  G  G +G +GP GP G  G PG  G +G PG PG  GE GP G  G  G +G  G PG +G+ G  G +G  G KGD GK G  G  G  GP G  G  G +G  G+ GP G  GE G+ G  GP G+ GV G PGL G  G +
Sbjct:  362 GPRGLTGPTGPDGPMGPVGPKGETGPQGDAGFQGRRGPIGPTGLPGPRGKTGRDGDRGDPGPSGPKGPDGLPGDSGLMGPKGLNGPRGPPGPVGEQGAPGEEGPRGPTGDQGDQGDTGPYGP------------------------------RGPVGLQGPLGPRGKTGSRGSVGLQGEAGEPGPTGMAGPMGPAGPAGPEGPAGPRGAVGPPGPTGKEGPPGATGPEGRPGYPGPKGEIGPKGDTGASGQKGEPGLPGPRGVKGSRGIIGVTGPKGDIGKPGAVGPQGEAGPKGLKGSRGSQGVMGLMGPQGEKGEPGKPGESGPRGDRGVQGPPGLIGPAGPQ 676          

HSP 4 Score: 72.0182 bits (175), Expect = 1.898e-8
Identity = 154/389 (39.59%), Postives = 173/389 (44.47%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNIGLD------------GDFGPIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGP------------------------------------EGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTK 3427
             QGP G+PG RGE GE G  GP G IG  G  G  GD G +G  G IG RGPTGDPGK+G  G+ G+ G KG  G RG PG RG  GY G DG+PGP GP+G KGE                                              G D            GD GPIG TG  G  G  G  G  G  G  G  G  G +G  G  G +G  GP    GPIG+PG  G +G  G  G  G+ GP G +GP                                    EG  G  G PG  GM G PG +G QG KGDRG+ GP GSPG  GP+G  GL G  G  G  GP G +GE G+ GP GP G  G  G+PG  G  G K
Sbjct:  771 RQGPQGFPGPRGEPGETGPPGPRGPIGMTGPAGPAGDTGPEGAPGPIGPRGPTGDPGKEGKEGVKGDKGPKGERGNRGPPGPRGPRGYIGLDGMPGPAGPDGFKGE---------------------------------------------TGPDGEVGPAGPKGYRGDSGPIGQTGPPGPAGPRGAQGIPGEKGPKGPDGVMGPVGPPGPRGSRGRSGP---TGPIGAPGFDGEKGERGSAGPPGKKGPSGPQGPRGIAGPIGSPGMPGIQGPPGAPGQPGEQGPMGLIGSEGLTGPAGLPGPMGMEGAPGPIGKQGPKGDRGRVGPQGSPGPAGPMGAIGLTGPAGNPGPTGPAGAVGEPGDVGPQGPRGSPGYAGIPGNHGPQGRK 1111          

HSP 5 Score: 64.3142 bits (155), Expect = 3.213e-6
Identity = 137/345 (39.71%), Postives = 167/345 (48.41%), Query Frame = 2
Query: 1733 RGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGD------DGGFGTRGYKGERGKPGGFGPKGDIGKAGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGGRGIAGLKXXXXXXXXXXXXXXXXEKGPNGPTGNRGVDGE------KGNLGVRGPIGDIGDXXXXXXXXXXXXXXXXXXXXLKGDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            RG +G  G  G DG  G  G KG+ G +GD+G  G+RG        G  G  G  G+RG PG  GPKG  G  G                                         G  G  GL G  G  GP G  G  GE+GP GPTG++G  G+      +G +G++GP+G  G  G RG  G +G  G  GP+G+ G MGP GP GP GP G +G+ GP GP G  GP G+ G +G  GYPG +GE G  G    TG  G  G PG  G  G  G RG IG  GP GD GK G  G  G  G KG  G RG+ G  G +G +G  G PG PG +G +G++G 
Sbjct:  361 RGPRGLTGPTGPDGPMGPVGPKGETGPQGDAGFQGRRGPIGPTGLPGPRGKTGRDGDRGDPGPSGPKGPDGLPG---------------------------------------DSGLMGPKGLNGPRGPPGPVGEQGAPGEEGPRGPTGDQGDQGDTGPYGPRGPVGLQGPLGPRGKTGSRGSVGLQGEAGEPGPTGMAGPMGPAGPAGPEGPAGPRGAVGPPGPTGKEGPPGATGPEGRPGYPGPKGEIGPKGD---TGASGQKGEPGLPGPRGVKGSRGIIGVTGPKGDIGKPGAVGPQGEAGPKGLKGSRGSQGVMGLMGPQGEKGEPGKPGESGPRGDRGV 663          
BLAST of Collagen F-8 vs. TrEMBL
Match: A0A0R3S998 (Fibrillar collagen NC1 domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS797 PE=4 SV=2)

HSP 1 Score: 280.026 bits (715), Expect = 4.000e-72
Identity = 176/407 (43.24%), Postives = 249/407 (61.18%), Query Frame = 2
Query: 3860 GLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMQEGSSKYVNTGTRFKREAKTEEGKDKL-----ENPE---IPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKV---TSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            G  GP+G  GP G  G +G  G +G KG  G  GP GP G +GE G +G  G  G  GPKGA GP G  G+ G  G+ GP GP GP G  GP G  GP+G KG +GP G  G PGPVKI+D+  G  K+  T T+        + +D L     ++P+    P +   I ++L++LY+ I+ LE  +   QRPIG+++ PARHCR+I  +        SG +WIDPNLGS  D+I+VECKF     KTCV AT +S    L + KK+ +   WW S +L+ N N  +++ Y P +Q+ FLQ+LH KAEQ++T +C  + VYYDS NK++++A  +  FN ++I+TH+DR+++ E G   LE+ VKDDCMDR  T + + F + A   E LP++D+++ DFG DNQ++
Sbjct: 1259 GEDGPEGLPGPAGPEGARGETGPKGEKGAYGPVGPMGPSGPRGERGVTGVVGERGGIGPKGAQGPPGPIGNQGPPGDVGPPGPEGPMGARGPTGLSGPRGPKGKQGPQGPQGPPGPVKILDLNAGYFKFEPTRTKRSVNPDESDIEDDLYDGYMKDPDANLFPNNVPAIGAVLRRLYARIEGLENAVKYYQRPIGTRAYPARHCREIAEATDSPHGPVSGEYWIDPNLGSSRDAIKVECKFSGNVAKTCVHATPESKALRLMNLKKSSSEGSWWFSRLLEDNNNGTQRLFYAPRNQMNFLQLLHHKAEQSITALCRGSVVYYDSRNKDYNSAANLLLFNGKVINTHLDRRVRGEGGFVELEVNVKDDCMDRSLTGSTASFDLVASHPELLPVMDMKMFDFGEDNQQI 1665          

HSP 2 Score: 179.874 bits (455), Expect = 2.255e-41
Identity = 212/676 (31.36%), Postives = 282/676 (41.72%), Query Frame = 2
Query:  236 NVFGMYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGS--------------KLGYIVGPEANLHLKSSF-------IFKAEKLLGSFSILLTAKVDRLSSDTIFS--------VNDINGHLNLAFKIGRKTVLHFR--EPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHD----------------------------IMMNQQPDDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRG------------------------------------PTGSPGPDGSLGGFGFKGENGPPGDTGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGSKGDFGQIGVKGDN------------GIIGEDGPRGPFGDSGDQGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGL 1942
                + +  V   L+   V S      +  +S  D+L   K+  +  +Q   G C    S              + GY+V   + L +K          I  + ++   F++ +   +++    TIFS        V   +GH  +++      V   R    G    + +    LDD  WHRV L+     + L +DC+  E       I  I     + LL  G+ GV+QDL  V G  +  +QC IYT +CP   D                            I++   P     G +G  GD GE GEKG+ GK G  G  G +G PGP G +F++PLNLG GG   AR A+FR  L  H+  ++GVRG RG                                    PTG PGP G  G  G +G+ GP G  G                                                  G  GD G +G KG N            G  GE+GPRGP GD GDQG+ G  G +G  G  GP GP G  G++G  G +GE G  G  G+ GP GP GP GPEG +GPRG+ GP G  G++G PG  G +G PGY G KG+ G KGD+G  GQ+G+ G  G RG KG RG  G  GPKGDIGK G +
Sbjct:   17 TCLALILFSVFLILSSSLVVSAKTFLLDLPASSVDLLAAFKLGDQANVQITAGKCGQVPSEDEVSSKVPIPDEFRPGYLV--PSGLEMKKLLSEVLPETIDWSHEMSVFFTLKMKPSLEKAEFFTIFSSQGRILLSVGIESGHFVVSYHEAAAGVRAARISTSGNAIHSEKISPALDD-QWHRVGLNFKEGRVHLALDCKTLESYTTVLPIKFIDPRNTLSLLPSGFEGVLQDLMFVQGDRSLEQQCLIYTPNCPTDGDDAMMNDGVSYRFKELSFFFISQSNPQFHILLQPVPLAPGQGEQGEQGDPGEQGEKGDPGKPGPRGPDGLQGLPGPVGSLFVVPLNLGIGGGAHARAAHFRQLLQQHLESLRGVRGPRGLTGPTGPDGPMGPVGPKGETGPQGDAGFQGRRGPIGPTGLPGPRGKTGRDGDRGDPGPSGPKG------------------------------------------------PDGLPGDSGLMGPKGLNGPRGPPGPVGEQGAPGEEGPRGPTGDQGDQGDTGPYGPRGPVGLQGPLGPRGKTGSRGSVGLQGEAGEPGPTGMAGPMGPAGPAGPEGPAGPRGAVGPPGPTGKEGPPGATGPEGRPGYPGPKGEIGPKGDTGASGQKGEPGLPGPRGVKGSRGIIGVTGPKGDIGKPGAV 641          

HSP 3 Score: 77.411 bits (189), Expect = 3.556e-10
Identity = 138/345 (40.00%), Postives = 160/345 (46.38%), Query Frame = 2
Query: 2429 GERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFD------------GIPGPPGPNGAKGEQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNIGLDGDFGPIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTK 3427
            G RG TG  G  GP G +G  G  G  GD G  G RG IG  G  G  GK G  G  G+PG  G  GP G PG  G +G +G +            G PG  GP G  G+QG  G+ GP G                               +G +GL G  GP G TG+RG  G  G  G  G  G AG  G  G  G  G  G +G +GP GP G  G PG  G +G PG PG  GE GP G  G  G +G  G PG +G+ G  G +G  G KGD GK G  G  G  GP G  G  G +G  G+ GP G  GE G+ G  GP G+ GV G PGL G  G +
Sbjct:  387 GPRGLTGPTGPDGPMGPVGPKGETGPQGDAGFQGRRGPIGPTGLPGPRGKTGRDGDRGDPGPSGPKGPDGLPGDSGLMGPKGLNGPRGPPGPVGEQGAPGEEGPRGPTGDQGDQGDTGPYGP------------------------------RGPVGLQGPLGPRGKTGSRGSVGLQGEAGEPGPTGMAGPMGPAGPAGPEGPAGPRGAVGPPGPTGKEGPPGATGPEGRPGYPGPKGEIGPKGDTGASGQKGEPGLPGPRGVKGSRGIIGVTGPKGDIGKPGAVGPQGEAGPKGLKGSRGSQGVMGLMGPQGEKGEPGKPGESGPRGDRGVQGPPGLIGPAGPQ 701          

HSP 4 Score: 72.4034 bits (176), Expect = 1.117e-8
Identity = 154/389 (39.59%), Postives = 173/389 (44.47%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNIGLD------------GDFGPIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGP------------------------------------EGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTK 3427
             QGP G+PG RGE GE G  GP G IG  G  G  GD G +G  G IG RGPTGDPGK+G  G+ G+ G KG  G RG PG RG  GY G DG+PGP GP+G KGE                                              G D            GD GPIG TG  G  G  G  G  G  G  G  G  G +G  G  G +G  GP G   PIG+PG  G +G  G  G  G+ GP G +GP                                    EG  G  G PG  GM G PG +G QG KGDRG+ GP GSPG  GP+G  GL G  G  G  GP G +GE G+ GP GP G  G  G+PG  G  G K
Sbjct:  796 RQGPQGFPGPRGEPGETGPPGPRGPIGMTGPAGPAGDTGPEGAPGPIGPRGPTGDPGKEGKEGVKGDKGPKGERGNRGPPGPRGPRGYIGLDGMPGPAGPDGFKGE---------------------------------------------TGPDGEVGPAGPKGYRGDSGPIGQTGPPGPAGPRGAQGIPGEKGPKGPDGVMGPVGPPGPRGSRGRSGPTG---PIGAPGFDGEKGERGSAGPPGKKGPSGPQGPRGIAGPIGSPGMPGIQGPPGAPGQPGEQGPMGLIGSEGLTGPAGLPGPMGMEGAPGPIGKQGPKGDRGRVGPQGSPGPAGPMGAIGLTGPAGNPGPTGPAGAVGEPGDVGPQGPRGSPGYAGIPGNHGPQGRK 1136          

HSP 5 Score: 65.0846 bits (157), Expect = 1.988e-6
Identity = 137/345 (39.71%), Postives = 168/345 (48.70%), Query Frame = 2
Query: 1733 RGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGD------DGGFGTRGYKGERGKPGGFGPKGDIGKAGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGGRGIAGLKXXXXXXXXXXXXXXXXEKGPNGPTGNRGVDGE------KGNLGVRGPIGDIGDXXXXXXXXXXXXXXXXXXXXLKGDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            RG +G  G  G DG  G  G KG+ G +GD+G  G+RG        G  G  G  G+RG PG  GPKG  G  G                                         G  G  GL G  G  GP G  G  GE+GP GPTG++G  G+      +G +G++GP+G  G  G RG  G +G  G  GP+G+ G MGP GP GP GP G +G+ GP GP G  GP G+ G +G  GYPG +GE G  G  G +G  G  G PG  G  GS   RG IG  GP GD GK G  G  G  G KG  G RG+ G  G +G +G  G PG PG +G +G++G 
Sbjct:  386 RGPRGLTGPTGPDGPMGPVGPKGETGPQGDAGFQGRRGPIGPTGLPGPRGKTGRDGDRGDPGPSGPKGPDGLPG---------------------------------------DSGLMGPKGLNGPRGPPGPVGEQGAPGEEGPRGPTGDQGDQGDTGPYGPRGPVGLQGPLGPRGKTGSRGSVGLQGEAGEPGPTGMAGPMGPAGPAGPEGPAGPRGAVGPPGPTGKEGPPGATGPEGRPGYPGPKGEIGPKGDTGASGQKGEPGLPGPRGVKGS---RGIIGVTGPKGDIGKPGAVGPQGEAGPKGLKGSRGSQGVMGLMGPQGEKGEPGKPGESGPRGDRGV 688          
BLAST of Collagen F-8 vs. TrEMBL
Match: A0A4E0S121 (Collagen alpha-1(XI) chain OS=Fasciola hepatica OX=6192 GN=D915_005268 PE=4 SV=1)

HSP 1 Score: 279.641 bits (714), Expect = 5.416e-72
Identity = 175/414 (42.27%), Postives = 252/414 (60.87%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMQEGSSKYVNTGTRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNP---KVTSGNFWIDPNLGSINDSIEVECKFEK--ESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQN--GNKMR-KIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +G  GP+G+ G  G +G  G  G+ G +G  GI+G+KG  G  GP GP G KGE G+ G EG  G DGPKG  G  G  GDPG+ G  G  GP GP G  G  G  G +G KG  GP+G PG PGP+KI+D+ EG  ++ +   R KR       K   +    P     I ++L+++Y  I+ LE ++N   +P G++ +PARHCRDI  S     ++ SG +WIDPNLGS  D+  VEC+F+   ++  TC++ T+++    LT FKKTEN + WWLS +  Q    N  R ++ Y P +Q+  L +LH KAEQ+VT +C   AVY+DS  KNH+ A+R R F +  I+T+  R+L+  SG+ +LE+KV+D+CM+R     +S F+ +A++   LPI+D QL +FGN +Q++
Sbjct: 1259 VGIPGPMGKVGERGSEGVTGKQGEMGDQGKPGIKGIKGAIGPVGPVGPMGRKGEKGAPGLEGDRGPDGPKGERGAVGPIGDPGIPGPSGAEGPEGPAGYPGRPGLPGNQGPKGASGPMGPPGPPGPIKILDVSEGYYRFEDP-PRSKRSVDGVILKLDPDEAIAPTTVPSIGAVLRRVYQRIEILENSLNMFDQPTGTRRHPARHCRDILSSAEYPEQLKSGRYWIDPNLGSPTDTFPVECRFKDRGKTALTCIAPTEETQALPLTQFKKTENDQDWWLSRLRSQQVQSNFTRPQLYYAPHNQIRHLHLLHQKAEQSVTFVCRNTAVYFDSTQKNHNAAVRARLFTEHEINTYEHRRLRDLSGNMMLEVKVRDECMERTTNKASSVFEFTAREPNLLPILDFQLSEFGNTDQEI 1671          

HSP 2 Score: 232.261 bits (591), Expect = 2.059e-57
Identity = 328/558 (58.78%), Postives = 379/558 (67.92%), Query Frame = 2
Query: 1739 RQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGGRGIAGLKXXXXXXXXXXXXXXXXEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDXXXXXXXXXXXXXXXXXXXXLKGDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNIGLDGDFGPIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQG 3412
            R G+ GVPGSDG PG+ G KGD G KGD+G VGQ+G+ G  G RGYKG+RG+ G  GPKGD GK G +G+ G+ GPKGVKGDIG  G  G  GP+G KG PG QGP+G RG  G+KG  G +GPPG  GPDGE+G  GP G RG DG+KG +G++G  GD+G+QGQRG PGSRG PG +GP G KGD G +GP GP G  G QG  GP GP+G TGP G++G  GP G+PG RGE GE G  G  G +GS G PG+TGDPG DGERG +G RGP GD GKDG  G DG PGAKG  GP+G  G+RG  G+ GFDG+PG PGP G KGE G +GE GPIG KG  GD G +G  G  G TG RGPPG  G KG+ G+DG FG IG  G RG  GRPGPTG +G  G  G+KG KG  G  G  GDKG +G +GP GPIGSPGLPGIQG PG+PG  GE GP G  GPEG RG TG+PG  GM G PG  G  GEKGD G  GP G  G TG  G  G+ G++G  G  G  G  G+KG+ G  G  G +G PG PG+QG
Sbjct:  562 RAGAAGVPGSDGLPGFPGQKGDTGAKGDAGDVGQKGETGVQGPRGYKGDRGRMGPTGPKGDAGKTGPMGVSGEVGPKGVKGDIGMPGPVGPPGPMGEKGNPGPQGPVGARGDPGVKGFMGAIGPPGPPGPDGERGVTGPAGPRGRDGDKGEVGIQGAPGDVGEQGQRGSPGSRGPPGKLGPPGPKGDSGSVGPVGPAGSFGEQGVQGPMGPVGPTGPQGAVGRPGPVGFPGPRGEPGERGPPGQPGALGSTGPPGATGDPGPDGERGPVGPRGPAGDAGKDGQPGRDGAPGAKGVRGPQGLAGSRGARGFPGFDGMPGRPGPTGPKGESGPNGEPGPIGSKGYMGDQGPMGPVGAPGLTGPRGPPGPAGEKGSTGVDGPFGLIGSPGPRGPQGRPGPTGQLGPHGFDGEKGSKGASGPPGIKGDKGGVGIRGPTGPIGSPGLPGIQGPPGIPGQSGEEGPQGLVGPEGNRGVTGSPGPIGMRGAPGAPGLPGEKGDTGLPGPRGRRGPTGLAGAPGILGQQGDVGQIGAAGAQGDKGDQGIHGIPGSIGFPGTPGVQG 1119          

HSP 3 Score: 229.565 bits (584), Expect = 1.308e-56
Identity = 181/453 (39.96%), Postives = 249/453 (54.97%), Query Frame = 2
Query:  248 MYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSM-----PGSK---LGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHF---------------REPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQP---DDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEV 1528
            M  L VL  L VQ+       S        DIL+ +++  + ++++  G C        GS+   LGY V    +L +    +   + +L   SIL T +V+      +F+V +  G + L    GR+  +++               ++   +T+ I+F T +DD  WHRVA+S+     +L +DCQ  E +   +        G ++LL  G  G IQDL+++P  EAA +QC+IY+ DC    D MM  +     D   G  G +GDMG PG+KG  G  GG GL G  G PGP G +F+IPLNLG G +  AR A FR+ L  H++ +KGVRG RG TG PGPDG  G  G KGE G PG+TGFQGPRG  G  GR G +G  G DG RG+ G  G  G+DG+PGDSG  G +G+KG+ G  G KGD G+ G +GPRGP GDSG+QGE+
Sbjct:   42 MLFLCVLVLLPVQTAGLFGSSSTESLIGTTDILKAVRLGDQAYVESVAGRCGARLEEPSGSEDNPLGYSVSRGMSLFIDGDRLITKD-VLSELSILFTVRVEWGFQGELFTVYNRQGQVELGVTFGRELRVYYVSGSANAKTHPRTQTKDKYSLTEVIQFNTSIDDNMWHRVAISMQKGIARLLIDCQQREYVSYDQSTFTFDDRGRLQLLKDGIQGAIQDLYLIPSGEAAGKQCDIYSTDC--AQDRMMGDEAVTTSDPMQGPTGPMGDMGPPGDKGEPGIPGGDGLVGDPGPPGPAGSLFVIPLNLGIGTSSFARAATFRDLLQKHLLSLKGVRGPRGMTGVPGPDGMQGERGVKGEPGHPGETGFQGPRGAMGLSGRPGPAGPPGRDGARGEPGANGPAGEDGRPGDSGHMGPKGAKGEVGHRGEKGDFGLPGAEGPRGPLGDSGEQGEI 491          
BLAST of Collagen F-8 vs. TrEMBL
Match: A0A3P6G5X1 (Fibrillar collagen NC1 domain-containing protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS260 PE=4 SV=1)

HSP 1 Score: 273.092 bits (697), Expect = 4.470e-70
Identity = 112/246 (45.53%), Postives = 165/246 (67.07%), Query Frame = 2
Query: 4319 IPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPK---VTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
             P +   I ++L++LY+ I+ LE  +   ++P+G++S PARHCR+I  +        SG +WIDPNLGS  D+  VEC+F     KTCV AT +S    LTS KK+     WWLS++L++ GN+ +K+ Y P +QL FLQ+LH KAEQ++T +C  + VYYD+ NKN+++A  M  FN ++IDTH+DR+++ E GS  LE+ VKDDCMDR    + + F + AK  E LPI+D+++ DFG +NQ+L
Sbjct: 1377 FPNNVPAIGAVLRRLYARIENLESAVKYYRKPVGTRSYPARHCREIMEATDSPHGAVSGEYWIDPNLGSSKDAFLVECRFSGNVAKTCVHATAESKALRLTSLKKSSGESSWWLSKLLEEQGNRTQKLFYAPRNQLNFLQLLHHKAEQSITALCRGSVVYYDNKNKNYNSAANMLLFNGKVIDTHLDRRVRGEGGSVQLEVNVKDDCMDRPLAGSTASFDLVAKNPELLPILDLKMFDFGEENQQL 1622          

HSP 2 Score: 210.69 bits (535), Expect = 7.346e-51
Identity = 343/860 (39.88%), Postives = 422/860 (49.07%), Query Frame = 2
Query:  416 KLGYIVGPEANLHLK---SSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREP------------GGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHD-------IMMNQQPDDS----------------NTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERG---------------------------------------------------KPGGFGPKGDIGKAGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGGRGIAGLKXXXXXXXXXXXXXXXXEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDXXXXXXXXXXXXXXXXXXXXLKGDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            + GY+V     L +K   +  +   +      S+  T +V   +   +F++    G + L+  I  + V+  +E             G    + +    LDD  WHRV L+     ++L VDC+  E   L+  +  I     + LL  G+ GVIQDL  V G  +  +QC IYT DCP   D       +M+ +  +++                  G +G  GD GEPGEKG  GK G  G  G  G  GP G +F++PLNLG GG   AR  +FR  L  H+  ++G RG RG TG  GPDG +G  G KGE GP GDTGFQG RG  GP G  G  G++G DG+RGD G  G KG DG PGDSG  G +G KG  G  G  G+ G  GE+GPRGP GD+GDQG++G  G +G  G  GP GP G  G++GP G +GE G  G  GLPGP GP+GP GPEG +GPRG+ G  G  G+QG PG  G +G PGY G KG+ G+KGD+G  GQ+GD G  G RG KG RG                                                   KPG  GP+GD G  G                                      G +G  G  GL G  G  GPPG  G +G+KG  GP G  G DGE+G  G  GP G  G  G  G                KGD+G  GP GPPGP+G  G  G SGP G  GP+G IG QGP G+PG RGE GE G  GP G IG  G  G  GD G +G  G +G RG  GDPGKDG  G  G+ G KG  G RG  G RG  GY G DG+PGP GP G KGE G
Sbjct:   40 RPGYVV--PRGLEMKKLLADLLPNTDAWRSEMSVFFTTRVKPGNKGELFTIYSSQGRVLLSVGIDGQVVVSHQEAAAGVRAARVSATGSAISSEKLGPSLDDGLWHRVGLNFKDGRVQLAVDCRTPESFKLSLPVAFIDERSTLSLLPNGFDGVIQDLMFVQGDRSLEQQCLIYTPDCPTDGDDAMQNDEVMIVETSEEALGQTAVPFFVLLIYQLFQGERGEQGDPGEPGEKGEPGKPGPRGPDGEPGPAGPTGSLFVVPLNLGVGGGSQARAGHFRQILQQHLESLRGPRGPRGLTGPTGPDGPMGPPGPKGETGPQGDTGFQGRRGPMGPAGLPGPRGKTGRDGDRGDPGPAGPKGPDGLPGDSGLMGPKGPKGPRGPAGPVGETGSPGEEGPRGPTGDAGDQGDMGPYGPRGPPGMQGPHGPRGKTGSRGPVGLQGETGEPGPTGLPGPMGPQGPAGPEGPAGPRGAVGAPGPNGKQGPPGATGPEGRPGYPGPKGEVGLKGDTGPEGQKGDPGLPGPRGVKGTRGMAGAVGPKGDAGKPGAMGVPGDPGPKGLKGSRGVPGTMGLMGPQGEKGEPGKPGDPGPRGDRGVQG------------------------------------PSGLMGPAGPQGLHGDPGPAGPPGPQGREGDKGETGPIGPAGADGEQGQHGAPGPRGLQGKTGPAGE---------------KGDLGATGPAGPPGPIGEMGFQGQSGPSGLPGPAGPIGRQGPQGFPGPRGEPGEIGPPGPRGPIGMTGPVGPAGDTGPEGVPGPVGPRGSAGDPGKDGKDGARGDKGPKGERGNRGPAGPRGPRGYTGLDGLPGPAGPEGFKGETG 846          

HSP 3 Score: 68.1662 bits (165), Expect = 2.366e-7
Identity = 53/115 (46.09%), Postives = 61/115 (53.04%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRG------PTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
             QGP G  G  G  G PG  G  GL G  G  G  GDPG  G RG  G+RG      P GD GK G  G+ G+PG KG  G RG PG  G +G +G  G PG PG  G +G++G 
Sbjct:  517 KQGPPGATGPEGRPGYPGPKGEVGLKGDTGPEGQKGDPGLPGPRGVKGTRGMAGAVGPKGDAGKPGAMGVPGDPGPKGLKGSRGVPGTMGLMGPQGEKGEPGKPGDPGPRGDRGV 631          

HSP 4 Score: 65.4698 bits (158), Expect = 1.563e-6
Identity = 136/394 (34.52%), Postives = 162/394 (41.12%), Query Frame = 2
Query: 2411 GPSGYPGERGETG------EPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPG---------------AKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNIGLDGDFGPIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGN------PGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLM------------------------GEKGENGPMGPI------GEVGVPGLPGLQGEPG 3421
            GP+G PG RG+TG      +PG  GP G  G  G  G  G  G  G RG  G  G TG PG++G  G  G+ G                +G  GPRG  G+RG +G +G  G PGP G  G  G QG  G  GP G +G  G  G  G  GP G TG  G PG  G KG +GL GD GP G                                      GD G  GP+G  G  G  G  G +G  G PG MG  G PG KG +G+RG  G        G++G PG PG+ GP+G++                              GVQGP GLM                        G+KGE GP+GP       G+ G PG  GLQG+ G
Sbjct:  369 GPAGLPGPRGKTGRDGDRGDPGPAGPKGPDGLPGDSGLMGPKGPKGPRGPAGPVGETGSPGEEGPRGPTGDAGDQGDMGPYGPRGPPGMQGPHGPRGKTGSRGPVGLQGETGEPGPTGLPGPMGPQGPAGPEGPAGPRGAVGAPGPNGKQGPPGATGPEGRPGYPGPKGEVGLKGDTGPEGQK------------------------------------GDPGLPGPRGVKGTRGMAGAVGPKGDAGKPGAMGVPGDPGPKGLKGSRGVPGTMGLMGPQGEKGEPGKPGDPGPRGDR------------------------------GVQGPSGLMGPAGPQGLHGDPGPAGPPGPQGREGDKGETGPIGPAGADGEQGQHGAPGPRGLQGKTG 696          
BLAST of Collagen F-8 vs. Ensembl Cavefish
Match: col1a2 (collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8415])

HSP 1 Score: 127.872 bits (320), Expect = 6.271e-29
Identity = 72/250 (28.80%), Postives = 120/250 (48.00%), Query Frame = 2
Query: 4316 EIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILD---QNGNKMRKIKYCPMS-QLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAK--KTEYLPIVDIQLKDFGNDNQKL 5047
            E   D   + +   ++ + I  L   ++++  P GSK NPAR CRDI LS+P  TS  +WIDPN G   D+I+  C F   + +TC+ A  +S +     ++ ++  +  W  E ++   + G     +    M+ QL F+++L  +A Q VT  C  +  Y D+ N N   A+ ++  N        D +L++E  S      ++D C  +  T   S+  I  +  K   LPI+DI   D G  +Q+ 
Sbjct: 1108 EYRADQAALRAKDYEVDATIKSLNTQIDNLLSPEGSKKNPARTCRDIRLSHPDWTS-FYWIDPNQGCTMDAIKAFCDF--STGQTCIHAHPES-IPRKNWYRSSQEKKHIWFGETINGGTEFGYNDETLSPQSMATQLAFMRLLANQAVQNVTYHCKNSIAYMDAENGNLKKAVLLQGSN--------DVELRAEGNSRFTFSVLEDGCTLQRHTGQWSKTVIEYRTNKPSRLPILDIAPLDIGGADQEF 1345          

HSP 2 Score: 60.8474 bits (146), Expect = 1.525e-8
Identity = 51/114 (44.74%), Postives = 63/114 (55.26%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGL------SGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +G SG PG  G  G  G VGP G  G +G PG TG  G DG RG  G  GP G  G++GL      SG  G+PG  G +GP G  G +G +G +GF+G+PG  G  G  G  G+
Sbjct:  766 RGDSGPPGLTGFPGAAGRVGPAGPAGIVGPPGPTGAQGKDGPRGLRGDVGPAGPQGENGLIGPPGLSGEKGSPGESGPMGPPGIAGPQGQLGSQGFNGLPGSRGERGLPGAAGS 879          

HSP 3 Score: 60.077 bits (144), Expect = 2.365e-8
Identity = 50/109 (45.87%), Postives = 60/109 (55.05%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +QG +G PG RGE G PG+ G  G  G +G  GS G  G  G  G  G  GP G+ G++G  G DG PG  GA G +G  G  G+ G  G  G PGP GP+GA G  G 
Sbjct:  858 SQGFNGLPGSRGERGLPGAAGSVGEAGRVGPSGSPGPRGPSGNIGLPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGPLGIAGAPGPLGPSGAVGRPGN 966          

HSP 4 Score: 55.8398 bits (133), Expect = 5.590e-7
Identity = 49/112 (43.75%), Postives = 60/112 (53.57%), Query Frame = 2
Query: 2405 NQGPSGYPGE---RGETGEPGSVGPTGLIGS---IGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGE 2722
            N GP G PG    +G+ GEPGS GP G+ G+   +G  G+ G PG+ GE GS G  G  G  G  G   + G  G +G  G  G  G RG  G RG  G+ G PGPNG  G+
Sbjct:  921 NDGPPGRPGAAGIKGDRGEPGSPGPLGIAGAPGPLGPSGAVGRPGNRGEAGSAGPSGAVGPAGARGAPFLQGPSGPRGEKGVAGDKGDRGMKGLRGHPGLQGMPGPNGPSGD 1032          

HSP 5 Score: 54.6842 bits (130), Expect = 1.026e-6
Identity = 54/118 (45.76%), Postives = 60/118 (50.85%), Query Frame = 2
Query: 2411 GPSGYPGERGETGE---PGSVGPTGLIGSIGAPGSTGDPGS------DGERGSIGSRGP---TGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GPSG PG RG +G    PG  GP G  G  G+PG+ G PG        G+RG  GS GP    G PG  G SG  G PG +G  G  G  GA G  G RG   + GP GP G KG  G
Sbjct:  887 GPSGSPGPRGPSGNIGLPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGPLGIAGAPGPLGPSGAVGRPGNRGEAGSAGPSGAVGPAGARGAPFLQGPSGPRGEKGVAG 1004          

HSP 6 Score: 53.1434 bits (126), Expect = 3.123e-6
Identity = 40/86 (46.51%), Postives = 49/86 (56.98%), Query Frame = 2
Query: 3833 GKQGPLGEPGL------SGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGD 4072
            G+QGP G PG       +GP GE G  GDRGI G  G+ G  GV+G RG  GP       G+SG +GP+G  GP G  GP G +G+
Sbjct:  533 GEQGPSGAPGFQGLPGPAGPVGETGKPGDRGIPGDQGVAGPSGVKGERGTPGP------AGASGAQGPIGARGPAGTPGPDGSKGE 612          

HSP 7 Score: 53.1434 bits (126), Expect = 3.313e-6
Identity = 51/113 (45.13%), Postives = 57/113 (50.44%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGA------KGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            G +G  GE G  G  GS GP G  G+IG PG TG  G  G  GS G+ GP G PG  G+ G  G PG+       GA GP G  GA G  G RG  G  GP G  G  G +G 
Sbjct:  875 GAAGSVGEAGRVGPSGSPGPRGPSGNIGLPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGDRGEPGSPGPLGIAGAPGPLGPSGAVGRPGNRGEAGSAGPSGAVGPAGARGA 987          

HSP 8 Score: 51.9878 bits (123), Expect = 7.259e-6
Identity = 42/88 (47.73%), Postives = 50/88 (56.82%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            +G  GP G  G  GP G QG  G RG++G VG  G +G  G+ GP G  G KG  G SG  GP G  GP+G +G +G  G PG  GER
Sbjct:  784 VGPAGPAGIVGPPGPTGAQGKDGPRGLRGDVGPAGPQGENGLIGPPGLSGEKGSPGESGPMGPPGIAGPQGQLGSQGFNGLPGSRGER 871          

HSP 9 Score: 51.9878 bits (123), Expect = 8.100e-6
Identity = 115/335 (34.33%), Postives = 147/335 (43.88%), Query Frame = 2
Query: 1715 TGPVGGRGRQGSPGVPGSDGTPGYAGIKGD---QGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGGRGIAGLKXXXXXXXXXXXXXXXXEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDXXXXXXXXXXXXXXXXXXXXLKGDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNG 2710
            TG  G  GR G  G  G  G PG  G +G    +G++GD G  G +G++G  G  G  GE+G PG  GP G  G AG                                     QG LG +G  GL G+ G  G PG +G  GE G  GP+G+ G  G  GN+G+ G  G  G+ G+ G PG+ G PG  G +G+KGD                                    +G  G PG  G  G PG +GP+   G++G PG+ G+ GS G  G++G  G  G P   G SG  G  G  G  G RG  G R   G+ G  G+PGP GP+G
Sbjct:  775 TGFPGAAGRVGPAGPAGIVGPPGPTGAQGKDGPRGLRGDVGPAGPQGENGLIGPPGLSGEKGSPGESGPMGPPGIAG------------------------------------PQGQLGSQGFNGLPGSRGERGLPGAAGSVGEAGRVGPSGSPGPRGPSGNIGLPGMTGPQGEAGREGSPGNDGPPGRPGAAGIKGD------------------------------------RGEPGSPGPLGIAGAPGPLGPS---GAVGRPGNRGEAGSAGPSGAVGPAGARGAPFLQGPSGPRGEKGVAGDKGDRGMKGLR---GHPGLQGMPGPNGPSG 1031          
BLAST of Collagen F-8 vs. Ensembl Cavefish
Match: col1a1a (collagen, type I, alpha 1a [Source:ZFIN;Acc:ZDB-GENE-030131-9102])

HSP 1 Score: 126.716 bits (317), Expect = 1.170e-28
Identity = 66/246 (26.83%), Postives = 114/246 (46.34%), Query Frame = 2
Query: 4328 DTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQS-HMKSLTSFKKTENPRQWWLSEILD-----QNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            D N +     ++ + +  L + + SI+ P G+K NPAR CRD+ + +P   SG +WIDP+ G   D+I+V C    E+ +TCV  ++     K+  + K  +  +  W  E +      + G +  K +   + QL FL+++ T+A Q +T  C  +  Y D  + N   A+ ++  N        + ++++E  S       +D C         +       KT  LPI+DI   D G  NQ+ 
Sbjct: 1191 DANVMRDRDLEVDTTLKSLSQQIESIRSPDGTKKNPARTCRDLKMCHPDWKSGEYWIDPDQGCNQDAIKVYCNM--ETGETCVYPSQSDIPQKNWYTSKNIKEKKHVWFGEAMTDGFQFEYGGEESKPEDVNI-QLTFLRLMSTEASQNITYHCKNSIAYMDQASGNLKKALLLQGSN--------EIEIRAEGNSRFTYSVTEDGCTSHTGAWGKTVIDYKTTKTSRLPIIDIAPMDVGAPNQEF 1425          

HSP 2 Score: 60.8474 bits (146), Expect = 1.372e-8
Identity = 49/100 (49.00%), Postives = 53/100 (53.00%), Query Frame = 2
Query: 2429 GERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GERGE G  G  G  GL G  GA G  G PG  G  G  G+ GP+G  G  G  G  G PG  G VG RG+PGA GN G +G  G  G PG  G  G QG
Sbjct:  613 GERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGLPGEAGATGPSGSRGDRGFPGERGAPGPAGPVGSRGSPGAAGNDGAKGESGASGAPGAQGPPGLQG 712          

HSP 3 Score: 52.7582 bits (125), Expect = 4.650e-6
Identity = 50/112 (44.64%), Postives = 53/112 (47.32%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGID------------------GNPGAKGAVGPRGTPGARGNIGYRGFDGIPG 2692
            GP G PGERG    PG+VGP G  G  G  G  G PGS G  GS GS GP G  G  G +G D                  G PG KGA G  G PG RG +G  G  G PG
Sbjct:  487 GPKGAPGERGG---PGAVGPKGATGEPGRNGEPGMPGSKGMTGSPGSPGPDGKTGATGPAGQDGRPGPPGPVGARGQPGVMGFPGPKGAAGEAGKPGERGVMGAIGVAGAPG 595          

HSP 4 Score: 51.9878 bits (123), Expect = 7.393e-6
Identity = 53/128 (41.41%), Postives = 63/128 (49.22%), Query Frame = 2
Query: 2420 GYPGERG---ETGEPGSVGPTGLIGSIGAPGSTGD---------PGSDGERGSIGSRGP------------TGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            G+PG +G   E G+PG  G  G IG  GAPG  GD          G  GERG  G  GP            TG+PGK G  G+   PG  GA GP G+   RG+ G+ G  G PGP GP G++G  G 
Sbjct:  565 GFPGPKGAAGEAGKPGERGVMGAIGVAGAPGKDGDVGAPGAPGAAGPSGERGEQGPAGPPGFQGLPGPQGATGEPGKPGEQGL---PGEAGATGPSGS---RGDRGFPGERGAPGPAGPVGSRGSPGA 686          
BLAST of Collagen F-8 vs. Ensembl Cavefish
Match: col11a2 (collagen, type XI, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-000208-23])

HSP 1 Score: 125.946 bits (315), Expect = 2.427e-28
Identity = 64/240 (26.67%), Postives = 122/240 (50.83%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLS-------EILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKN-HDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L + + +++ P+G+K +PAR C+D+ LS P+ T   +WIDPN G   DS +V C F     +TC+  +K+     + S+ K E P  W+           +D NG  +  +      Q+ FL++L  +A Q +T  C+ +  + DS + N +  A+     N+  I    +  +K+          + D C  R +    +  +I+  + E LP++D+++ DFG +NQK 
Sbjct: 1563 MEEVFGSLNSLRQEIEAMRFPLGTKDSPARTCQDLLLSQPEYTD-EYWIDPNQGCTRDSFKVYCNFTAGG-ETCLYPSKEVENVKMNSWPK-EKPGTWYSRFAKGSKMSYVDSNGEPVGVV------QIGFLRLLSLQARQNLTYHCHHSVAWADSTSGNGYQRALHFLGSNEEEISYETNPYIKA----------LSDGCSYR-KGYDRTVLEINTPQVEQLPLLDMKITDFGENNQKF 1782          

HSP 2 Score: 78.5666 bits (192), Expect = 7.336e-14
Identity = 63/259 (24.32%), Postives = 106/259 (40.93%), Query Frame = 2
Query:  221 IIKPNNVFGMYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPF-IQTQTGMCSMP---GSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHF----REPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQ--MAEVIPLTR----EIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNT 955
            I K    +GM     L SL + ++T  +       +   D+L+ +++   P  +Q   G C+      +   Y +  +A +   +  +F   +   +FSI+   K        + S+ +  G   L  ++GR  V  +    R P      +     L D  WHR+A+SV    + L +DC+  M + +P +     +   I V G   L  + + G IQ L I    +AAY  CE Y+ DC      +   Q  D NT
Sbjct:    3 IRKKRRPWGME----LISLGLMTITLALCELPQAQAEPVDVLRVMQLNSLPEGVQKVPGFCTSRRAGTADHAYRITKKAQISAPTKQLFS--RFPENFSIMALVKAKPGLQAFLLSIYNEQGVQQLGLELGRSPVFLYEDQSRMPAPEDYPLFTGINLAD-GWHRIAISVQKKNVTLLLDCKKRMTKALPRSNKPVLDTKGITVFGARLLDEEVFQGDIQQLLIASNPQAAYDFCEHYSPDC---DSPLPKVQAQDPNT 251          

HSP 3 Score: 59.3066 bits (142), Expect = 4.235e-8
Identity = 46/97 (47.42%), Postives = 54/97 (55.67%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPG 2701
            G +G  G+RG  G PG  G  G  G+ GA G  G PG DGERG  G  GP G PG+         PG +G +GP+G PG  G+ G RG DG PGP G
Sbjct:  570 GETGIKGDRGFDGLPGLPGDKGYRGNNGAMGPVGPPGEDGERGDDGDVGPRGLPGE---------PGPRGLLGPKGPPGIAGSQGVRGSDGPPGPKG 657          

HSP 4 Score: 57.3806 bits (137), Expect = 1.699e-7
Identity = 47/110 (42.73%), Postives = 60/110 (54.55%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGT---PGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            QG +G PGE+G TG+PG  G  G  G  G PG  G  G+ G +G  G +G  G PG  G+ G+ G  G KG  G +G    PG +G+ G +G  G  G PGP G  G +G
Sbjct:  683 QGATGPPGEKGPTGKPGLPGMPGADGPPGHPGKEGPSGTKGNQGPSGPQGSIGYPGPRGIKGVQGIRGLKGHKGEKGEDGFPGIKGDFGVKGERGEVGVPGPRGEDGPEG 792          

HSP 5 Score: 55.8398 bits (133), Expect = 5.385e-7
Identity = 45/101 (44.55%), Postives = 57/101 (56.44%), Query Frame = 2
Query: 2426 PGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            PG +G TG PG  GPTG  G  G PG+ G PG  G+ G  G++   G+ G  G  G  G PG +G  G +G  G +G+ G +G DG PG  G  G KGE+G
Sbjct:  680 PGPQGATGPPGEKGPTGKPGLPGMPGADGPPGHPGKEGPSGTK---GNQGPSGPQGSIGYPGPRGIKGVQGIRGLKGHKGEKGEDGFPGIKGDFGVKGERG 777          

HSP 6 Score: 55.8398 bits (133), Expect = 5.431e-7
Identity = 40/99 (40.40%), Postives = 52/99 (52.53%), Query Frame = 2
Query:  980 MGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGND-----VARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPG 1261
            +G+PGE+G  GK    GL G  G PGP G   ++P   G  G D      A++A  +  L    + +KG  G  G TG PGP G+ G  G KGE+G PG
Sbjct:  442 VGDPGERGPPGK---AGLPGADGVPGPPGTSVMLPFRFGQSGGDKGPAVSAQEAQAQAILSQARLALKGPPGPMGFTGRPGPLGTPGSNGLKGESGDPG 537          

HSP 7 Score: 54.6842 bits (130), Expect = 1.208e-6
Identity = 43/89 (48.31%), Postives = 54/89 (60.67%), Query Frame = 2
Query: 3833 GKQGPLGEPG---LSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGE 4090
            GK+GP G  G    SGPQG  G  G RGIKG  GI+G+KG +G +G  G  G+KG+ G  G+ G +G  GP+G  GP G +G  G  GE
Sbjct:  714 GKEGPSGTKGNQGPSGPQGSIGYPGPRGIKGVQGIRGLKGHKGEKGEDGFPGIKGDFGVKGERGEVGVPGPRGEDGPEGPKGRVGPPGE 802          

HSP 8 Score: 54.6842 bits (130), Expect = 1.239e-6
Identity = 52/133 (39.10%), Postives = 59/133 (44.36%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGD---------------------------PGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GP G PGE G  G  G  GP G+ GS G  GS G                            PG  G  G  G +GPTG PG  G+ G DG PG  G  GP GT G +G  G +G  G PGP G  G +G +G
Sbjct:  618 GPRGLPGEPGPRGLLGPKGPPGIAGSQGVRGSDGPPGPKGNLGPQGEPGPPGQQGGPGTQGMPGPQGATGPPGEKGPTGKPGLPGMPGADGPPGHPGKEGPSGTKGNQGPSGPQGSIGYPGPRGIKGVQGIRG 750          

HSP 9 Score: 54.6842 bits (130), Expect = 1.260e-6
Identity = 60/163 (36.81%), Postives = 78/163 (47.85%), Query Frame = 2
Query: 3020 MGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPG---------------------FKGPEGTRGSTGNPGDQ---GMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGE---VGVPGLPGLQGEPGTK 3427
             GP G  GP G PGLPG+ G+ G PG  G+ GP G                      KG +G RG  G+ G++   G PG+ G+ G +GE+G+                   G+PG  G  G +GP G +G  GE G +GP+GE   +GVPGLPG  G  G K
Sbjct:  686 TGPPGEKGPTGKPGLPGMPGADGPPGHPGKEGPSGTKGNQGPSGPQGSIGYPGPRGIKGVQGIRGLKGHKGEKGEDGFPGIKGDFGVKGERGE------------------VGVPGPRGEDGPEGPKGRVGPPGEIGSLGPVGEKGKLGVPGLPGYPGRQGPK 830          

HSP 10 Score: 53.5286 bits (127), Expect = 2.557e-6
Identity = 49/125 (39.20%), Postives = 64/125 (51.20%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSG------------------IDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            GP G+PG+ G +G  G+ GP+G  GSIG PG  G  G  G RG  G +G  G+ G  G+ G                   DG  G KG VGP G  G+ G +G +G  G+PG PG  G +G +G+
Sbjct:  708 GPPGHPGKEGPSGTKGNQGPSGPQGSIGYPGPRGIKGVQGIRGLKGHKGEKGEDGFPGIKGDFGVKGERGEVGVPGPRGEDGPEGPKGRVGPPGEIGSLGPVGEKGKLGVPGLPGYPGRQGPKGS 832          

HSP 11 Score: 51.9878 bits (123), Expect = 6.962e-6
Identity = 46/108 (42.59%), Postives = 59/108 (54.63%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGP---QGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQ---------------GLKGEIGSSGKEGPMGED---GPKGAIGPRGQRGDPGLAGER 4093
            G  GP G PG  GP   +G QGP+G +G  G  G +G+KGV+G+RG +G +               G+KGE G  G  GP GED   GPKG +GP G+ G  G  GE+
Sbjct:  705 GADGPPGHPGKEGPSGTKGNQGPSGPQGSIGYPGPRGIKGVQGIRGLKGHKGEKGEDGFPGIKGDFGVKGERGEVGVPGPRGEDGPEGPKGRVGPPGEIGSLGPVGEK 812          

HSP 12 Score: 51.9878 bits (123), Expect = 7.323e-6
Identity = 38/76 (50.00%), Postives = 48/76 (63.16%), Query Frame = 2
Query: 1718 GPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTR---GYKGERGKPGGFGPKGDIGKAG 1936
            GP G +G QG  G  GS G PG  GIKG QG++G  GH G++G+DG  G +   G KGERG+ G  GP+G+ G  G
Sbjct:  717 GPSGTKGNQGPSGPQGSIGYPGPRGIKGVQGIRGLKGHKGEKGEDGFPGIKGDFGVKGERGEVGVPGPRGEDGPEG 792          
BLAST of Collagen F-8 vs. Ensembl Cavefish
Match: col5a1 (procollagen, type V, alpha 1 [Source:ZFIN;Acc:ZDB-GENE-041105-6])

HSP 1 Score: 124.79 bits (312), Expect = 4.993e-28
Identity = 60/239 (25.10%), Postives = 113/239 (47.28%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWW-------LSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L+  +  ++ P+G++SNPAR C+D+ L +P      +WIDPN G   DS +V C F     ++C+   K+S    +  + K ++P  W+       +    D  GN +  +      Q+ FL++L   A Q +T  C ++  ++D    ++D AIR    ND  +    +  +++      L+   +   +           +I+  K E +P VDI   DFG   QK 
Sbjct: 1179 MEEIFGSLNSLKLEIEQMKHPLGTQSNPARTCKDLQLCHPDFPD-EYWIDPNQGCSRDSFKVYCNF-TAGGESCIYPDKKSDGSKMARWPK-DSPGTWYSRYKRGSMLSYADAEGNPIGVV------QMTFLRLLSASARQNLTYNCYQSVAWHDQDLDSYDKAIRFLGSNDEEMSYDNNPYIRAAVDGCALKKGYEKTVL-----------EINTPKVEQVPFVDIMFNDFGGATQKF 1397          

HSP 2 Score: 56.9954 bits (136), Expect = 2.549e-7
Identity = 51/126 (40.48%), Postives = 64/126 (50.79%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGS----------TGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGT---------PGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            G  G+PG+ G +GE G++GP G  G IG PG            GD G  G+RG +G+ GP G+ G +G  G  G PG  G +GP G          PG  G  G +G  G  G PG NG KG +GT
Sbjct:  342 GEKGHPGKEGPSGEKGNMGPPGAQGPIGYPGPRGGEDGFTGFKGDMGIKGDRGELGAAGPRGEDGPEGPKGRSGLPGDAGPLGPTGEKGKLGVPGLPGYPGRQGPKGSQGFQGFPGANGEKGTRGT 467          

HSP 3 Score: 55.0694 bits (131), Expect = 9.340e-7
Identity = 55/123 (44.72%), Postives = 67/123 (54.47%), Query Frame = 2
Query: 2408 QGPSGYPGERGE----TGEPGSVGPTGLIGSIGAPGSTGDPGSDGERG------SIGSRGPTGDPGKDGLSGIDGNP---GAKGAVGPRGTPGARGNIGYRGFDGIPGP---PGPNGAKGEQG 2728
            QGP GYPG RG     TG  G +G  G  G +GA G  G+ G +G +G        G  GPTG+ GK G+ G+ G P   G KG+ G +G PGA G  G RG  G PGP    GP G +GE+G
Sbjct:  365 QGPIGYPGPRGGEDGFTGFKGDMGIKGDRGELGAAGPRGEDGPEGPKGRSGLPGDAGPLGPTGEKGKLGVPGLPGYPGRQGPKGSQGFQGFPGANGEKGTRGTAGKPGPRGQRGPTGPRGERG 487          

HSP 4 Score: 54.299 bits (129), Expect = 1.365e-6
Identity = 49/100 (49.00%), Postives = 56/100 (56.00%), Query Frame = 2
Query: 2429 GERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTP------GARGNIGYRGFDGIPGPPGPNG 2710
            GE GE G  G  GP G +G  G PG  G  GSDG RG  G  GP GD G DGL+G+ G  G +G  GP+G P      G RG+ G  G  G+PG PGP G
Sbjct:  183 GESGEQGTQGPRGPMGSLGPPGKPGRRGRAGSDGARGMPGQTGPKGDRGFDGLAGLPGEKGHRGETGPQGPPGPSGEDGERGDDGEVGPRGLPGEPGPRG 282          

HSP 5 Score: 51.6026 bits (122), Expect = 9.570e-6
Identity = 42/96 (43.75%), Postives = 53/96 (55.21%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGL---------KGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G+ GP G  G SG  G+ GP G  G KG +G+ G+ G  G +GP+G QG          KG  G++GK GP G+ GP G  G RG RG  G AG +
Sbjct:  403 GEDGPEGPKGRSGLPGDAGPLGPTGEKGKLGVPGLPGYPGRQGPKGSQGFQGFPGANGEKGTRGTAGKPGPRGQRGPTGPRGERGPRGPTGKAGPK 498          
BLAST of Collagen F-8 vs. Ensembl Cavefish
Match: col11a2 (collagen, type XI, alpha 2 [Source:ZFIN;Acc:ZDB-GENE-000208-23])

HSP 1 Score: 120.939 bits (302), Expect = 1.371e-27
Identity = 65/240 (27.08%), Postives = 121/240 (50.42%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLS-------EILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKN-HDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +++++ +++ L + + +++ P+G+K +PAR C+D+ LS P+ T G +WIDPN G   DS +V C F     +TC+  +K+  M S       E P  W+           +D NG  +  +      Q+ FL++L  +A Q +T  C+ +  + DS + N +  A+     N+  I    +  +K+          + D C  R +    +  +I+  + E LP++D+++ DFG +NQK 
Sbjct:  345 MEEVFGSLNSLRQEIEAMRFPLGTKDSPARTCQDLLLSQPEYTDGEYWIDPNQGCTRDSFKVYCNFTAGG-ETCLYPSKEVKMNSWPK----EKPGTWYSRFAKGSKMSYVDSNGEPVGVV------QIGFLRLLSLQARQNLTYHCHHSVAWADSTSGNGYQRALHFLGSNEEEISYETNPYIKA----------LSDGCSYR-KGYDRTVLEINTPQVEQLPLLDMKITDFGENNQKF 562          
BLAST of Collagen F-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003197.1 (pep scaffold:Pmarinus_7.0:GL479090:2162:37629:-1 gene:ENSPMAG00000002618.1 transcript:ENSPMAT00000003197.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.028 bits (323), Expect = 4.122e-30
Identity = 64/231 (27.71%), Postives = 110/231 (47.62%), Query Frame = 2
Query: 4358 KLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGN-KMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            +L ++I  L   + ++  P GS+ NPAR CR++ L  P + SG +WIDPN GS +D+I+V C    E+ ++C++A   S  +     K + + +  W    +  +      +  +    QL FL++  T+A Q +T  C  +  Y D    N   A+ ++  N        + ++++E  S L    ++D C         +  +    KT  LPIVDI  KD G  +Q+ 
Sbjct:  957 ELEASISSLNVRVENMVSPDGSQKNPARTCRNLKLCYPDLPSGLYWIDPNEGSKSDAIQVWCNM--ETGESCMNADNPSIARKNWWLKPSGSKKHVWFGVTMSPDAQFTYGEDSHSTEIQLTFLRLFSTEASQKITYHCKNSVAYQDGAVGNLQQALLLQGSN--------EMEIRAEGNSKLAYSVLEDGCTMHTGQWGKTVIEYRTPKTSRLPIVDIAPKDVGGPDQEF 1177          

HSP 2 Score: 55.8398 bits (133), Expect = 1.022e-7
Identity = 47/103 (45.63%), Postives = 56/103 (54.37%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            G PG+RGE G  G  G  G  G  G  G +G+ GS G  G++GS G  GD G+DG +G DG PG  G  GP+G  G  GN G  G  G  GP G  G+ G  G
Sbjct:  712 GLPGQRGERGFSGPAGLVGEAGKQGPVGPSGERGSAGPAGAMGSAGSPGDSGRDGAAGADGLPGRDGPQGPKGDRGPPGNAGPAGAPGASGPSGQAGSPGRTG 814          

HSP 3 Score: 53.9138 bits (128), Expect = 3.750e-7
Identity = 50/106 (47.17%), Postives = 59/106 (55.66%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGL---SGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            G PG+ G  G  GS GP+GL GS G     G PG  GERG  G  G  G+ GK G    SG  G+ G  GA+G  G+PG  G  G  G DG+PG  GP G KG++G
Sbjct:  685 GAPGDDGPVGAEGSPGPSGLAGSRGV---VGLPGQRGERGFSGPAGLVGEAGKQGPVGPSGERGSAGPAGAMGSAGSPGDSGRDGAAGADGLPGRDGPQGPKGDRG 787          

HSP 4 Score: 51.2174 bits (121), Expect = 2.750e-6
Identity = 41/88 (46.59%), Postives = 45/88 (51.14%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
             GKQGP+G  G  G  G  G  G  G  G  G  G  G +G+ G  GPQG KG+ G  G  GP G     GA GP GQ G PG  GER
Sbjct:  732 AGKQGPVGPSGERGSAGPAGAMGSAGSPGDSGRDGAAGADGLPGRDGPQGPKGDRGPPGNAGPAGA---PGASGPSGQAGSPGRTGER 816          
BLAST of Collagen F-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001576.1 (pep scaffold:Pmarinus_7.0:GL476350:400893:424819:1 gene:ENSPMAG00000001417.1 transcript:ENSPMAT00000001576.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 1.425e-29
Identity = 72/240 (30.00%), Postives = 114/240 (47.50%), Query Frame = 2
Query: 4340 IISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMS----QLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            + + LK L + ID       SI+ P GS+ NPAR CRD+ L +P+  SG+++IDPN G   D+I+V C    ES +TCV A+ Q+  +      K+++ +  W  E ++            P +    Q+ FL++L T+A Q +T  C  +  Y D    N   A+ ++  ND  I        ++E  S      ++D C         +  +   +KT  LPIVDI   D G  +Q+ 
Sbjct:  512 VDATLKSLTNQID-------SIRSPEGSRKNPARTCRDLKLCHPEWKSGDYFIDPNQGCTLDAIKVFCNM--ESGETCVYASPQNVPRKSWWTNKSKDRKHIWFGETMNSGSQFNYGDDSLPPNTAAIQMTFLRLLSTEASQNITYHCKNSIAYMDEQAGNLKKALLLQGSNDIEI--------RAEGNSRFTYNVLEDGCTKHTGDWGQTVLEYRTQKTSRLPIVDIAPLDIGGVDQEF 734          

HSP 2 Score: 58.9214 bits (141), Expect = 1.087e-8
Identity = 42/87 (48.28%), Postives = 52/87 (59.77%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGS---RGPTGDPGKDGLSGIDGNPGAKGAVGPRGT---PGARGNI 2662
            G PGERGETG PG  G  G  GS G PG+ G+ G  G++G  G+   +GP G PG  G +G+ G  GA+GA GP G    PGA G +
Sbjct:   76 GSPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGESGQKGDAGAPGPQGPAGSPGPQGPNGVPGPKGARGAQGPSGATGFPGAAGRV 162          

HSP 3 Score: 49.2914 bits (116), Expect = 9.306e-6
Identity = 54/140 (38.57%), Postives = 57/140 (40.71%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERG---------------------------------SIGSRGPTGDPGKDGLS---GIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            G PGERG  G PG   P G  G  G  G  G PG DG RG                                 S G RG TG PG  G +   G DG PGAKG  G  G  G  G  G +G  G PGP GPNG  G +G 
Sbjct:    7 GMPGERGTAGAPG---PKGDRGDGGEKGPEGAPGKDGSRGLTGPIGPPGPSGSAGDKGEAGPPGPTGPAGTRGSPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGESGQKGDAGAPGPQGPAGSPGPQGPNGVPGPKGA 143          
BLAST of Collagen F-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001071.1 (pep scaffold:Pmarinus_7.0:GL476837:726:42204:1 gene:ENSPMAG00000000855.1 transcript:ENSPMAT00000001071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 126.331 bits (316), Expect = 3.245e-29
Identity = 66/233 (28.33%), Postives = 107/233 (45.92%), Query Frame = 2
Query: 4361 LYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTS--GNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCP--MSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            L ++I  L   + SI  P GS+ +PAR CRD+ L +P+  S  G +WIDPN G   D+I+V C    E+ ++CV+    S  +      +  + +  WL E +   G++       P    QL FL++L T A Q +T  C  +  Y DS   N   A+        ++    D ++++E  S      ++D C         +  +   +KT  LP +DI   D G  +Q+ 
Sbjct: 1044 LDASIKALNAQVESITSPDGSRKHPARSCRDLMLCHPEYKSDTGEYWIDPNEGCRADAIKVWCNM--ETGESCVNPGMPSLPRKNWWRSQAADKKHVWLGETMSP-GSQFTYGDGSPNMEVQLTFLRLLSTDASQKITYHCKNSVAYLDSRAGNLKKAL--------MLQGSSDVEIRAEGNSRFTYSVLEDGCTTHTGVWGKTVIEYRTQKTSRLPFMDIAPMDVGGSDQEF 1265          
BLAST of Collagen F-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009617.1 (pep scaffold:Pmarinus_7.0:GL476473:139194:170406:1 gene:ENSPMAG00000008685.1 transcript:ENSPMAT00000009617.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 117.472 bits (293), Expect = 1.149e-26
Identity = 61/239 (25.52%), Postives = 108/239 (45.19%), Query Frame = 2
Query: 4358 KLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMS----QLVFLQMLHTK-----AEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            ++ ++I  L   +  ++ P G++ NPAR CRD+ L +P+  SGN+WIDPN G   D+++V C    E+ +TCV A  Q+  +      K+ + +  W  E +    +        P +    Q+ FL++L  +     A   +T  C  +  Y D    N   A+ ++  N        D ++++E  S      ++D C         +  +   +KT  LP VD+   D G  +Q+ 
Sbjct:  654 EVDASIKSLSGQIEGLRSPEGTRKNPARTCRDLKLCHPEWESGNYWIDPNQGCTLDALKVFCNM--ETGETCVYANPQTISRKNWWQSKSADRKHVWFGEAMSGGLHFNYGDDNLPANTAAIQMTFLRLLSMEAYDLPAAANITYHCKNSIAYMDEETGNLKKALLLQGSN--------DMEIRAEGNSRFTYNVLEDSCTKHTGEWGRTVVEYRTQKTSRLPFVDVAPMDVGGPDQEF 882          

HSP 2 Score: 66.2402 bits (160), Expect = 6.021e-11
Identity = 54/118 (45.76%), Postives = 67/118 (56.78%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGS---RGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIG---------YRGFDGIPGPPGPNGAKGEQG 2728
            G  G PGERGETG PG  G  G  GS G PG+ G+ G  G++G  G+   +GP+G PG  G +G+ G  GA+GA GP   PGAR   G         ++G  G PGP GPNG  G +G
Sbjct:  215 GARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGARGAQGP--PPGARALCGPAVDVAPVPFQGNPGSPGPAGPNGKDGPKG 330          

HSP 3 Score: 49.6766 bits (117), Expect = 6.957e-6
Identity = 58/158 (36.71%), Postives = 67/158 (42.41%), Query Frame = 2
Query: 2417 SGYPGERGETGEPGSVGPTGLIGSIGAPGS---------------------------------TGDPGSDGERGSIGSRGPTGDPGKDGLSGI---------------DGNPGAKGAVGP---RGTPGARGNIGYRGFDGIPGPPGPN---GAKGEQG 2728
            SG  GERG  GE G+ GP GL G+ G PG+                                 TG  G+ G+RG  G +GP G PGKDG  G+                G+ G  G  GP   RG PG RG  G  G  G  GPPG +   GAKGEQG
Sbjct:   94 SGARGERGFPGERGAPGPQGLQGARGLPGTPGTDGPKGATGPGGPPGAQGPPGLQGMPGERGATGISGAKGDRGDSGEKGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQG 251          

HSP 4 Score: 49.6766 bits (117), Expect = 7.701e-6
Identity = 49/103 (47.57%), Postives = 59/103 (57.28%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            G  G +GE GE G+ G  G  GS GAPG  G  G +G RG  G +GP G PG  G  G+ G  G +G  G  G  G RG  G+RGF G+ G PGP G+ G+QG
Sbjct:  450 GAAGAKGERGEAGAAGQPGAPGSPGAPGPVGPTGKNGARGDQGPQGPMGPPGPSGARGLPGPQGPRGDKGETGEAGERGIKGHRGFTGLQGLPGPPGSSGDQG 552          

HSP 5 Score: 49.2914 bits (116), Expect = 9.357e-6
Identity = 53/114 (46.49%), Postives = 59/114 (51.75%), Query Frame = 2
Query: 2408 QGPSGYPGE---RGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLS---GIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +GP G PG+   RG TG  G  GP G  G  G  G  G  G  G RG+ G RG TG PG  G +   G DG PGAKG  G  G  G  G  G +G  G PGP GPNG  G +G 
Sbjct:  172 KGPEGAPGKDGGRGVTGPIGPPGPAGAHGDKGDAGPAGPTGPSGARGAPGERGETGPPGPAGFAGPPGSDGQPGAKGEQGETGQKGDAGAPGPQGPSGAPGPQGPNGVSGPKGA 285          
BLAST of Collagen F-8 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005318.1 (pep scaffold:Pmarinus_7.0:GL477895:43798:56979:-1 gene:ENSPMAG00000004829.1 transcript:ENSPMAT00000005318.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 1.063e-23
Identity = 64/243 (26.34%), Postives = 108/243 (44.44%), Query Frame = 2
Query: 4349 ILKKLYSNID----KLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSAT-KQSHMKSLTSFKKTENPRQWWLSEILD-----QNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
             LK+  + +D     L   + +I  P G+K++PAR CRD+ L +    SG +WIDPN GS+ D+++V C    E+ +TCV    K    K+  S K +   +  W  E +        G+         + QL FL+++  +A Q +T +C  +  Y D+   +   A+R+            + +L+++  +      ++D C         +  Q    K   LPIVDI   D G   Q+ 
Sbjct:  371 ALKEHDAEVDVTLKSLTNQLENIMSPEGTKTDPARSCRDLMLCHSDWKSGEYWIDPNEGSVLDAMKVWCNM--ETGETCVYPKPKNVPSKNWWSNKGSREHKHVWFGEAMPGGFHFSYGDDTMSANIAEV-QLNFLRLVAAEASQNITYLCRNSVAYADAAG-SLRKAVRLMGSG--------ELELRADGKNRFTYSMLEDGCAKHTGEWGKTVLQYKTNKPSRLPIVDIAPLDIGGPEQEF 601          

HSP 2 Score: 58.151 bits (139), Expect = 1.677e-8
Identity = 49/110 (44.55%), Postives = 59/110 (53.64%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDP---GSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +G  G PG  G TG  G  GPTG  G  GAPG+ G P   G+ GE G  GS G  G  G+DGL+G+ G+ G  G  G  G PG  GN G  G +G  G  G  G +G+ G
Sbjct:  115 RGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSG 224          

HSP 3 Score: 56.6102 bits (135), Expect = 4.215e-8
Identity = 49/114 (42.98%), Postives = 60/114 (52.63%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPR------GTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            + G  G  G+RGE G PG  GPTG +G  G  G  G+ G+ G  GS G  G  G+ G++G SG DG  G  G  G R      GTPG  GN G  G  G+ G  G +G +GE G
Sbjct:  105 SHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETG 218          

HSP 4 Score: 56.225 bits (134), Expect = 5.586e-8
Identity = 53/113 (46.90%), Postives = 60/113 (53.10%), Query Frame = 2
Query: 2408 QGPSGYPGERGETG---EPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIP---GPPGPNGAKGEQG 2728
            QG  G  G RG+TG   EPG  GPTGL+G+ G  G  G  G+ G  G+ GS G  G  G  GLSG  G  G  G  GP G+ G  G  G +G  G P   G PG NGA GE G
Sbjct:   49 QGKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESG 161          

HSP 5 Score: 55.8398 bits (133), Expect = 7.792e-8
Identity = 44/98 (44.90%), Postives = 55/98 (56.12%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPG 2701
             G  G  G RG+ GEPG+ G  G  G++G PG +G  G DG RG  G +G +G  G+ G +G  G  G  GA G RG  G RG  G+RG+ G  G PG
Sbjct:  172 SGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPG 269          

HSP 6 Score: 55.4546 bits (132), Expect = 1.164e-7
Identity = 50/115 (43.48%), Postives = 60/115 (52.17%), Query Frame = 2
Query: 2405 NQGPSGYPGERGET------GEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            + G  G PGE G T      GE G  GP+G  G+ GAPGS+G  GS G +G  G RG  G PG +G +G  G  G  G  G RG P   GN+G  G +G PG  G  G+ G  G 
Sbjct:   60 DTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAP---GNVGSPGLNGAPGESGREGSSGTDGA 171          

HSP 7 Score: 55.0694 bits (131), Expect = 1.357e-7
Identity = 51/116 (43.97%), Postives = 57/116 (49.14%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIP---------GPPGPNGAKGEQG 2728
             GP+G  GERG  G  GS G  G  G  G  GS+G  G+ G  G  G RG  G+PG  G  G  GN G  G  G  G  G RG  G +G  GI          GP GPNGA GE+G
Sbjct:  133 SGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERG 248          

HSP 8 Score: 51.9878 bits (123), Expect = 1.174e-6
Identity = 46/108 (42.59%), Postives = 57/108 (52.78%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            +GPSG  G  G  G  G +G  G+ G  G  G  G PG +G  GS+G  GPTG+ G+ G  G  G+PG  GA G  G  G+ G  G  G DG+    G  G +GE GT
Sbjct:   85 RGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGRDGL---AGVRGDRGEPGT 189          

HSP 9 Score: 51.2174 bits (121), Expect = 2.263e-6
Identity = 41/91 (45.05%), Postives = 51/91 (56.04%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGG------VGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAG 4087
            G+ GP G  G  G +GE+GP+G RG  G       +G  G++G+ G RG +G  GL G  GS GK GP GE G +GA    G  G PGL G
Sbjct:   68 GEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGERGVPGLNGPTGSLGKSGPTGEQGERGAP---GNVGSPGLNG 155          

HSP 10 Score: 50.447 bits (119), Expect = 3.971e-6
Identity = 69/202 (34.16%), Postives = 82/202 (40.59%), Query Frame = 2
Query: 3023 GPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNGAKGVQGIVGEDGPIGQPGNPGRQG 3628
            G  G  GP G  G PG  G PG  G +G  G  G +GP GTRG+ G PG  G  G  G  G  G++G+R                        G  G+ GP G +G+ G  G  G  G  G  G PGL G PG  G +GS G  G  G                            +G  GV+G  GE G  G+PGNPG  G
Sbjct:   50 GKDGSMGPRGDTGTPGEPGEPGPTGLLGNQGERGERGPSGTRGTAGAPGSSGFLGSHGIQGLSGQRGER------------------------GVPGLNGPTGSLGKSGPTGEQGERGAPGNVGSPGLNGAPGESGREGSSGTDGASGR---------------------------DGLAGVRGDRGEPGTPGRPGNPGNMG 200          

HSP 11 Score: 49.6766 bits (117), Expect = 5.537e-6
Identity = 40/103 (38.83%), Postives = 52/103 (50.49%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGV------------------RGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAG 4087
            G  GPLG  G +G  GE+G +G+RGIKG  G  G +G+ G+                  RGP GP G +G+ G +G+ GP         +GP G RG PG AG
Sbjct:  230 GSAGPLGPQGPNGAHGERGDSGERGIKGHRGWSGFQGLPGLPGPHGHQGGPGINGGSGPRGPTGPAGGRGKDGHNGQAGP---------LGPSGHRGRPGEAG 323          

HSP 12 Score: 49.2914 bits (116), Expect = 7.029e-6
Identity = 39/95 (41.05%), Postives = 50/95 (52.63%), Query Frame = 2
Query: 3827 SMGKQGPLGEPGLSGPQGEQGPTG------DRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            S G  G  G  GL+G +G++G  G      + G  G  G+ G  G +G RG  GPQG  G +G  G  GP+G  GP GA G RG  G+ G+ G R
Sbjct:  165 SSGTDGASGRDGLAGVRGDRGEPGTPGRPGNPGNMGNPGLSGANGKDGHRGETGPQGDSGIVGRPGSAGPLGPQGPNGAHGERGDSGERGIKGHR 259          
BLAST of Collagen F-8 vs. Ensembl Nematostella
Match: EDO42953 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S046])

HSP 1 Score: 144.05 bits (362), Expect = 2.179e-34
Identity = 82/268 (30.60%), Postives = 130/268 (48.51%), Query Frame = 2
Query: 4247 VNTGTRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKY-CPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            V  G  ++  A +++ K K +NP +               + ++K+E ++N+I++P G K+NPA+ C+D+ + +P   SG +WIDPN GS  D+I V C F  +   +C+S TK   +      +   N +  WLSE  ++      +I Y    SQ+ FL++   +A Q VT  C     Y    N+ H  +I++R  ND I   H     K +    L E   KDD   +      +   I  K+   LPIVD+ L DFG  +QK+
Sbjct: 1157 VEKGPGYRLYAGSKDAK-KPDNPSV------------SFMTALEKMEIDVNTIRKPTGMKNNPAKTCKDLRMDHPDYVSGYYWIDPNEGSKKDAIRVYCDFSNDF--SCISPTKAKLLN--LRVQANVNKKDKWLSEAFEEE----SQIDYSAEQSQIAFLRVFSKRAYQNVTYNCQN---YKAWTNRKH--SIKLRGDNDLIF--HAKSPKKFQPTVILNECTTKDDQWHK------TILAIDTKQKHRLPIVDMALFDFGKPHQKV 1390          

HSP 2 Score: 58.9214 bits (141), Expect = 2.433e-8
Identity = 52/131 (39.69%), Postives = 61/131 (46.56%), Query Frame = 2
Query: 3020 MGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQG 3412
             GPQGP G  G  GL G +G PGV G  G  G PG +GP G +G  G PG QG PG+PG+ G  G +G+R                           G  G  G MGE+G  G  GP G  G  G PG +G
Sbjct:  560 TGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGER---------------------------GTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRG 663          

HSP 3 Score: 55.4546 bits (132), Expect = 2.311e-7
Identity = 50/106 (47.17%), Postives = 55/106 (51.89%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GPSG  G +G  GEPG  G TG  G  GA G +G  GS G  G  G  G  G+PG+ G  G  G  GA G  GP G PG  G  G RG  G  G PG  G +G QG
Sbjct:  540 GPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQG 645          

HSP 4 Score: 53.1434 bits (126), Expect = 1.259e-6
Identity = 60/139 (43.17%), Postives = 67/139 (48.20%), Query Frame = 2
Query: 2411 GPSGYPGERGETGE---PGSVGPTGLIGSIGAPGSTGDPGSDGERGS---------IGSRGP------------TGDPGKDGLSGIDGNPGA---------KGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GP G PG RG TG    PG+ GP G  G  G+PG+ G PGS G++GS         +G RGP            TG PG DG  G  G PG           G  GP G  GA+G  G  G DG  GP GP GAKGE G
Sbjct:  435 GPIGDPGSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESG 573          

HSP 5 Score: 52.7582 bits (125), Expect = 1.490e-6
Identity = 60/136 (44.12%), Postives = 68/136 (50.00%), Query Frame = 2
Query: 3017 FMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGT 3424
              G  G  GP GSPGLPG +GS G  G  GE G PG  G  G RG++G PG  G+ G  G  G QGEKG+ G +GPPG PG                        L G+KGE G +G  G VG PG PG  G PG 
Sbjct:  148 IKGSNGAPGPRGSPGLPGPRGSDGPRGQRGEVGLPGESGSAGRRGASGPPGSPGIDGFSGAPGEQGEKGEAGPSGPPGFPG------------------------LKGQKGEEGNLGERGMVGRPGRPGFDGAPGA 259          

HSP 6 Score: 52.373 bits (124), Expect = 2.252e-6
Identity = 51/138 (36.96%), Postives = 64/138 (46.38%), Query Frame = 2
Query: 2420 GYPGERGETGEPGSVGPTGLIGSIGAPGSTGDP---------------GSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTP-------------------GARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            G  G+ G  GEPG  GP G  G  GAPG+ G P               G+DG+ G++G RGP G+ G  GL+G  G PG +G+ G  GTP                   G  GN G  G  G+PG  G  GA G +G+
Sbjct:  582 GVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGAKGS 719          

HSP 7 Score: 51.9878 bits (123), Expect = 2.688e-6
Identity = 137/383 (35.77%), Postives = 154/383 (40.21%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAV------------GPRGTPGARGNIGYRGFDG---IPGPPGPNGAKGEQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNIGLDGDFGPIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTR------------GSTGNPGD------------------QGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPG 3421
            QG  G PG  G  G PG+    GL G  GA GS G PG+ G +G  G +G  G  G DG  G  G PG KGA+            GP G PG  GN G  G +G    PG PG  G+KGE+G++G  G  G +G  G  G                      +G IG  G  GPIGD                               G  G  G +GF G  GPNG  G  G PG  G PG  GD G  G  G  G  G R            G TG PGD                  QGM G+PG  G  G KG  G+ G  G  G  GP G  G  G  G  G+ G  G  G  GE G  GP+G  G  G PG QG PG
Sbjct:  287 QGVRGAPGNEGARGLPGN---PGLKGKRGATGSRGSPGNQGPQGPSGPQGSKGQAGIDGRPGEPGLPGDKGAMGGPGPAGQPGIRGPSGAPGITGNPGATGINGDRGAPGRPGKIGSKGEKGSEGPNGSPGPRGAPGPPGK---------------------RGKIGRVGPMGPIGDP------------------------------GSRGATGPRGFPGAAGPNGRKGEQGSPGAAGFPGSKGDKGSSGKNGEPGRVGLRGPPGQPGSPGREGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPG 615          

HSP 8 Score: 51.6026 bits (122), Expect = 3.209e-6
Identity = 50/117 (42.74%), Postives = 64/117 (54.70%), Query Frame = 2
Query: 2408 QGPSGYPGERGET---GEPGSVGPTGLIGSIGAP---GSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGP---PGPNGAKGEQGT 2731
            +G +G PG+ G+T   G  G+ G +GL GS G P   G  G+ G  GERG +G +GP G PG  G  G+ G  G  G  G RGT G  G +G RG  G  GP    GP G  G++G+
Sbjct:  548 KGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGS 664          

HSP 9 Score: 51.2174 bits (121), Expect = 5.188e-6
Identity = 53/128 (41.41%), Postives = 63/128 (49.22%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAP------GSTGDPG---------------SDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +GP+G PGE G  GEPG  G  G  G  G P      GS G+PG               ++GE G  G++G  GD GKDG  G  G  G  G  G +G  G RG  G +GF G  G PG  G +GEQG
Sbjct:  975 RGPTGQPGENGLPGEPGKPGINGTNGRGGIPGLKGERGSPGEPGKAGKQGPPGPSGPLGANGEPGVQGAKGARGDDGKDGKQGPAGPQGPNGPQGDKGNRGPRGEKGDKGFTGSDGSPGAPGQQGEQG 1102          

HSP 10 Score: 50.8322 bits (120), Expect = 5.412e-6
Identity = 46/116 (39.66%), Postives = 61/116 (52.59%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGP---------TGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +G +G PG+ G+ G+PG+ G          TG+ G  G  G+ G  G  G+ G  G +GP G  G+ GL+G  G PG  G  G  G PG RG +G +G  G PG  GP G  G+ G
Sbjct:  506 EGKTGLPGDDGQDGKPGAPGKPDRLSLQGMTGMPGPSGVAGAKGANGEPGKDGDTGPQGPAGAKGESGLAGSRGMPGVAGKNGNAGEPGERGPVGPQGPQGAPGTQGPPGLPGKTG 621          

HSP 11 Score: 50.8322 bits (120), Expect = 6.625e-6
Identity = 55/139 (39.57%), Postives = 62/139 (44.60%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVG---PTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNP-------------GAKGAVGPRGTPG---------------ARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            QGP G PG +G  G PG  G   P G  G+ G PG+ G+ G  GE G  G  GPTG PG  G +G DG P             G  GA GP G PG               A G  G RG  G  GPPG +G  G  G+
Sbjct:  602 QGPQGAPGTQGPPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNGADGTPVSKHEFIRYFAIIGEPGAQGPSGNPGTPGRQGMPGASGRRGAPGAKGSRGERGRVGPPGIDGKDGAPGS 740          

HSP 12 Score: 50.447 bits (119), Expect = 8.319e-6
Identity = 40/86 (46.51%), Postives = 48/86 (55.81%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAG 4087
             GK G  GEPG  GP G QGP G  G +G     G+ G  G  GP+G +G  G+ G+ G+ GP GE GP G  GP G+ GD G  G
Sbjct:  584 AGKNGNAGEPGERGPVGPQGPQGAPGTQG---PPGLPGKTGESGPRGERGTDGKPGAMGERGPQGETGPTGLTGPTGKPGDRGSNG 666          
BLAST of Collagen F-8 vs. Ensembl Nematostella
Match: EDO49401 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGC7])

HSP 1 Score: 97.4413 bits (241), Expect = 1.842e-22
Identity = 64/222 (28.83%), Postives = 112/222 (50.45%), Query Frame = 2
Query: 4382 LEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            L   +   + P+G+  +PAR CRD+ L  P+  SG +WIDPN G   DSI V C F   +  +C+  T    MK  +     +     W ++  D +G++       P SQL+FL++L  +A Q +T  C  +  +YDS +++ D +I++++ N          +L + S +      +KDDC  +      +  +++ + T  LPIVDI + D G+ +++ 
Sbjct:   15 LSLRVGLFKNPLGTHRHPARTCRDLKLCRPEAESGQYWIDPNGGITEDSILVYCDFALNA--SCI--TPNQFMKWYSGRDGYK-----WFAQ--DLHGSQQFHYTSDP-SQLLFLRLLSDRASQKITYHCRNSVAWYDSRSRDFDKSIKLKSGN--------GIELYAASSNKYKPTIIKDDCGVKDGKWRKTVLEVNTESTHRLPIVDIAVFDIGDRDEEF 216          
BLAST of Collagen F-8 vs. Ensembl Nematostella
Match: EDO44729 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV66])

HSP 1 Score: 100.908 bits (250), Expect = 2.935e-21
Identity = 64/232 (27.59%), Postives = 104/232 (44.83%), Query Frame = 2
Query: 4319 IPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMS-QLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDI 5011
            + ++T+ I++  K LY     L +  +  + P+GS++NPA  C ++   N  +  G +WIDPN G  +D+I+V CKF K   ++CV    +   K   +   T     W+    L++      KI Y     QL FL++L TK  Q + + C    V++   +K++D + +   FN      +  R     S   +L    K D     RT    +      K   LPIVD 
Sbjct:  881 LKQNTHLIVNDKKSLY-----LSEMDDKSKTPLGSRANPALTCHELKHVN-GIKDGEYWIDPNQGCSSDAIKVYCKF-KTGGESCVRPALKMIPKETWNNATTAG---WYQFSKLERG----YKITYLTNKVQLNFLRLLTTKVTQKIIVKCKSVVVWFHRHSKSYDYSWKFHGFNGHQFTYNSSR-----SSLNVLRDACKYDDGRWRRT----ELLFETTKLRTLPIVDF 1089          

HSP 2 Score: 56.225 bits (134), Expect = 1.336e-7
Identity = 66/216 (30.56%), Postives = 88/216 (40.74%), Query Frame = 2
Query: 3023 GPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFK------------GPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ 3634
            GPQG  GPIG+ G+ G  G+PG+PG +G  GP G +            G +G  G  G+ G+ G+PG  G +GP G KG                          G  G  G  G  G  G  GP G +G  G+PG PG QG+PG                                         G+ G +G+QG+ G+ G IG PG+PG +G +
Sbjct:  173 GPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKG------------------------ILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKP---------------------------------------GIRGHEGLQGVSGKAGSIGDPGDPGDEGNE 325          

HSP 3 Score: 55.8398 bits (133), Expect = 1.811e-7
Identity = 46/108 (42.59%), Postives = 56/108 (51.85%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVG------PTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAK 2716
            GP G  GE G  G PG  G      P G +GS G PG  G PG  G +G  G +GP G PG  G  G+ G+ G+ G  G +G  G  G  G+RG  G PG  GP G++
Sbjct:  464 GPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGTPGDIGPPGSE 571          

HSP 4 Score: 54.6842 bits (130), Expect = 3.470e-7
Identity = 47/116 (40.52%), Postives = 65/116 (56.03%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDG------ERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPG---ARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            GP G  G+RG  G+PG  G  G IG+ G  G  GD G  G        G +GS+GP GD G+ G+ G +G  G++G  G  G PG    +G  G++G +G+PG PG  G +G +G+
Sbjct:  422 GPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGKRGLRGSEGS 537          

HSP 5 Score: 54.6842 bits (130), Expect = 3.650e-7
Identity = 50/120 (41.67%), Postives = 62/120 (51.67%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGD------------PGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            ++GP G PGE+G +G  G+VG  GLIG  G  G  G  G  GERGS G  G  GD             G  G+ G  G+PG  G+ GP G  G  G +G +G  G  G  GP+G +G QG
Sbjct:   27 DRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQG 146          

HSP 6 Score: 53.9138 bits (128), Expect = 6.060e-7
Identity = 93/217 (42.86%), Postives = 112/217 (51.61%), Query Frame = 2
Query: 2135 EKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDXXXXXXXXXXXXXXXXXXXXLKGDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSG------------IDGNPGAKGAVGP------RGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            ++GP GP G +G  G KG +G  G IG  G++G+ G  G +G  GS G SGL GD GP+GPPG PG  G  G  G SG  G  G  G  G  GP+G  G +G+ G  GS+GP+GL G  G  G  GD G DG  G  G  G TG PG  G  G              G PG  G++GP      +G  G +G+ GY G DG  G  G  G  G QGT
Sbjct:   27 DRGPRGPPGEQGFSGVKGAVGSHGLIGRKGEKGKEGRDGVKGERGSKGKSGLPGDKGPVGPPGHPGHKGAIGIIGKSGSPGKDGSEGPTGESGPTGALGAKGQKGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGT 243          

HSP 7 Score: 53.1434 bits (126), Expect = 1.152e-6
Identity = 44/109 (40.37%), Postives = 59/109 (54.13%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            ++G  G  G +G  GE GS GP G  G +G  G  G+ GS+G  G +G  GP G  G++G  G +G PG  G    RG  G+ G+ G  G  G+ GP G  G +G+ GT
Sbjct:  456 DRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGEVGKPGPIGYQGREGFKGPNGLPGLPGK---RGLRGSEGSTGVYGMKGMKGPIGVPGFRGQHGT 561          

HSP 8 Score: 52.7582 bits (125), Expect = 1.684e-6
Identity = 49/123 (39.84%), Postives = 63/123 (51.22%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTG------------DPGKDGLSGIDGNPGAKGAVGPRGTP---GARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            + G  G  G +G  G  G  GP G +G IGA G  GD G+ G  G +GS GP+G            D G DG+ G  G+ G  G  GP+GT    GA+G +G  G  G+PG  G NG +G +G
Sbjct:  153 DAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEG 275          

HSP 9 Score: 51.9878 bits (123), Expect = 2.657e-6
Identity = 40/89 (44.94%), Postives = 53/89 (59.55%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGI---KGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGE 4090
            G +G LG PG  G +G++GP G  G+   KG +G +G  G++G RG QGP G KG  G  G +GP G+ G  G  GP G+ G  G+ GE
Sbjct:  413 GPRGALGHPGPQGLEGDRGPIGKPGVSGTKGNIGAKGRIGLQGDRGEQGPFGPKGAGGEMGSKGPPGDFGEVGVRGPNGELGSEGVPGE 501          

HSP 10 Score: 51.9878 bits (123), Expect = 2.680e-6
Identity = 47/103 (45.63%), Postives = 52/103 (50.49%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKG 2719
            G  G+ G  G TG PG  G  G IG+ G  G  G PG  G RG  G+RGP GD G  GL G  G  G  G  G RG  G +G  G  G  G PG PG  G +G
Sbjct:  224 GVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPGIRGHEGLQGVSGKAGSIGDPGDPGDEGNEG 326          

HSP 11 Score: 51.9878 bits (123), Expect = 2.941e-6
Identity = 52/120 (43.33%), Postives = 58/120 (48.33%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPG------SVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRG------FDGIPGPPGPNGAKGEQG 2728
              GP G  G  G+ G PG      S+GP+GL G  G  G  GD G DG  G  G  G TG PG  G  G  G  G  G VG  G PG+RG  G RG        G+PGPPG  G  G+ G
Sbjct:  177 TMGPIGAKGILGDVGAPGMPGGVGSIGPSGLQGFQGRMGLKGDAGYDGVDGFKGHAGNTGIPGPQGTMGPIGAKGILGDVGAPGMPGSRGLNGTRGPEGDLGHSGLPGPPGFQGDPGKPG 296          

HSP 12 Score: 51.2174 bits (121), Expect = 4.759e-6
Identity = 39/90 (43.33%), Postives = 51/90 (56.67%), Query Frame = 2
Query: 3839 QGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMK------GVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGE 4090
            +GP G  G+ G +G  GP GD GIKGG G+ G +      G+ G +G QG +G  G +G  GK+GP GE+G  G  G  G  G PG  G+
Sbjct:  755 RGPQGPVGIKGIRGASGPIGDSGIKGGYGLMGPRGPDGNPGLLGRKGRQGEKGTAGRLGERGKKGPFGENGVLGKRGTLGPPGSPGSIGD 844          
BLAST of Collagen F-8 vs. Ensembl Nematostella
Match: EDO48996 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHK9])

HSP 1 Score: 89.7373 bits (221), Expect = 4.836e-20
Identity = 62/210 (29.52%), Postives = 99/210 (47.14%), Query Frame = 2
Query: 4433 PARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMR-----KIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            PAR CRD+ + +PK+ SGN+WIDPN G  +DSI+V C FE  S  TC+    Q+       F   +  +  W  + L   G   R     K   CP SQL FL++L  +A Q VT  C  +A  + S   + +++I+++  N   +      K K +         ++DDC  +      +   +   K   LP++D+ + D G   ++ 
Sbjct:    3 PARTCRDLHMCHPKLKSGNYWIDPNEGIPDDSIQVYCDFENNS--TCIFPNNQTRSHRRKWFSGPDGYK--WFGKELRGFGTVRRGRDGPKEGTCP-SQLAFLRLLSDRARQNVTYHCLNSAA-WSSGKGDLNHSIKIKGDNGVELHASSSNKFKPQI--------IRDDCHIKDGKWRQTIITVDTSKPHRLPVLDVAVFDIGGQGEEF 198          
BLAST of Collagen F-8 vs. Ensembl Nematostella
Match: EDO49368 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG67])

HSP 1 Score: 93.9745 bits (232), Expect = 2.593e-19
Identity = 61/223 (27.35%), Postives = 99/223 (44.39%), Query Frame = 2
Query: 4361 LYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKY-CPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDF 5026
            L + I+ L   + + +   G+K  PAR CR++ + NP   SG ++IDPN GS +D+ EV C F   +  TCV       +    S     N    W++E      N   KI Y   + Q+ FL+++H  A+Q +T  C  +  + DS        I++   N+  I   +           L E + KD+   +      +   IS K+ + LPI+D+   D 
Sbjct:  425 LIAVINLLINKIVTYKEQEGTKGKPARSCRNLKIDNPDKKSGYYYIDPNEGSPSDAEEVWCDFTTNA--TCVFPKNTEII--TRSLVVNSNGEDTWITE------NDDVKIDYKLDVVQMKFLRLMHKTAKQNMTYHCYNSRAWEDS------RTIKLLGDNEEEITAKL----------RLNECQNKDNQWHK------TVLDISTKQKDKLPIIDVAPYDL 615          

HSP 2 Score: 63.5438 bits (153), Expect = 6.279e-10
Identity = 49/107 (45.79%), Postives = 57/107 (53.27%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            QGP G  G++G  G  G  G  G  G  G  G+ G PG  GERG++G  GPTG PG  G  G+ G  GA G  G RG  G+ G  G  G  G PGP G  G KG +G
Sbjct:  137 QGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPGRPGSPGPAGAPGLKGPRG 243          

HSP 3 Score: 62.003 bits (149), Expect = 1.905e-9
Identity = 42/86 (48.84%), Postives = 55/86 (63.95%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGE 4090
            G +G  G PG +G +G QGP G +G KGG G +G+ GV G  GPQG +G  G+ G  G+ G +GE GP G+ GP GQ   PG++GE
Sbjct:  120 GDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQ---PGVSGE 202          

HSP 4 Score: 62.003 bits (149), Expect = 1.905e-9
Identity = 51/105 (48.57%), Postives = 61/105 (58.10%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDG---ERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYR----GFDGIPGPPG 2701
            +G  G PGE+GE G  G VGPTG  G  G PG +G+ G+DG   ERG  GS G +G PG+ G  G  G PG KG   PRG  GA+G+ G +    G  G PG PG
Sbjct:  167 RGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGASGLPGRPGSPGPAGAPGLKG---PRGEKGAKGDRGSKGPKGGASGFPGKPG 268          

HSP 5 Score: 58.151 bits (139), Expect = 3.077e-8
Identity = 50/119 (42.02%), Postives = 60/119 (50.42%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGL------IGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGT-----PGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            QG  G PG +G+ GEPG+VGP G        G  G  G  G  G DG  G  G++G  G PGK G  G+ G  G +G  GP G       G +G  G +G  G+ GPPG NG KG  G 
Sbjct:    9 QGSQGVPGTKGDRGEPGAVGPRGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGA 127          

HSP 6 Score: 56.225 bits (134), Expect = 9.647e-8
Identity = 51/135 (37.78%), Postives = 65/135 (48.15%), Query Frame = 2
Query: 3023 GPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTK 3427
            GPQG  G  G PG  G +G+ G PG  G+ G    +GP+G +G  G  G +G+PGV G  GPQGE+G+                        +G  G QG  G +GE G  G  GP G+ GV G  G  G PG +
Sbjct:  105 GPQGSRGVTGPPGFNGDKGANGAPGRAGDRG---AQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGN------------------------DGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGER 212          

HSP 7 Score: 55.0694 bits (131), Expect = 2.485e-7
Identity = 45/107 (42.06%), Postives = 53/107 (49.53%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            GP G+ G++G  G PG  G  G  G  G  G  G  G+ G  G  G+ GP G+ G DG  G  G  GA G VGP G+PG  G  G  G  G  G PG  G +G  G 
Sbjct:  114 GPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGERGAVGEVGPTGSPGPAGQPGVSGEAGADGTPGERGQQGSSGA 220          

HSP 8 Score: 52.373 bits (124), Expect = 1.579e-6
Identity = 45/97 (46.39%), Postives = 50/97 (51.55%), Query Frame = 2
Query: 3827 SMGKQGPLGE--PGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGV------RGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            + GK+GP G   PG  G QG  GP G RG+ G  G  G KG  G       RG QGPQG KG+ G +G  G  G  G  G  G RG  G PG  GER
Sbjct:   83 NQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQGER 179          

HSP 9 Score: 51.6026 bits (122), Expect = 3.043e-6
Identity = 36/81 (44.44%), Postives = 50/81 (61.73%), Query Frame = 2
Query: 3851 GEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G+ G  GPQG QG  G +G +G  G  G +G +G  GP GP G KG+ G +G++G  G DG KG  G  G++G  G++GE+
Sbjct:    1 GKSGAPGPQGSQGVPGTKGDRGEPGAVGPRGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEK 81          

HSP 10 Score: 51.2174 bits (121), Expect = 4.101e-6
Identity = 47/107 (43.93%), Postives = 56/107 (52.34%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGP---QGEQGPTGDRGIKGGVG---------IQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPM-----GEDGPKGAIGPRGQR---GDPGLAGER 4093
            G +G  GEPG  GP   QGE+GPTG  G KG  G           G KG  G  G QG QG+ GE G+ GK GP      G+DG +G  GP+G R   G PG  G++
Sbjct:   16 GTKGDRGEPGAVGPRGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERGAPGKQGKQGVSGEKGNQGKRGPAGAGIPGDDGRQGPPGPQGSRGVTGPPGFNGDK 122          

HSP 11 Score: 50.0618 bits (118), Expect = 7.636e-6
Identity = 79/204 (38.73%), Postives = 95/204 (46.57%), Query Frame = 2
Query: 3023 GPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ 3634
            G  G  GP GS G+PG +G  G PG +G  G  G +GP G  G  G+ G  G  G PG  G +GE+G                             G QG  G+ GEKG  G  GP G  G+PG  G QG PG +G  G  G  G  G  G  G  G  GD G+ GP G  G  G  GA+G+ G+ G  GP G+ GN G+ G Q
Sbjct:    1 GKSGAPGPQGSQGVPGTKGDRGEPGAVGPRGQQGEEGPTGPAGPKGDAGKNGQDGRPGYDGAKGERG---------------------------APGKQGKQGVSGEKGNQGKRGPAG-AGIPGDDGRQGPPGPQGSRGVTGPPGFNGDKGANGAPGRAGDRGAQGPQGQKGDKGGAGARGLPGVAGTPGPQGERGNDGKPGEQ 176          
BLAST of Collagen F-8 vs. Ensembl Medaka
Match: ENSORLT00000034900.1 (collagen alpha-1(XI) chain [Source:NCBI gene;Acc:101162214])

HSP 1 Score: 143.665 bits (361), Expect = 1.004e-33
Identity = 70/239 (29.29%), Postives = 128/239 (53.56%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLS-------EILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            ++++++ +  ++  +  ++RPIG+  +PAR C+++ +  P    G++WIDPN G   DS+ V C F     +TC+   K++    L S+ K E P  W+            D++GN +  +      QL FL++L   A+QT T  C  +A ++DS + ++ +A+R+RA ND  +         +++ S  + + V D C  R R+   +  +I+A   E LPI+D+  +DFG ++QK 
Sbjct: 1353 MEEVFATLSSMKNEVELMRRPIGTFESPARTCKELLMVQPNFKDGDYWIDPNQGCHKDSLRVFCNFTAGG-ETCLYPDKRTETVKLASWNK-EKPGSWYSQYRRGKQFSYSDRDGNPVHVV------QLTFLKLLSATAKQTFTYNCQNSAGWFDSTSSSYQHALRLRASNDEEL---------TQAKSPFITV-VHDGCQFR-RSQERTVLEIAAPSAELLPIIDVAPEDFGKNSQKF 1572          

HSP 2 Score: 55.8398 bits (133), Expect = 5.385e-7
Identity = 45/105 (42.86%), Postives = 57/105 (54.29%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLK---------------GEIGSSGKEGPMGEDGP---KGAIGPRGQRGDPGLAGER 4093
            G+ GP G PG++GPQG  G  GD+G  GG G +G KG +G  GP GP G++               G  G  G  GP G++GP   KGA GP G +G PG  GE+
Sbjct:  908 GEPGPAGLPGIAGPQGPPGEDGDKGETGGPGQKGSKGDKGEAGPSGPAGIQGPVGPPGPSGADGEPGPRGQQGLNGPKGDEGPRGFKGASGPSGLQGMPGPPGEK 1012          

HSP 3 Score: 55.4546 bits (132), Expect = 6.592e-7
Identity = 53/127 (41.73%), Postives = 61/127 (48.03%), Query Frame = 2
Query: 2411 GPSGYPGERGETG------EPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGI------------DGNPGAKGAVG---PRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            G  G PGE+G TG      EPG  G  G+ G  G PG  GD G  G  G  GS+G  G+ G  G +GI            DG PG +G  G   P+G  G RG  G  G  G+ G PGP G KGE G
Sbjct:  890 GEKGEPGEKGTTGLAGRDGEPGPAGLPGIAGPQGPPGEDGDKGETGGPGQKGSKGDKGEAGPSGPAGIQGPVGPPGPSGADGEPGPRGQQGLNGPKGDEGPRGFKGASGPSGLQGMPGPPGEKGESG 1016          

HSP 4 Score: 54.6842 bits (130), Expect = 1.293e-6
Identity = 68/149 (45.64%), Postives = 77/149 (51.68%), Query Frame = 2
Query: 3026 PQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGE---------------KGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTK 3427
            P GP G IG PG PG   S G  G MGE G PG KG  G  G  G PG  G+PG+ G  GP GE               KGD+G+ GP G  G  GP+GP G  G +G  G +G  GL G KG+ GP G  G  G  GL G+ G PG K
Sbjct:  867 PAGPAGAIGQPGRPG---SVGPAGPMGEKGEPGEKGTTGLAGRDGEPGPAGLPGIAGPQGPPGEDGDKGETGGPGQKGSKGDKGEAGPSGPAGIQGPVGPPGPSGADGEPGPRGQQGLNGPKGDEGPRGFKGASGPSGLQGMPGPPGEK 1012          

HSP 5 Score: 53.9138 bits (128), Expect = 2.056e-6
Identity = 54/123 (43.90%), Postives = 64/123 (52.03%), Query Frame = 2
Query: 2414 PSGYPGERGETGEPGSVGPTGLIGSIGAP---GSTGDPGSDGERGSIGS---RGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYR---------GFDGIPGPPGP---NGAKGEQG 2728
            P+G  G  G+ G PGSVGP G +G  G P   G+TG  G DGE G  G     GP G PG+DG  G  G PG KG+ G +G  G  G  G +         G DG PGP G    NG KG++G
Sbjct:  867 PAGPAGAIGQPGRPGSVGPAGPMGEKGEPGEKGTTGLAGRDGEPGPAGLPGIAGPQGPPGEDGDKGETGGPGQKGSKGDKGEAGPSGPAGIQGPVGPPGPSGADGEPGPRGQQGLNGPKGDEG 989          

HSP 6 Score: 53.5286 bits (127), Expect = 2.715e-6
Identity = 51/127 (40.16%), Postives = 57/127 (44.88%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGSVGPTGL---------------------IGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GP G  G RG  G PG+VGP GL                      G  GA G  G PGS G  G +G +G  G+ G  GL+G DG PG  G  G  G  G  G  G +G  G PG  G  G KGE G
Sbjct:  824 GPPGLKGFRGTRGTPGAVGPAGLKGGEGLPGVAGAAGATGERGPAGPAGAIGQPGRPGSVGPAGPMGEKGEPGEKGTTGLAGRDGEPGPAGLPGIAGPQGPPGEDGDKGETGGPGQKGSKGDKGEAG 950          
BLAST of Collagen F-8 vs. Ensembl Medaka
Match: col11a2 (collagen alpha-1(XI) chain [Source:NCBI gene;Acc:101154880])

HSP 1 Score: 139.428 bits (350), Expect = 1.195e-33
Identity = 74/257 (28.79%), Postives = 132/257 (51.36%), Query Frame = 2
Query: 4304 LENPEIPKDTNGIISI----LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKY----CPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYD-SINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            L +P+  +  +   +I    +++++ ++D L + + SI+ P+G++ +PAR C+D+ LS P +  G +WIDPN G   DS +V C F K   +TC+  +K      ++S+  TE P  W+   +    G+K   +        + QL FL++L  +A Q +T  C+ +  + D S   NH  A+  R  ND  +    +  +K+          +KD C  R +    +  +I+  + E+LP++DIQ+ DFG  NQ+ 
Sbjct:  323 LRSPKSKRSIDAKFTIGNEGMEEIFGSLDSLRQELESIRFPLGTQDSPARTCQDLHLSQPDLKDGEYWIDPNQGCSRDSFKVFCNFTKG--ETCLHPSKGIDSVKMSSW-DTETPGSWYSQFV---TGSKFSYVDASGEPVGVVQLGFLRLLSVQARQNLTYHCHRSVAWADRSAKNNHKRALHFRGANDEELSYETNPYIKA----------LKDGCSYR-KGFDRTILEINTPQVEHLPLLDIQVSDFGESNQQF 562          

HSP 2 Score: 56.9954 bits (136), Expect = 1.630e-7
Identity = 44/94 (46.81%), Postives = 55/94 (58.51%), Query Frame = 2
Query: 2447 GEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            G+PG+VGP G  G +G  G  G PG++G RG  GS G  G PG  G  G  G  G  G  G RG PGA+G  G++G  G+ G PG  G KG++G
Sbjct:  157 GDPGAVGPPGKTGPVGPQGQPGKPGTEGLRGLPGSVGEQGSPGAAGQKGPPGPVGPAGLPGLRGDPGAKGEKGHQGLIGLVGAPGEQGEKGDRG 250          
BLAST of Collagen F-8 vs. Ensembl Medaka
Match: ENSORLT00000007336.2 (collagen alpha-1(XI) chain [Source:NCBI gene;Acc:101162214])

HSP 1 Score: 142.51 bits (358), Expect = 1.821e-33
Identity = 68/239 (28.45%), Postives = 126/239 (52.72%), Query Frame = 2
Query: 4352 LKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLS-------EILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            ++++++ +  ++  +  ++RPIG+  +PAR C+++ +  P     ++WIDPN G   DS+ V C F     +TC+   K++    L S+ K E P  W+            D++GN +  +      QL FL++L   A+QT T  C  +A ++DS + ++ +A+R+RA ND  +         +++ S  + + V D C +R      +  +I+A   E LPI+D+  +DFG ++QK 
Sbjct: 1347 MEEVFATLSSMKNEVELMRRPIGTFESPARTCKELLMVQPNFKD-DYWIDPNQGCHKDSLRVFCNFTAGG-ETCLYPDKRTETVKLASWNK-EKPGSWYSQYRRGKQFSYSDRDGNPVHVV------QLTFLKLLSATAKQTFTYNCQNSAGWFDSTSSSYQHALRLRASNDEEL---------TQAKSPFITV-VHDGCQER------TVLEIAAPSAELLPIIDVAPEDFGKNSQKF 1560          

HSP 2 Score: 61.6178 bits (148), Expect = 9.909e-9
Identity = 54/118 (45.76%), Postives = 69/118 (58.47%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSI-GAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGT---PGARGNIGY---RGFDGIPGP---PGPNGAKGEQGT 2731
            QGP G PGE+G  G+PG +G  G+ G   G PG  G PG  G +G  GS+GP G PG  G+ G DG  G KG+ G +G    PG +G++G    RG +G PGP    GP G KG+ G+
Sbjct:  503 QGPIGLPGEKGPQGKPGILGLPGIDGPPQGHPGREGPPGEKGLQGLPGSQGPIGYPGTRGVKGADGVRGMKGSKGEKGEDGFPGIKGDMGIKGDRGDNGAPGPRGEDGPEGPKGQTGS 620          

HSP 3 Score: 60.077 bits (144), Expect = 2.817e-8
Identity = 47/99 (47.47%), Postives = 61/99 (61.62%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTG---DRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEI------GSSGKEGPMGEDGPKGAIGPRGQRGD---PGLAGER 4093
            G++GP GE GL G  G QGP G    RG+KG  G++GMKG +G +G  G  G+KG++      G +G  GP GEDGP+G  G  G  GD   PG+AGE+
Sbjct:  535 GREGPPGEKGLQGLPGSQGPIGYPGTRGVKGADGVRGMKGSKGEKGEDGFPGIKGDMGIKGDRGDNGAPGPRGEDGPEGPKGQTGSLGDPGAPGIAGEK 633          

HSP 4 Score: 56.6102 bits (135), Expect = 3.058e-7
Identity = 51/109 (46.79%), Postives = 58/109 (53.21%), Query Frame = 2
Query: 2414 PSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGD---PGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            P G+PG  G  GE G  G  G  G IG PG+ G  G+DG RG  GS+G  G+   PG  G  GI G+ G  GA GPRG  G  G  G  G  G PG PG  G KG+ G 
Sbjct:  530 PQGHPGREGPPGEKGLQGLPGSQGPIGYPGTRGVKGADGVRGMKGSKGEKGEDGFPGIKGDMGIKGDRGDNGAPGPRGEDGPEGPKGQTGSLGDPGAPGIAGEKGKLGV 638          

HSP 5 Score: 56.225 bits (134), Expect = 3.681e-7
Identity = 49/108 (45.37%), Postives = 57/108 (52.78%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            +QGP GYPG RG  G   + G  G+ GS G  G  G PG  G+ G  G RG  G PG  G  G +G  G  G++G  G PG  G  G  G  G+PG PG  GAKG  G
Sbjct:  551 SQGPIGYPGTRGVKG---ADGVRGMKGSKGEKGEDGFPGIKGDMGIKGDRGDNGAPGPRGEDGPEGPKGQTGSLGDPGAPGIAGEKGKLGVPGLPGYPGRQGAKGSLG 655          

HSP 6 Score: 53.5286 bits (127), Expect = 2.430e-6
Identity = 45/105 (42.86%), Postives = 57/105 (54.29%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLK---------------GEIGSSGKEGPMGEDGP---KGAIGPRGQRGDPGLAGER 4093
            G+ GP G PG++GPQG  G  GD+G  GG G +G KG +G  GP GP G++               G  G  G  GP G++GP   KGA GP G +G PG  GE+
Sbjct:  905 GEPGPAGLPGIAGPQGPPGEDGDKGETGGPGQKGSKGDKGEAGPSGPAGIQGPVGPPGPSGADGEPGPRGQQGLNGPKGDEGPRGFKGASGPSGLQGMPGPPGEK 1009          

HSP 7 Score: 53.1434 bits (126), Expect = 3.863e-6
Identity = 53/127 (41.73%), Postives = 61/127 (48.03%), Query Frame = 2
Query: 2411 GPSGYPGERGETG------EPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGI------------DGNPGAKGAVG---PRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            G  G PGE+G TG      EPG  G  G+ G  G PG  GD G  G  G  GS+G  G+ G  G +GI            DG PG +G  G   P+G  G RG  G  G  G+ G PGP G KGE G
Sbjct:  887 GEKGEPGEKGTTGLAGRDGEPGPAGLPGIAGPQGPPGEDGDKGETGGPGQKGSKGDKGEAGPSGPAGIQGPVGPPGPSGADGEPGPRGQQGLNGPKGDEGPRGFKGASGPSGLQGMPGPPGEKGESG 1013          

HSP 8 Score: 51.9878 bits (123), Expect = 8.315e-6
Identity = 68/149 (45.64%), Postives = 77/149 (51.68%), Query Frame = 2
Query: 3026 PQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGE---------------KGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTK 3427
            P GP G IG PG PG   S G  G MGE G PG KG  G  G  G PG  G+PG+ G  GP GE               KGD+G+ GP G  G  GP+GP G  G +G  G +G  GL G KG+ GP G  G  G  GL G+ G PG K
Sbjct:  864 PAGPAGAIGQPGRPG---SVGPAGPMGEKGEPGEKGTTGLAGRDGEPGPAGLPGIAGPQGPPGEDGDKGETGGPGQKGSKGDKGEAGPSGPAGIQGPVGPPGPSGADGEPGPRGQQGLNGPKGDEGPRGFKGASGPSGLQGMPGPPGEK 1009          
BLAST of Collagen F-8 vs. Ensembl Medaka
Match: col2a1a (collagen alpha-1(II) chain [Source:NCBI gene;Acc:100529192])

HSP 1 Score: 140.969 bits (354), Expect = 5.033e-33
Identity = 78/271 (28.78%), Postives = 125/271 (46.13%), Query Frame = 2
Query: 4259 TRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILD--------QNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            + F    +TE+  D L      + +N +     ++ S +  L   + +++ P G++ NPAR CRD+ L +P+  SG+FWIDPNLG   D+I+V C    E+ +TCV        K      K++N +  W  E +         Q+G     I      QL FL++L T+A Q +T  C  +  Y D    N   A+ ++  N        D ++++E  S      ++D C       +N+ F+    KT  LPIVDI   D G  +Q+ 
Sbjct: 1154 SAFAGLGQTEKSPDPLRYMRADEASNSLRQHDVEVDSTLKSLNSQIENMRSPDGTQKNPARTCRDLKLCHPEWKSGDFWIDPNLGCTADAIKVFCNM--ETGETCVYPRISKVPKKNWWSSKSKNLKHIWFGETISGGFHFSYGQDG----PIPNSANIQLNFLRLLSTEASQNLTYHCKNSIAYMDQATGNLKKALVLQGSN--------DVEIRAEGNSRFTYSVMEDGCKRHSGRWSNTVFEYKTMKTSRLPIVDIAPMDIGGADQEF 1410          

HSP 2 Score: 61.2326 bits (147), Expect = 1.159e-8
Identity = 45/96 (46.88%), Postives = 53/96 (55.21%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPG 2692
            + GP G PG RG  G+ G VGP G  G  G PG+ G PG+ GE G  G +G +G PG  G SG  G  G  G  GP+G  GA+G  G  GF G  G
Sbjct:  741 STGPIGAPGVRGAPGDRGEVGPPGPAGFAGPPGADGQPGAKGELGESGQKGESGAPGPQGPSGAPGPVGPTGVSGPKGARGAQGAPGATGFPGAAG 836          

HSP 3 Score: 55.4546 bits (132), Expect = 6.524e-7
Identity = 57/156 (36.54%), Postives = 69/156 (44.23%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLI------GSIGAPGSTGDPGS------------------------DGERGSIGSRGPTGDPGKDGLSG------------------IDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
             +G SG PG +G +G PG VGPTG+       G+ GAPG+TG PG+                        DG +G+ G  GP G PG  GL G                   DG PG +G  G RG  G  G  G RGF G+PGP G  G +G  G
Sbjct:  789 QKGESGAPGPQGPSGAPGPVGPTGVSGPKGARGAQGAPGATGFPGAAGRVGPPGPNGNPGPAGPAGAAGKDGPKGTRGDAGPPGRPGDAGLRGPAGPPGEKGEPGEEGKPGTDGPPGPQGLAGSRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPG 944          

HSP 4 Score: 53.5286 bits (127), Expect = 2.758e-6
Identity = 54/139 (38.85%), Postives = 63/139 (45.32%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGS---------------VGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGID------------------GNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GP G  G RG  G PGS                GP GL G  G  G+ G PG+ G+RG  G +GP G PGKDG  G+                   G+ G  GA G RG PG RG +G  G  G  GPPG +G  G +G
Sbjct:  644 GPQGLQGPRGLPGTPGSDGPKGAIGPAGAAGPQGPPGLQGMPGERGAGGIPGAKGDRGDNGQKGPEGAPGKDGARGLTGPIGPPGPAGPNGAKGETGSTGPIGAPGVRGAPGDRGEVGPPGPAGFAGPPGADGQPGAKG 782          
BLAST of Collagen F-8 vs. Ensembl Medaka
Match: col2a1a (collagen alpha-1(II) chain [Source:NCBI gene;Acc:100529192])

HSP 1 Score: 139.813 bits (351), Expect = 1.091e-32
Identity = 78/271 (28.78%), Postives = 125/271 (46.13%), Query Frame = 2
Query: 4259 TRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILD--------QNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            + F    +TE+  D L      + +N +     ++ S +  L   + +++ P G++ NPAR CRD+ L +P+  SG+FWIDPNLG   D+I+V C    E+ +TCV        K      K++N +  W  E +         Q+G     I      QL FL++L T+A Q +T  C  +  Y D    N   A+ ++  N        D ++++E  S      ++D C       +N+ F+    KT  LPIVDI   D G  +Q+ 
Sbjct: 1101 SAFAGLGQTEKSPDPLRYMRADEASNSLRQHDVEVDSTLKSLNSQIENMRSPDGTQKNPARTCRDLKLCHPEWKSGDFWIDPNLGCTADAIKVFCNM--ETGETCVYPRISKVPKKNWWSSKSKNLKHIWFGETISGGFHFSYGQDG----PIPNSANIQLNFLRLLSTEASQNLTYHCKNSIAYMDQATGNLKKALVLQGSN--------DVEIRAEGNSRFTYSVMEDGCKRHSGRWSNTVFEYKTMKTSRLPIVDIAPMDIGGADQEF 1357          

HSP 2 Score: 61.6178 bits (148), Expect = 8.629e-9
Identity = 45/96 (46.88%), Postives = 53/96 (55.21%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPG 2692
            + GP G PG RG  G+ G VGP G  G  G PG+ G PG+ GE G  G +G +G PG  G SG  G  G  G  GP+G  GA+G  G  GF G  G
Sbjct:  688 STGPIGAPGVRGAPGDRGEVGPPGPAGFAGPPGADGQPGAKGELGESGQKGESGAPGPQGPSGAPGPVGPTGVSGPKGARGAQGAPGATGFPGAAG 783          

HSP 3 Score: 55.8398 bits (133), Expect = 4.395e-7
Identity = 57/156 (36.54%), Postives = 69/156 (44.23%), Query Frame = 2
Query: 2405 NQGPSGYPGERGETGEPGSVGPTGLI------GSIGAPGSTGDPGS------------------------DGERGSIGSRGPTGDPGKDGLSG------------------IDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
             +G SG PG +G +G PG VGPTG+       G+ GAPG+TG PG+                        DG +G+ G  GP G PG  GL G                   DG PG +G  G RG  G  G  G RGF G+PGP G  G +G  G
Sbjct:  736 QKGESGAPGPQGPSGAPGPVGPTGVSGPKGARGAQGAPGATGFPGAAGRVGPPGPNGNPGPAGPAGAAGKDGPKGTRGDAGPPGRPGDAGLRGPAGPPGEKGEPGEEGKPGTDGPPGPQGLAGSRGIVGLPGQRGERGFPGLPGPSGEPGKQGAPG 891          

HSP 4 Score: 53.9138 bits (128), Expect = 1.955e-6
Identity = 54/139 (38.85%), Postives = 63/139 (45.32%), Query Frame = 2
Query: 2411 GPSGYPGERGETGEPGS---------------VGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGID------------------GNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            GP G  G RG  G PGS                GP GL G  G  G+ G PG+ G+RG  G +GP G PGKDG  G+                   G+ G  GA G RG PG RG +G  G  G  GPPG +G  G +G
Sbjct:  591 GPQGLQGPRGLPGTPGSDGPKGAIGPAGAAGPQGPPGLQGMPGERGAGGIPGAKGDRGDNGQKGPEGAPGKDGARGLTGPIGPPGPAGPNGAKGETGSTGPIGAPGVRGAPGDRGEVGPPGPAGFAGPPGADGQPGAKG 729          
BLAST of Collagen F-8 vs. Planmine SMEST
Match: SMESG000016282.1 (SMESG000016282.1)

HSP 1 Score: 1355.89 bits (3508), Expect = 0.000e+0
Identity = 1141/1141 (100.00%), Postives = 1141/1141 (100.00%), Query Frame = 2
Query:  212 MGGIIKPNNVFGMYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGGRGIAGLKXXXXXXXXXXXXXXXXEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDXXXXXXXXXXXXXXXXXXXXLKGDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNIGLDGDFGPIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ 3634
            MGGIIKPNNVFGMYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFQGPRGLSGPQGRRGGSGRSGNDGERGDSGLPGIKGKDGKPGDSGPRGLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVGLLGFQGGRGAGGPPGPSGPAGNQGPSGSKGEVGPTGSMGLPGPSGPRGPPGPEGISGPRGSTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLGIPGDPGPKGVKGDIGPAGIPGIEGPVGPKGEPGVQGPLGGRGIAGLKGTSGIMGPPGISGPDGEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDQGQRGPPGSRGSPGSVGPSGLKGDMGPLGPPGPPGPLGLQGSSGPSGPIGTTGPSGSIGNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTDGEIGPIGDKGGRGDTGMIGGPGPSGPTGSRGPPGSVGTKGNIGLDGDFGPIGDTGARGRNGRPGPTGPVGLAGAAGQKGDKGGIGINGKPGDKGFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRGKTGPPGSPGSTGPLGPNGLPGKEGPAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKGDDGSPGEQGPPGGSGPQGPQGPKGDFGSIGPPGPPGPIGVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ
Sbjct:    1 MGGIIKPNNVFGMYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFQGPRGLSGPQGRRGGSGRSGNDGERGDSGLPGIKGKDGKPGDSGPRGLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVGLLGFQGGRGAGGPPGPSGPAGNQGPSGSKGEVGPTGSMGLPGPSGPRGPPGPEGISGPRGSTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLGIPGDPGPKGVKGDIGPAGIPGIEGPVGPKGEPGVQGPLGGRGIAGLKGTSGIMGPPGISGPDGEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDQGQRGPPGSRGSPGSVGPSGLKGDMGPLGPPGPPGPLGLQGSSGPSGPIGTTGPSGSIGNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTDGEIGPIGDKGGRGDTGMIGGPGPSGPTGSRGPPGSVGTKGNIGLDGDFGPIGDTGARGRNGRPGPTGPVGLAGAAGQKGDKGGIGINGKPGDKGFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRGKTGPPGSPGSTGPLGPNGLPGKEGPAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKGDDGSPGEQGPPGGSGPQGPQGPKGDFGSIGPPGPPGPIGVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ 1141          

HSP 2 Score: 729.169 bits (1881), Expect = 0.000e+0
Identity = 407/407 (100.00%), Postives = 407/407 (100.00%), Query Frame = 2
Query: 3827 SMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMQEGSSKYVNTGTRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            SMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGERGPNGPPGPPGPVGPLGPGGPKGEKGVKGPIGGPGLPGPVKIVDMQEGSSKYVNTGTRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL
Sbjct: 1206 SMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGERGPNGPPGPPGPVGPLGPGGPKGEKGVKGPIGGPGLPGPVKIVDMQEGSSKYVNTGTRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 1612          

HSP 3 Score: 53.9138 bits (128), Expect = 1.310e-6
Identity = 44/93 (47.31%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQG------LKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G +G  G PG +GP G  G  G +G KGG+GI G  G +G  GPQGP G      L G  GS G  G MGE GP G  GP G RG  G  G++
Sbjct:  896 GARGRNGRPGPTGPVGLAGAAGQKGDKGGIGINGKPGDKGFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQ 988          

HSP 4 Score: 53.9138 bits (128), Expect = 1.525e-6
Identity = 48/107 (44.86%), Postives = 60/107 (56.07%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            QGPSG  G  G+ G  G +G  G+ GS+G  G  G+PG  G +G    +GPTGD G  G  GI G  G +G  GP+G  G +G IG  G +G  G  GP GA G +G
Sbjct: 1180 QGPSGPLGPMGQMGPQGPIGKPGIQGSMGKQGPLGEPGLSGPQGE---QGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRG 1283          

HSP 5 Score: 53.1434 bits (126), Expect = 2.549e-6
Identity = 42/87 (48.28%), Postives = 50/87 (57.47%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G  GP G PG+ GP G +G  G +G  GG GI G+KG  G+ GP G  G  GE G +G  G  G DG KG +G RG  GD G  G+R
Sbjct:  590 GDIGPAGIPGIEGPVGPKGEPGVQGPLGGRGIAGLKGTSGIMGPPGISGPDGEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDQGQR 676          

HSP 6 Score: 53.1434 bits (126), Expect = 2.592e-6
Identity = 40/100 (40.00%), Postives = 58/100 (58.00%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVE------------GVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            +G+ GP+G+PG  G QG QGP G  G+ G  G  G +G +            G  GPQGP G  G +G  G +GP+G+ G +G++G +G  G+PGL+G +
Sbjct: 1123 VGEDGPIGQPGNPGRQGAQGPPGKSGVVGKPGKTGAQGEQGSSGVKGGKGERGQPGPQGPSGPLGPMGQMGPQGPIGKPGIQGSMGKQGPLGEPGLSGPQ 1222          

HSP 7 Score: 52.373 bits (124), Expect = 4.189e-6
Identity = 40/88 (45.45%), Postives = 53/88 (60.23%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGP---QGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAG 4087
            G  GP GEPG+ GP G +G  G +G  G +G  G+ G +G +GP GP   +G+ GE G+ G  GP+G+ G +G  GP G RG PG  G
Sbjct:  602 GPVGPKGEPGVQGPLGGRGIAGLKGTSGIMGPPGISGPDGEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDQGQRGPPGSRGSPGSVG 689          

HSP 8 Score: 52.373 bits (124), Expect = 4.714e-6
Identity = 56/132 (42.42%), Postives = 65/132 (49.24%), Query Frame = 2
Query: 3020 MGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGE 3415
            MG  GP GPIG PG+ G  G  G  G+ G  GP G +GP G RG  G  G QGM GV G  GPQG +G +                     G+ G +G +GPM      GE+GP G IG  G  G PGL GE
Sbjct: 1189 MGQMGPQGPIGKPGIQGSMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLK---------------------GEIGSSGKEGPM------GEDGPKGAIGPRGQRGDPGLAGE 1293          

HSP 9 Score: 51.6026 bits (122), Expect = 6.492e-6
Identity = 41/97 (42.27%), Postives = 55/97 (56.70%), Query Frame = 2
Query: 2441 ETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            E G+PG  GP+G +G +G  G  G  G  G +GS+G +GP G+P      G+ G  G +G  G RG  G  G  G +G +G+ GP GP G KGE G+
Sbjct: 1173 ERGQPGPQGPSGPLGPMGQMGPQGPIGKPGIQGSMGKQGPLGEP------GLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGS 1263          
BLAST of Collagen F-8 vs. Planmine SMEST
Match: SMESG000016282.1 (SMESG000016282.1)

HSP 1 Score: 1348.95 bits (3490), Expect = 0.000e+0
Identity = 1141/1141 (100.00%), Postives = 1141/1141 (100.00%), Query Frame = 2
Query:  212 MGGIIKPNNVFGMYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGGRGIAGLKXXXXXXXXXXXXXXXXEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDXXXXXXXXXXXXXXXXXXXXLKGDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNIGLDGDFGPIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ 3634
            MGGIIKPNNVFGMYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFQGPRGLSGPQGRRGGSGRSGNDGERGDSGLPGIKGKDGKPGDSGPRGLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVGLLGFQGGRGAGGPPGPSGPAGNQGPSGSKGEVGPTGSMGLPGPSGPRGPPGPEGISGPRGSTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLGIPGDPGPKGVKGDIGPAGIPGIEGPVGPKGEPGVQGPLGGRGIAGLKGTSGIMGPPGISGPDGEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDQGQRGPPGSRGSPGSVGPSGLKGDMGPLGPPGPPGPLGLQGSSGPSGPIGTTGPSGSIGNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTDGEIGPIGDKGGRGDTGMIGGPGPSGPTGSRGPPGSVGTKGNIGLDGDFGPIGDTGARGRNGRPGPTGPVGLAGAAGQKGDKGGIGINGKPGDKGFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRGKTGPPGSPGSTGPLGPNGLPGKEGPAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKGDDGSPGEQGPPGGSGPQGPQGPKGDFGSIGPPGPPGPIGVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ
Sbjct:    1 MGGIIKPNNVFGMYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFQGPRGLSGPQGRRGGSGRSGNDGERGDSGLPGIKGKDGKPGDSGPRGLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVGLLGFQGGRGAGGPPGPSGPAGNQGPSGSKGEVGPTGSMGLPGPSGPRGPPGPEGISGPRGSTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLGIPGDPGPKGVKGDIGPAGIPGIEGPVGPKGEPGVQGPLGGRGIAGLKGTSGIMGPPGISGPDGEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDQGQRGPPGSRGSPGSVGPSGLKGDMGPLGPPGPPGPLGLQGSSGPSGPIGTTGPSGSIGNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTDGEIGPIGDKGGRGDTGMIGGPGPSGPTGSRGPPGSVGTKGNIGLDGDFGPIGDTGARGRNGRPGPTGPVGLAGAAGQKGDKGGIGINGKPGDKGFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRGKTGPPGSPGSTGPLGPNGLPGKEGPAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKGDDGSPGEQGPPGGSGPQGPQGPKGDFGSIGPPGPPGPIGVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ 1141          

HSP 2 Score: 51.6026 bits (122), Expect = 6.353e-6
Identity = 44/94 (46.81%), Postives = 51/94 (54.26%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQG------LKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
             G +G  G PG +GP G  G  G +G KGG+GI G  G +G  GPQGP G      L G  GS G  G MGE GP G  GP G RG  G  G++
Sbjct:  895 TGARGRNGRPGPTGPVGLAGAAGQKGDKGGIGINGKPGDKGFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQ 988          
BLAST of Collagen F-8 vs. Planmine SMEST
Match: SMESG000016282.1 (SMESG000016282.1)

HSP 1 Score: 1331.62 bits (3445), Expect = 0.000e+0
Identity = 1129/1129 (100.00%), Postives = 1129/1129 (100.00%), Query Frame = 2
Query:  248 MYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGGRGIAGLKXXXXXXXXXXXXXXXXEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDXXXXXXXXXXXXXXXXXXXXLKGDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNIGLDGDFGPIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ 3634
            MYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFQGPRGLSGPQGRRGGSGRSGNDGERGDSGLPGIKGKDGKPGDSGPRGLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVGLLGFQGGRGAGGPPGPSGPAGNQGPSGSKGEVGPTGSMGLPGPSGPRGPPGPEGISGPRGSTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLGIPGDPGPKGVKGDIGPAGIPGIEGPVGPKGEPGVQGPLGGRGIAGLKGTSGIMGPPGISGPDGEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDQGQRGPPGSRGSPGSVGPSGLKGDMGPLGPPGPPGPLGLQGSSGPSGPIGTTGPSGSIGNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTDGEIGPIGDKGGRGDTGMIGGPGPSGPTGSRGPPGSVGTKGNIGLDGDFGPIGDTGARGRNGRPGPTGPVGLAGAAGQKGDKGGIGINGKPGDKGFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRGKTGPPGSPGSTGPLGPNGLPGKEGPAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKGDDGSPGEQGPPGGSGPQGPQGPKGDFGSIGPPGPPGPIGVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ
Sbjct:    1 MYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFQGPRGLSGPQGRRGGSGRSGNDGERGDSGLPGIKGKDGKPGDSGPRGLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVGLLGFQGGRGAGGPPGPSGPAGNQGPSGSKGEVGPTGSMGLPGPSGPRGPPGPEGISGPRGSTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLGIPGDPGPKGVKGDIGPAGIPGIEGPVGPKGEPGVQGPLGGRGIAGLKGTSGIMGPPGISGPDGEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDQGQRGPPGSRGSPGSVGPSGLKGDMGPLGPPGPPGPLGLQGSSGPSGPIGTTGPSGSIGNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTDGEIGPIGDKGGRGDTGMIGGPGPSGPTGSRGPPGSVGTKGNIGLDGDFGPIGDTGARGRNGRPGPTGPVGLAGAAGQKGDKGGIGINGKPGDKGFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRGKTGPPGSPGSTGPLGPNGLPGKEGPAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKGDDGSPGEQGPPGGSGPQGPQGPKGDFGSIGPPGPPGPIGVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ 1129          

HSP 2 Score: 728.398 bits (1879), Expect = 0.000e+0
Identity = 407/407 (100.00%), Postives = 407/407 (100.00%), Query Frame = 2
Query: 3827 SMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMQEGSSKYVNTGTRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            SMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGERGPNGPPGPPGPVGPLGPGGPKGEKGVKGPIGGPGLPGPVKIVDMQEGSSKYVNTGTRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL
Sbjct: 1194 SMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGERGPNGPPGPPGPVGPLGPGGPKGEKGVKGPIGGPGLPGPVKIVDMQEGSSKYVNTGTRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 1600          

HSP 3 Score: 53.9138 bits (128), Expect = 1.388e-6
Identity = 44/93 (47.31%), Postives = 51/93 (54.84%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQG------LKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G +G  G PG +GP G  G  G +G KGG+GI G  G +G  GPQGP G      L G  GS G  G MGE GP G  GP G RG  G  G++
Sbjct:  884 GARGRNGRPGPTGPVGLAGAAGQKGDKGGIGINGKPGDKGFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQ 976          

HSP 4 Score: 53.9138 bits (128), Expect = 1.657e-6
Identity = 48/107 (44.86%), Postives = 60/107 (56.07%), Query Frame = 2
Query: 2408 QGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQG 2728
            QGPSG  G  G+ G  G +G  G+ GS+G  G  G+PG  G +G    +GPTGD G  G  GI G  G +G  GP+G  G +G IG  G +G  G  GP GA G +G
Sbjct: 1168 QGPSGPLGPMGQMGPQGPIGKPGIQGSMGKQGPLGEPGLSGPQGE---QGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRG 1271          

HSP 5 Score: 53.1434 bits (126), Expect = 2.746e-6
Identity = 40/100 (40.00%), Postives = 58/100 (58.00%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVE------------GVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            +G+ GP+G+PG  G QG QGP G  G+ G  G  G +G +            G  GPQGP G  G +G  G +GP+G+ G +G++G +G  G+PGL+G +
Sbjct: 1111 VGEDGPIGQPGNPGRQGAQGPPGKSGVVGKPGKTGAQGEQGSSGVKGGKGERGQPGPQGPSGPLGPMGQMGPQGPIGKPGIQGSMGKQGPLGEPGLSGPQ 1210          

HSP 6 Score: 53.1434 bits (126), Expect = 2.770e-6
Identity = 42/87 (48.28%), Postives = 50/87 (57.47%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
            G  GP G PG+ GP G +G  G +G  GG GI G+KG  G+ GP G  G  GE G +G  G  G DG KG +G RG  GD G  G+R
Sbjct:  578 GDIGPAGIPGIEGPVGPKGEPGVQGPLGGRGIAGLKGTSGIMGPPGISGPDGEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDQGQR 664          

HSP 7 Score: 52.373 bits (124), Expect = 4.591e-6
Identity = 40/88 (45.45%), Postives = 53/88 (60.23%), Query Frame = 2
Query: 3833 GKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGP---QGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAG 4087
            G  GP GEPG+ GP G +G  G +G  G +G  G+ G +G +GP GP   +G+ GE G+ G  GP+G+ G +G  GP G RG PG  G
Sbjct:  590 GPVGPKGEPGVQGPLGGRGIAGLKGTSGIMGPPGISGPDGEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDQGQRGPPGSRGSPGSVG 677          

HSP 8 Score: 52.373 bits (124), Expect = 4.911e-6
Identity = 56/132 (42.42%), Postives = 65/132 (49.24%), Query Frame = 2
Query: 3020 MGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGE 3415
            MG  GP GPIG PG+ G  G  G  G+ G  GP G +GP G RG  G  G QGM GV G  GPQG +G +                     G+ G +G +GPM      GE+GP G IG  G  G PGL GE
Sbjct: 1177 MGQMGPQGPIGKPGIQGSMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLK---------------------GEIGSSGKEGPM------GEDGPKGAIGPRGQRGDPGLAGE 1281          

HSP 9 Score: 51.6026 bits (122), Expect = 6.595e-6
Identity = 41/97 (42.27%), Postives = 55/97 (56.70%), Query Frame = 2
Query: 2441 ETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGT 2731
            E G+PG  GP+G +G +G  G  G  G  G +GS+G +GP G+P      G+ G  G +G  G RG  G  G  G +G +G+ GP GP G KGE G+
Sbjct: 1161 ERGQPGPQGPSGPLGPMGQMGPQGPIGKPGIQGSMGKQGPLGEP------GLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGS 1251          
BLAST of Collagen F-8 vs. Planmine SMEST
Match: SMESG000016282.1 (SMESG000016282.1)

HSP 1 Score: 1327 bits (3433), Expect = 0.000e+0
Identity = 1129/1129 (100.00%), Postives = 1129/1129 (100.00%), Query Frame = 2
Query:  248 MYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKGEVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGGRGIAGLKXXXXXXXXXXXXXXXXEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDXXXXXXXXXXXXXXXXXXXXLKGDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKGNIGLDGDFGPIGDTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRXXXXXXXXXXXXXXXXXXXXXXXXXXAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ 3634
            MYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFQGPRGLSGPQGRRGGSGRSGNDGERGDSGLPGIKGKDGKPGDSGPRGLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVGLLGFQGGRGAGGPPGPSGPAGNQGPSGSKGEVGPTGSMGLPGPSGPRGPPGPEGISGPRGSTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLGIPGDPGPKGVKGDIGPAGIPGIEGPVGPKGEPGVQGPLGGRGIAGLKGTSGIMGPPGISGPDGEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDQGQRGPPGSRGSPGSVGPSGLKGDMGPLGPPGPPGPLGLQGSSGPSGPIGTTGPSGSIGNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTDGEIGPIGDKGGRGDTGMIGGPGPSGPTGSRGPPGSVGTKGNIGLDGDFGPIGDTGARGRNGRPGPTGPVGLAGAAGQKGDKGGIGINGKPGDKGFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRGKTGPPGSPGSTGPLGPNGLPGKEGPAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKGDDGSPGEQGPPGGSGPQGPQGPKGDFGSIGPPGPPGPIGVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ
Sbjct:    1 MYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKIAQRPFIQTQTGMCSMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSILLTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFKTQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELLGQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNTGNKGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGNDVARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPGDTGFQGPRGLSGPQGRRGGSGRSGNDGERGDSGLPGIKGKDGKPGDSGPRGLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVGLLGFQGGRGAGGPPGPSGPAGNQGPSGSKGEVGPTGSMGLPGPSGPRGPPGPEGISGPRGSTGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGFGTRGYKGERGKPGGFGPKGDIGKAGGLGIPGDPGPKGVKGDIGPAGIPGIEGPVGPKGEPGVQGPLGGRGIAGLKGTSGIMGPPGISGPDGEKGPNGPTGNRGVDGEKGNLGVRGPIGDIGDQGQRGPPGSRGSPGSVGPSGLKGDMGPLGPPGPPGPLGLQGSSGPSGPIGTTGPSGSIGNQGPSGYPGERGETGEPGSVGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPGAKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTDGEIGPIGDKGGRGDTGMIGGPGPSGPTGSRGPPGSVGTKGNIGLDGDFGPIGDTGARGRNGRPGPTGPVGLAGAAGQKGDKGGIGINGKPGDKGFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQGEKGDRGKTGPPGSPGSTGPLGPNGLPGKEGPAGVQGPMGLMGEKGENGPMGPIGEVGVPGLPGLQGEPGTKGDDGSPGEQGPPGGSGPQGPQGPKGDFGSIGPPGPPGPIGVNGAKGVQGIVGEDGPIGQPGNPGRQGAQ 1129          

HSP 2 Score: 51.6026 bits (122), Expect = 6.727e-6
Identity = 44/94 (46.81%), Postives = 51/94 (54.26%), Query Frame = 2
Query: 3830 MGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQG------LKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGER 4093
             G +G  G PG +GP G  G  G +G KGG+GI G  G +G  GPQGP G      L G  GS G  G MGE GP G  GP G RG  G  G++
Sbjct:  883 TGARGRNGRPGPTGPVGLAGAAGQKGDKGGIGINGKPGDKGFMGPQGPNGPIGSPGLPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQ 976          
BLAST of Collagen F-8 vs. Planmine SMEST
Match: SMESG000016282.1 (SMESG000016282.1)

HSP 1 Score: 637.491 bits (1643), Expect = 0.000e+0
Identity = 361/395 (91.39%), Postives = 366/395 (92.66%), Query Frame = 2
Query: 3863 LSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRGPQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDMQEGSSKYVNTGTRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 5047
            + G +G +GP G +G+                        KGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGERGPNGPPGPPGPVGPLGPGGPKGEKGVKGPIGGPGLPGPVKIVDMQEGSSKYVNTGTRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL
Sbjct:    1 MKGVEGVRGPQGPQGL------------------------KGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGERGPNGPPGPPGPVGPLGPGGPKGEKGVKGPIGGPGLPGPVKIVDMQEGSSKYVNTGTRFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQRPIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKESIKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMSQLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDTHVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDIQLKDFGNDNQKL 371          
The following BLAST results are available for this feature:
BLAST of Collagen F-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL11A17.589e-3429.71collagen type XI alpha 1 chain [Source:HGNC Symbol... [more]
COL11A12.008e-3329.71collagen type XI alpha 1 chain [Source:HGNC Symbol... [more]
COL11A12.408e-3329.71collagen type XI alpha 1 chain [Source:HGNC Symbol... [more]
COL11A12.416e-3329.71collagen type XI alpha 1 chain [Source:HGNC Symbol... [more]
COL5A11.603e-3128.87collagen type V alpha 1 chain [Source:HGNC Symbol;... [more]
back to top
BLAST of Collagen F-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col-1351.356e-1639.77COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58][more]
col-1353.232e-1246.30COLlagen [Source:UniProtKB/TrEMBL;Acc:G3MU58][more]
col-545.731e-942.86COLlagen [Source:UniProtKB/TrEMBL;Acc:O44774][more]
col-1498.562e-947.17COLlagen [Source:UniProtKB/TrEMBL;Acc:Q17417][more]
dpy-171.154e-839.87DumPY: shorter than wild-type [Source:UniProtKB/T... [more]
back to top
BLAST of Collagen F-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG423423.629e-847.47gene:FBgn0259244 transcript:FBtr0303650[more]
CG423423.905e-847.47gene:FBgn0259244 transcript:FBtr0336781[more]
CG423424.561e-847.47gene:FBgn0259244 transcript:FBtr0336782[more]
Col4a13.972e-744.95gene:FBgn0000299 transcript:FBtr0079003[more]
Col4a13.972e-744.95gene:FBgn0000299 transcript:FBtr0079002[more]
back to top
BLAST of Collagen F-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col5a3a2.137e-3429.29collagen, type V, alpha 3a [Source:ZFIN;Acc:ZDB-GE... [more]
col2a1a8.470e-3227.31collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-G... [more]
col11a1a2.563e-3127.62collagen, type XI, alpha 1a [Source:ZFIN;Acc:ZDB-G... [more]
col2a1a2.727e-3126.30collagen, type II, alpha 1a [Source:ZFIN;Acc:ZDB-G... [more]
col5a13.379e-3127.27procollagen, type V, alpha 1 [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Collagen F-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COL11A11.126e-3530.54collagen, type V, alpha 3 [Source:NCBI gene;Acc:73... [more]
COL11A11.189e-3530.54collagen, type V, alpha 3 [Source:NCBI gene;Acc:73... [more]
COL11A11.540e-3530.54collagen, type V, alpha 3 [Source:NCBI gene;Acc:73... [more]
COL11A11.571e-3530.54collagen, type V, alpha 3 [Source:NCBI gene;Acc:73... [more]
COL11A12.156e-3530.54collagen, type V, alpha 3 [Source:NCBI gene;Acc:73... [more]
back to top
BLAST of Collagen F-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Col11a11.702e-3429.29collagen, type XI, alpha 1 [Source:MGI Symbol;Acc:... [more]
Col5a15.233e-3229.29collagen, type V, alpha 1 [Source:MGI Symbol;Acc:M... [more]
Col5a27.053e-3130.35collagen, type V, alpha 2 [Source:MGI Symbol;Acc:M... [more]
Col5a12.097e-3029.29collagen, type V, alpha 1 [Source:MGI Symbol;Acc:M... [more]
Col2a19.609e-3027.35collagen, type II, alpha 1 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of Collagen F-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q61245|COBA1_MOUSE1.191e-3329.29Collagen alpha-1(XI) chain OS=Mus musculus OX=1009... [more]
sp|P20909|COBA1_RAT2.819e-3329.29Collagen alpha-1(XI) chain OS=Rattus norvegicus OX... [more]
sp|P12107|COBA1_HUMAN1.156e-3229.71Collagen alpha-1(XI) chain OS=Homo sapiens OX=9606... [more]
sp|P02460|CO2A1_CHICK6.437e-3228.73Collagen alpha-1(II) chain (Fragment) OS=Gallus ga... [more]
sp|O93484|CO1A2_ONCMY3.075e-3129.80Collagen alpha-2(I) chain OS=Oncorhynchus mykiss O... [more]
back to top
BLAST of Collagen F-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4D6FZN34.169e-13799.03Collagen F-8 (Fragment) OS=Schmidtea mediterranea ... [more]
A0A564Z6L23.674e-7340.44Fibrillar collagen NC1 domain-containing protein O... [more]
A0A0R3S9984.000e-7243.24Fibrillar collagen NC1 domain-containing protein O... [more]
A0A4E0S1215.416e-7242.27Collagen alpha-1(XI) chain OS=Fasciola hepatica OX... [more]
A0A3P6G5X14.470e-7045.53Fibrillar collagen NC1 domain-containing protein O... [more]
back to top
BLAST of Collagen F-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
col1a26.271e-2928.80collagen, type I, alpha 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
col1a1a1.170e-2826.83collagen, type I, alpha 1a [Source:ZFIN;Acc:ZDB-GE... [more]
col11a22.427e-2826.67collagen, type XI, alpha 2 [Source:ZFIN;Acc:ZDB-GE... [more]
col5a14.993e-2825.10procollagen, type V, alpha 1 [Source:ZFIN;Acc:ZDB-... [more]
col11a21.371e-2727.08collagen, type XI, alpha 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Collagen F-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003197.14.122e-3027.71pep scaffold:Pmarinus_7.0:GL479090:2162:37629:-1 g... [more]
ENSPMAT00000001576.11.425e-2930.00pep scaffold:Pmarinus_7.0:GL476350:400893:424819:1... [more]
ENSPMAT00000001071.13.245e-2928.33pep scaffold:Pmarinus_7.0:GL476837:726:42204:1 gen... [more]
ENSPMAT00000009617.11.149e-2625.52pep scaffold:Pmarinus_7.0:GL476473:139194:170406:1... [more]
ENSPMAT00000005318.11.063e-2326.34pep scaffold:Pmarinus_7.0:GL477895:43798:56979:-1 ... [more]
back to top
BLAST of Collagen F-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Collagen F-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO429532.179e-3430.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494011.842e-2228.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447292.935e-2127.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489964.836e-2029.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493682.593e-1927.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Collagen F-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000034900.11.004e-3329.29collagen alpha-1(XI) chain [Source:NCBI gene;Acc:1... [more]
col11a21.195e-3328.79collagen alpha-1(XI) chain [Source:NCBI gene;Acc:1... [more]
ENSORLT00000007336.21.821e-3328.45collagen alpha-1(XI) chain [Source:NCBI gene;Acc:1... [more]
col2a1a5.033e-3328.78collagen alpha-1(II) chain [Source:NCBI gene;Acc:1... [more]
col2a1a1.091e-3228.78collagen alpha-1(II) chain [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Collagen F-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016282.11.310e-6100.00SMESG000016282.1[more]
SMESG000016282.16.353e-6100.00SMESG000016282.1[more]
SMESG000016282.11.388e-6100.00SMESG000016282.1[more]
SMESG000016282.16.727e-6100.00SMESG000016282.1[more]
SMESG000016282.10.000e+091.39SMESG000016282.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031625 ID=SMED30031625|Name=Collagen F-8|organism=Schmidtea mediterranea sexual|type=transcript|length=5275bp
CTTCCGATCTCAGCACATGAATTTGGTGTTGATCTCGCTGCAAATGTCAT
CATTCGGTTGTGTCGGTGGCATTACAAACCTAACATTGAATTCGACTGTG
TATTTCCCAATTTCCATTTTATTGGTTTTGATCCTATTGATAAATTGTTA
AATTATTAAAACAATAAATTCTAATATTCATTTCAACCGTTAAAACAATA
ATTGGATATTTATGGGCGGAATCATCAAGCCCAACAACGTCTTTGGAATG
TATATACTGTTCGTTTTGTTCTCTCTGGCAGTCCAGTCGGTCACCTCCAG
GATCCATCTCAGTCACAACCGAACATCAAGTCATGGAGATATTTTACAAT
TCATCAAAATCGCCCAACGACCATTCATACAAACTCAGACTGGCATGTGC
TCCATGCCGGGATCAAAATTAGGGTACATTGTTGGTCCTGAGGCGAATTT
GCACTTGAAGTCCAGTTTCATTTTTAAAGCGGAAAAGCTGCTGGGTAGTT
TCTCCATCCTCCTGACTGCTAAAGTTGACCGGCTGTCGTCCGATACGATT
TTTTCCGTCAACGACATCAATGGGCATTTGAATTTGGCTTTCAAAATCGG
CCGAAAAACGGTGCTCCATTTCAGGGAACCCGGAGGCATCACACAAACAA
TTGAATTTAAAACACAGTTAGATGATTTAAGTTGGCATCGAGTGGCTCTT
TCAGTGACGGTGAATGCCATCAAGTTGTTTGTGGACTGCCAAATGGCTGA
GGTTATACCTTTAACAAGGGAGATTGATGAAATTCTTGTGTCGGGAGAAA
TGGAACTTTTAGGTCAAGGATATACCGGTGTCATTCAAGATTTGTTTATT
GTTCCCGGACAAGAAGCCGCGTACAGACAATGTGAAATATATACGCAAGA
CTGTCCCGGATTACACGATATTATGATGAATCAACAGCCGGATGATTCAA
ACACGGGAAATAAAGGAAGAATTGGAGATATGGGAGAGCCAGGTGAAAAA
GGAAATGCGGGTAAAAATGGTGGTATTGGATTAAGTGGCGGTAGAGGAGC
TCCTGGTCCACAAGGACAAGTTTTTATCATTCCCTTAAATCTTGGTACGG
GTGGCAATGATGTTGCTCGTCAAGCCAATTTCAGGAATTCGTTAATAAAC
CATATGATGGTTATGAAAGGAGTTCGGGGGAAAAGAGGTCCTACTGGTTC
CCCTGGACCAGATGGTTCTTTAGGAGGGTTTGGATTTAAAGGAGAAAATG
GCCCACCGGGAGATACAGGATTCCAAGGTCCTAGAGGACTTTCAGGACCT
CAAGGAAGACGAGGAGGATCGGGACGATCCGGAAATGATGGTGAAAGAGG
TGATTCCGGATTACCAGGAATTAAAGGCAAAGATGGAAAGCCAGGGGATT
CTGGCCCAAGAGGTTTAAGAGGAAGTAAAGGGGATTTTGGCCAAATAGGT
GTAAAAGGTGATAATGGGATCATTGGAGAAGATGGACCACGAGGACCTTT
TGGTGATTCAGGAGATCAAGGGGAAGTCGGATTATTGGGTTTCCAAGGAG
GAAGAGGTGCTGGAGGACCACCAGGCCCAAGTGGACCTGCAGGAAACCAA
GGTCCTAGTGGATCAAAAGGCGAAGTGGGACCAACAGGATCTATGGGATT
ACCTGGACCATCAGGTCCTAGAGGTCCCCCAGGTCCAGAAGGTATTTCTG
GCCCAAGAGGTTCAACTGGTCCTGTTGGTGGAAGAGGAAGACAGGGATCA
CCGGGGGTTCCTGGAAGTGATGGAACTCCAGGATATGCTGGTATTAAAGG
AGATCAGGGAGTAAAAGGGGATTCTGGGCATGTAGGTCAAAGAGGAGATG
ACGGAGGATTTGGAACCAGAGGGTATAAAGGAGAAAGAGGTAAACCAGGA
GGTTTTGGTCCAAAAGGAGATATTGGAAAAGCAGGTGGTCTCGGAATTCC
AGGTGATCCTGGACCTAAAGGAGTTAAAGGAGACATTGGACCGGCAGGAA
TACCTGGTATAGAAGGGCCAGTTGGACCAAAAGGAGAACCCGGAGTACAG
GGTCCTCTAGGTGGTAGAGGAATAGCTGGTTTGAAGGGAACTAGTGGCAT
TATGGGCCCCCCTGGAATCAGTGGTCCAGATGGTGAGAAAGGCCCTAATG
GACCGACCGGCAATCGGGGCGTTGATGGAGAAAAGGGAAATTTGGGTGTA
AGAGGACCAATTGGAGATATTGGAGATCAAGGTCAAAGAGGTCCACCAGG
ATCACGAGGAAGTCCAGGAAGTGTAGGTCCATCGGGTCTTAAAGGAGACA
TGGGCCCTCTTGGTCCCCCAGGGCCCCCTGGTCCATTGGGATTGCAAGGC
TCATCAGGTCCATCAGGACCAATTGGAACCACAGGCCCCTCAGGGTCAAT
TGGAAATCAAGGTCCTTCAGGATACCCTGGCGAACGAGGGGAAACTGGTG
AACCTGGTTCAGTCGGTCCTACTGGTTTGATAGGTAGTATTGGTGCTCCT
GGATCAACTGGCGATCCTGGTTCGGATGGAGAAAGAGGATCCATTGGATC
TAGAGGTCCAACAGGTGATCCTGGTAAAGATGGTCTTTCTGGAATTGATG
GAAATCCAGGTGCCAAAGGAGCTGTTGGCCCAAGAGGAACTCCTGGTGCC
AGAGGAAATATTGGATATAGAGGATTTGACGGAATACCTGGACCTCCAGG
TCCAAATGGAGCAAAAGGAGAACAAGGGACAGATGGGGAAATAGGCCCAA
TTGGAGATAAAGGAGGAAGAGGCGATACTGGAATGATTGGAGGCCCAGGC
CCATCAGGCCCCACTGGATCAAGAGGACCACCAGGATCAGTTGGTACAAA
AGGAAATATTGGTTTGGATGGAGATTTTGGTCCTATTGGGGATACGGGGG
CGAGAGGACGTAATGGAAGACCTGGACCAACTGGGCCAGTTGGATTAGCT
GGTGCAGCTGGACAAAAAGGTGATAAAGGAGGAATAGGAATAAATGGAAA
GCCCGGGGATAAAGGCTTTATGGGACCACAAGGTCCAAATGGACCAATTG
GAAGCCCGGGACTTCCCGGTATTCAAGGATCACCGGGGGTCCCTGGTGAC
ATGGGTGAGCATGGACCTCCAGGTTTCAAGGGTCCAGAAGGTACAAGAGG
ATCTACTGGAAATCCTGGAGATCAAGGAATGCCCGGTGTGCCTGGTGAAC
TTGGTCCACAAGGAGAAAAGGGGGACCGAGGCAAAACTGGACCTCCAGGC
TCCCCTGGATCTACTGGTCCATTAGGTCCAAATGGCCTTCCTGGAAAAGA
AGGACCAGCTGGAGTTCAAGGTCCAATGGGCTTGATGGGTGAAAAGGGAG
AGAATGGGCCGATGGGGCCCATTGGTGAAGTAGGTGTACCTGGCCTTCCC
GGCTTGCAAGGAGAACCTGGAACAAAAGGTGATGATGGTTCTCCAGGTGA
ACAAGGACCACCAGGAGGTTCTGGCCCCCAAGGACCACAAGGCCCTAAAG
GCGATTTCGGTTCAATCGGACCACCTGGACCGCCTGGTCCCATTGGAGTA
AATGGAGCTAAAGGAGTTCAGGGAATTGTGGGTGAGGATGGACCAATTGG
GCAACCAGGAAACCCTGGCAGACAAGGAGCTCAAGGTCCACCAGGAAAAT
CTGGTGTTGTAGGAAAACCTGGCAAAACTGGGGCTCAAGGTGAGCAAGGA
AGTTCCGGAGTTAAAGGAGGTAAAGGAGAAAGAGGACAACCTGGTCCACA
AGGCCCATCCGGACCATTAGGACCAATGGGACAAATGGGACCTCAAGGTC
CTATTGGGAAACCTGGAATTCAAGGATCAATGGGTAAACAAGGACCTCTG
GGAGAACCAGGTCTCTCTGGGCCGCAAGGTGAACAGGGTCCAACTGGAGA
TCGTGGTATAAAAGGAGGAGTCGGTATACAAGGAATGAAAGGCGTTGAAG
GTGTAAGAGGTCCACAAGGACCTCAAGGATTAAAAGGAGAAATTGGTAGC
TCTGGAAAAGAAGGTCCGATGGGAGAAGATGGCCCAAAAGGAGCTATTGG
ACCCAGAGGACAGAGAGGTGACCCAGGTCTAGCTGGAGAAAGAGGTCCGA
ATGGACCTCCTGGACCACCTGGCCCAGTTGGACCTTTAGGACCGGGTGGA
CCGAAAGGTGAAAAAGGTGTTAAAGGACCCATAGGAGGTCCTGGCTTACC
TGGTCCGGTAAAAATTGTTGATATGCAAGAAGGAAGCTCTAAATATGTAA
ATACTGGAACCAGATTTAAGCGTGAAGCCAAAACAGAGGAAGGCAAAGAT
AAATTAGAAAACCCGGAAATCCCAAAAGACACCAACGGAATTATCAGCAT
TCTAAAAAAATTATATTCAAACATTGATAAATTGGAGAAAAATATGAATT
CTATACAGAGGCCCATCGGTAGCAAGTCTAATCCCGCCCGGCACTGTAGA
GATATCTTCCTCAGTAATCCAAAGGTTACTTCCGGAAACTTTTGGATTGA
TCCTAACCTTGGATCTATAAACGATTCGATAGAAGTCGAATGCAAATTTG
AAAAAGAATCTATAAAAACCTGCGTGTCAGCGACAAAACAGTCCCATATG
AAATCTTTAACTTCATTCAAGAAAACAGAAAATCCTAGGCAGTGGTGGCT
CAGCGAAATCCTTGATCAAAACGGCAACAAAATGAGAAAGATCAAGTATT
GCCCCATGAGCCAACTGGTATTCCTTCAGATGTTGCACACGAAGGCAGAA
CAGACTGTAACGATGATGTGCAACGAAGCCGCAGTCTACTATGATAGCAT
TAATAAAAATCACGACAACGCAATACGCATGAGGGCTTTCAATGACCGTA
TCATAGACACGCACGTCGACAGGAAGTTGAAGAGCGAATCTGGCAGTACT
TTGTTGGAAATCAAAGTCAAAGACGATTGCATGGATCGGTTGAGAACTCC
AACAAATTCCCAGTTTCAGATCTCTGCCAAGAAAACCGAATACCTTCCGA
TTGTAGATATCCAATTGAAGGATTTCGGAAATGACAACCAAAAATTGGGC
TATTATGTTTATTCGGTTTGTTATAGTTAGAATAACGGACTAATATATCA
GACAATCAAGTGAGATCATGAGGATGAATCTTTGGGTTGACTTGTTTGAA
TGATGCTGTGGACAATGTACAAGTTCTTTACGTTTGGGTCTTAGTTCTGA
GTTGAGTGTTTTGTATTTATTTATGCTCGGTCAATCAAATCTTTTAATAT
TATTTTCATTTACTATGAAAAAAAA
back to top

protein sequence of SMED30031625-orf-1

>SMED30031625-orf-1 ID=SMED30031625-orf-1|Name=SMED30031625-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1623bp
MGGIIKPNNVFGMYILFVLFSLAVQSVTSRIHLSHNRTSSHGDILQFIKI
AQRPFIQTQTGMCSMPGSKLGYIVGPEANLHLKSSFIFKAEKLLGSFSIL
LTAKVDRLSSDTIFSVNDINGHLNLAFKIGRKTVLHFREPGGITQTIEFK
TQLDDLSWHRVALSVTVNAIKLFVDCQMAEVIPLTREIDEILVSGEMELL
GQGYTGVIQDLFIVPGQEAAYRQCEIYTQDCPGLHDIMMNQQPDDSNTGN
KGRIGDMGEPGEKGNAGKNGGIGLSGGRGAPGPQGQVFIIPLNLGTGGND
VARQANFRNSLINHMMVMKGVRGKRGPTGSPGPDGSLGGFGFKGENGPPG
DTGFQGPRGLSGPQGRRGGSGRSGNDGERGDSGLPGIKGKDGKPGDSGPR
GLRGSKGDFGQIGVKGDNGIIGEDGPRGPFGDSGDQGEVGLLGFQGGRGA
GGPPGPSGPAGNQGPSGSKGEVGPTGSMGLPGPSGPRGPPGPEGISGPRG
STGPVGGRGRQGSPGVPGSDGTPGYAGIKGDQGVKGDSGHVGQRGDDGGF
GTRGYKGERGKPGGFGPKGDIGKAGGLGIPGDPGPKGVKGDIGPAGIPGI
EGPVGPKGEPGVQGPLGGRGIAGLKGTSGIMGPPGISGPDGEKGPNGPTG
NRGVDGEKGNLGVRGPIGDIGDQGQRGPPGSRGSPGSVGPSGLKGDMGPL
GPPGPPGPLGLQGSSGPSGPIGTTGPSGSIGNQGPSGYPGERGETGEPGS
VGPTGLIGSIGAPGSTGDPGSDGERGSIGSRGPTGDPGKDGLSGIDGNPG
AKGAVGPRGTPGARGNIGYRGFDGIPGPPGPNGAKGEQGTDGEIGPIGDK
GGRGDTGMIGGPGPSGPTGSRGPPGSVGTKGNIGLDGDFGPIGDTGARGR
NGRPGPTGPVGLAGAAGQKGDKGGIGINGKPGDKGFMGPQGPNGPIGSPG
LPGIQGSPGVPGDMGEHGPPGFKGPEGTRGSTGNPGDQGMPGVPGELGPQ
GEKGDRGKTGPPGSPGSTGPLGPNGLPGKEGPAGVQGPMGLMGEKGENGP
MGPIGEVGVPGLPGLQGEPGTKGDDGSPGEQGPPGGSGPQGPQGPKGDFG
SIGPPGPPGPIGVNGAKGVQGIVGEDGPIGQPGNPGRQGAQGPPGKSGVV
GKPGKTGAQGEQGSSGVKGGKGERGQPGPQGPSGPLGPMGQMGPQGPIGK
PGIQGSMGKQGPLGEPGLSGPQGEQGPTGDRGIKGGVGIQGMKGVEGVRG
PQGPQGLKGEIGSSGKEGPMGEDGPKGAIGPRGQRGDPGLAGERGPNGPP
GPPGPVGPLGPGGPKGEKGVKGPIGGPGLPGPVKIVDMQEGSSKYVNTGT
RFKREAKTEEGKDKLENPEIPKDTNGIISILKKLYSNIDKLEKNMNSIQR
PIGSKSNPARHCRDIFLSNPKVTSGNFWIDPNLGSINDSIEVECKFEKES
IKTCVSATKQSHMKSLTSFKKTENPRQWWLSEILDQNGNKMRKIKYCPMS
QLVFLQMLHTKAEQTVTMMCNEAAVYYDSINKNHDNAIRMRAFNDRIIDT
HVDRKLKSESGSTLLEIKVKDDCMDRLRTPTNSQFQISAKKTEYLPIVDI
QLKDFGNDNQKLGYYVYSVCYS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0003001lateral region of the whole animal
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR000885Fib_collagen_C
IPR001791Laminin_G
IPR008160Collagen
IPR013320ConA-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005581collagen trimer
GO:0005578proteinaceous extracellular matrix
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005201extracellular matrix structural constituent
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001791Laminin G domainSMARTSM00210TSPN_2coord: 41..217
e-value: 1.1E-7
score: 41.6
IPR001791Laminin G domainPROSITEPS50025LAM_G_DOMAINcoord: 62..231
score: 12.174
IPR000885Fibrillar collagen, C-terminalSMARTSM00038COLFI_2coord: 1381..1622
e-value: 2.0E-29
score: 113.7
IPR000885Fibrillar collagen, C-terminalPFAMPF01410COLFIcoord: 1383..1621
e-value: 3.7E-52
score: 177.0
IPR000885Fibrillar collagen, C-terminalPROSITEPS51461NC1_FIBcoord: 1382..1622
score: 50.891
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 29..233
e-value: 5.2E-27
score: 96.7
NoneNo IPR availableGENE3DG3DSA:2.60.120.1000coord: 1385..1621
e-value: 2.2E-56
score: 192.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 361..425
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 452..472
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1070..1093
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1134..1181
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1245..1269
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 668..689
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 531..568
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 764..810
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 501..520
NoneNo IPR availablePANTHERPTHR24023:SF590COLLAGEN ALPHA-1(XXIV) CHAINcoord: 551..711
NoneNo IPR availablePANTHERPTHR24023FAMILY NOT NAMEDcoord: 591..775
coord: 458..647
coord: 692..876
coord: 247..462
coord: 1016..1277
NoneNo IPR availablePANTHERPTHR24023:SF590COLLAGEN ALPHA-1(XXIV) CHAINcoord: 591..775
coord: 458..647
coord: 247..462
coord: 1016..1277
NoneNo IPR availablePANTHERPTHR24023FAMILY NOT NAMEDcoord: 383..569
NoneNo IPR availablePANTHERPTHR24023:SF590COLLAGEN ALPHA-1(XXIV) CHAINcoord: 383..569
NoneNo IPR availablePANTHERPTHR24023FAMILY NOT NAMEDcoord: 1110..1549
NoneNo IPR availablePANTHERPTHR24023:SF590COLLAGEN ALPHA-1(XXIV) CHAINcoord: 692..876
coord: 871..1036
coord: 1110..1549
NoneNo IPR availablePANTHERPTHR24023FAMILY NOT NAMEDcoord: 551..711
coord: 871..1036
NoneNo IPR availablePRODOMPD002078coord: 1505..1621
e-value: 2.0E-29
score: 330.0
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..28
score: 0.684
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR008160Collagen triple helix repeatPFAMPF01391Collagencoord: 319..375
e-value: 1.0E-6
score: 28.4
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 71..231