Lig_chan-Glu_bd domain-containing protein

Overview
NameLig_chan-Glu_bd domain-containing protein
Smed IDSMED30031596
Length (bp)726
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 67.0106 bits (162), Expect = 3.808e-12
Identity = 52/252 (20.63%), Postives = 109/252 (43.25%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTKW-WSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----YFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I+++ P       +S    ++  +W+  L     ++    + ++F+P+  +N +        +E+    L +FW  +G  + QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +    +  +     +I        S  +  K S   T  ++++      ++ LV    + + +  T + A L + +  +Y+   NC+   I    +++   G   P  S Y+
Sbjct:  540 KVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQI-GGLIDSKGYGVGTPIGSPYR 790          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Human
Match: GRIK5 (glutamate ionotropic receptor kainate type subunit 5 [Source:HGNC Symbol;Acc:HGNC:4583])

HSP 1 Score: 67.0106 bits (162), Expect = 4.244e-12
Identity = 54/253 (21.34%), Postives = 109/253 (43.08%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQ-PKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYF-----AIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  +N +         +E++     + W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I        S  +  +NS  +T +R+++       S+ V    + + +      A L + +  +Y    NC+   I    L+    G  +P  S ++
Sbjct:  508 KVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQI-GGLLDTKGYGIGMPLGSPFR 759          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Human
Match: GRIK5 (glutamate ionotropic receptor kainate type subunit 5 [Source:HGNC Symbol;Acc:HGNC:4583])

HSP 1 Score: 67.0106 bits (162), Expect = 4.244e-12
Identity = 54/253 (21.34%), Postives = 109/253 (43.08%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQ-PKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYF-----AIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  +N +         +E++     + W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I        S  +  +NS  +T +R+++       S+ V    + + +      A L + +  +Y    NC+   I    L+    G  +P  S ++
Sbjct:  508 KVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQI-GGLLDTKGYGIGMPLGSPFR 759          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 67.0106 bits (162), Expect = 4.349e-12
Identity = 52/252 (20.63%), Postives = 109/252 (43.25%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTKW-WSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----YFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I+++ P       +S    ++  +W+  L     ++    + ++F+P+  +N +        +E+    L +FW  +G  + QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +    +  +     +I        S  +  K S   T  ++++      ++ LV    + + +  T + A L + +  +Y+   NC+   I    +++   G   P  S Y+
Sbjct:  540 KVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQI-GGLIDSKGYGVGTPIGSPYR 790          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Human
Match: GRIK1 (glutamate ionotropic receptor kainate type subunit 1 [Source:HGNC Symbol;Acc:HGNC:4579])

HSP 1 Score: 67.0106 bits (162), Expect = 4.377e-12
Identity = 52/252 (20.63%), Postives = 109/252 (43.25%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTKW-WSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----YFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I+++ P       +S    ++  +W+  L     ++    + ++F+P+  +N +        +E+    L +FW  +G  + QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +    +  +     +I        S  +  K S   T  ++++      ++ LV    + + +  T + A L + +  +Y+   NC+   I    +++   G   P  S Y+
Sbjct:  525 KVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQI-GGLIDSKGYGVGTPIGSPYR 775          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Celegans
Match: glr-3 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q21415])

HSP 1 Score: 75.8702 bits (185), Expect = 1.402e-15
Identity = 59/253 (23.32%), Postives = 119/253 (47.04%), Query Frame = 1
Query:    1 NEVADFSHPIMSDPTVIIFQMPQPK-TKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLN----LYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKN-SNDETLRRLY-----SKSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +EV DF+ P M     I+F+ P+ + + W+     ++  VWI+  A   ++++   + +K SP+  +  +     Y  ++++ +   +FW ++   + QG E  P   S R +   WW F+ +  ++Y+A+L +VLT    +   +   +     + I + T+G  +T +  N S  ET  R++     S  + V    + + + ++ + A L + S  +Y V  +C    I    ++    G  LPK S Y+
Sbjct:  486 SEVIDFTVPYMHLGISILFKKPRIRDSDWFKFMDPLSTQVWIMTFASYFVVSVAIWIIAKISPYEQFERDEDNGQYKPVDNQFSLRNSFWFTVCSLMQQGSELCPRAASTRLLTGIWWFFALILISSYTANLAAVLTTRRMETPIENADDLAAQTK-IKYGTLGRGSTMSFFNESKIETYERMWQLMSSSPGLFVQSSKEGIARVKSSDYAYLMESSMLEYAVERDCELMQI-GGLIDQKGYGIGLPKGSPYR 736          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 67.781 bits (164), Expect = 7.835e-13
Identity = 56/255 (21.96%), Postives = 111/255 (43.53%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTK---WWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL-----YFAIEDEIN---FLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLY------SKSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNS 717
            EV DF+ P M     I+      +T     W+  + +++ VWI  L    I++    + +KFSP+  +NL       +  I+++ N    L +FW ++G  + QG +  P   + R +   WW+F+ +  ++Y+A L + LT+       ++  +  +  +I   +    S     + S      R++      S  + V    + + + ++   A + + S  +Y +  +C   SI    L++   G  LPK S
Sbjct:  494 EVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSGGYAYMMESSMLEYYLERDCELQSI-GGLLDSKGYGIALPKGS 747          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 67.3958 bits (163), Expect = 9.883e-13
Identity = 56/258 (21.71%), Postives = 112/258 (43.41%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTK---WWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL-----YFAIEDEIN---FLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLY------SKSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            EV DF+ P M     I+      +T     W+  + +++ VWI  L    I++    + +KFSP+  +NL       +  I+++ N    L +FW ++G  + QG +  P   + R +   WW+F+ +  ++Y+A L + LT+       ++  +  +  +I   +    S     + S      R++      S  + V    + + + ++   A + + S  +Y +  +C   SI    L++   G  LPK S  +
Sbjct:  494 EVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERIDERDFENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPGVFVNSSREGIARVKSGGYAYMMESSMLEYYLERDCELQSI-GGLLDSKGYGIALPKGSPLR 750          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Celegans
Match: glr-1 (Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:P34299])

HSP 1 Score: 64.3142 bits (155), Expect = 1.084e-11
Identity = 44/184 (23.91%), Postives = 91/184 (49.46%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTKWWSIF---KSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNL----NLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLY 534
             V DFS P M+  T I   + +P  + +S+F   + ++  +W+  +     +++   L S+FSP+  W +       F I ++ +     W ++  F+ QG +  P  IS R   + WW F+ +  ++Y+A+L + LT+ + Q   +++ +    ++I   +  G S  S  K S+ +  +R++
Sbjct:  556 RVVDFSKPFMT--TGISIMIKKPDKQEFSVFSFMQPLSTEIWMYIIFAYIGVSVVIFLVSRFSPYE-WRVEETSRGGFTISNDFSVYNCLWFTLAAFMQQGTDILPRSISGRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAPIESVEDLAKQSKIKYGIQGGGSTASFFKYSSVQIYQRMW 736          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 63.929 bits (154), Expect = 1.499e-11
Identity = 52/233 (22.32%), Postives = 108/233 (46.35%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKT-KWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWN--LNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS-------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPE 672
               DFS P M+    I+ + P+ +    +S  + + + +WI  L+    ++L   L S FSP+          F + +E     + W ++  F+ QG +  P  +S R   +CWW F+ +  ++Y+A+L + LT+       +++ +  + N+I+  +  G S  +  ++S     +++++       K I + K S   + + T N   ++ Y+     V T+  +Y+ L E
Sbjct:  515 RAVDFSKPFMTTGISIMIKKPEKQEFNIFSFMEPLGMTIWIFTLSSYFGVSLTIFLVSWFSPYEKRIEFKRGEFTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNKILYGVNEGGSTAAFFEDSIVPLYKKMWNFMVSTTQKQIELEKQS---ITNSTSNRIFVSSYADGIEKVRTSKGKYAFLLE 744          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0110906)

HSP 1 Score: 66.6254 bits (161), Expect = 2.548e-12
Identity = 63/252 (25.00%), Postives = 115/252 (45.63%), Query Frame = 1
Query:    7 VADFSHPIMSDPTVIIFQMPQPK-TKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----YFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSN-LKNSNDETLRRLYSK------SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            V DF+ P M+    I+F++P  + T+ +S    + I +WI  L    +++L   +  K SP     +N       +I ++ +  ++FW +IG F+ Q  + YP  +S R + + W  FS +  A+Y+A+L + LT  E+   P   +E   S   I + T+   +T    ++S  ET ++++        S         + +    N A L + +   YIV  +C+   I    L+    G   PK S ++
Sbjct:  497 VIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLT-TERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQRDCNLTQI-GGLLDTKGYGIATPKGSPWR 746          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Fly
Match: Ekar (gene:FBgn0039916 transcript:FBtr0344874)

HSP 1 Score: 66.6254 bits (161), Expect = 2.695e-12
Identity = 63/252 (25.00%), Postives = 115/252 (45.63%), Query Frame = 1
Query:    7 VADFSHPIMSDPTVIIFQMPQPK-TKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----YFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSN-LKNSNDETLRRLYSK------SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            V DF+ P M+    I+F++P  + T+ +S    + I +WI  L    +++L   +  K SP     +N       +I ++ +  ++FW +IG F+ Q  + YP  +S R + + W  FS +  A+Y+A+L + LT  E+   P   +E   S   I + T+   +T    ++S  ET ++++        S         + +    N A L + +   YIV  +C+   I    L+    G   PK S ++
Sbjct:  496 VIDFTKPFMNLGISILFKVPTSEPTRLFSFMNPLAIEIWIYVLIAYFLVSLCIYIVGKLSPIEWKCINACDLENISIGNQFSLTDSFWFTIGTFMQQSPDIYPRAMSTRIISSTWGFFSLIIVASYTANLAAFLT-TERMINPIENAEDLASQTEISYGTLDSGSTMTFFRDSVIETYKKIWRSMDNKKPSAFTTTYEDGIKRVNQGNYAFLMESTMLDYIVQRDCNLTQI-GGLLDTKGYGIATPKGSPWR 745          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0333701)

HSP 1 Score: 66.2402 bits (160), Expect = 3.611e-12
Identity = 60/253 (23.72%), Postives = 117/253 (46.25%), Query Frame = 1
Query:    7 VADFSHPIMSDPTVIIFQMP--QPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFA----IEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLP-QTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLY------SKSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            V DF+ P M+    I+F++P  QP T+ +S    + I +W+  LA   +++    + ++FSP+   N +  +     +E++ +   +FW   G FL QG    P   S R V  CW+ F  +  ++Y+A+L + LT+ E+   P ++ S+  +  EI      G S  +  ++S     ++++        ++ V      + +    + A L + +   Y V  +C+   I    L++   G   PK S ++
Sbjct:  519 VIDFTKPFMNLGIGILFKVPTSQP-TRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTV-ERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQRDCNLTQI-GGLLDSKGYGIATPKGSPWR 768          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Fly
Match: CG11155 (gene:FBgn0039927 transcript:FBtr0089195)

HSP 1 Score: 66.2402 bits (160), Expect = 3.611e-12
Identity = 60/253 (23.72%), Postives = 117/253 (46.25%), Query Frame = 1
Query:    7 VADFSHPIMSDPTVIIFQMP--QPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFA----IEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLP-QTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLY------SKSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            V DF+ P M+    I+F++P  QP T+ +S    + I +W+  LA   +++    + ++FSP+   N +  +     +E++ +   +FW   G FL QG    P   S R V  CW+ F  +  ++Y+A+L + LT+ E+   P ++ S+  +  EI      G S  +  ++S     ++++        ++ V      + +    + A L + +   Y V  +C+   I    L++   G   PK S ++
Sbjct:  519 VIDFTKPFMNLGIGILFKVPTSQP-TRLFSFMNPLAIEIWLYVLAAYILVSFALFVMARFSPYEWKNPHPCYKETDIVENQFSISNSFWFITGTFLRQGSGLNPKATSTRIVGGCWFFFCLIIISSYTANLAAFLTV-ERMISPIESASDLAEQTEISYGTLEGGSTMTFFRDSKIGIYQKMWRYMENRKTAVFVKTYEDGIKRVMEGSYAFLMESTMLDYAVQRDCNLTQI-GGLLDSKGYGIATPKGSPWR 768          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 65.0846 bits (157), Expect = 7.661e-12
Identity = 54/253 (21.34%), Postives = 108/253 (42.69%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMP--QPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFS--SWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLL--LQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +  DF+ P M+    I+++ P  QP    +S    +++ VWI        +++   + +KF+P+   ++       +E +   L   W +IG  + QG +F P  +S R V   WW F+ +  ++Y+A+L + LT+       ++  +      I      G S  +  ++S   T +R++S       S+      + +  +     + A L + +  +Y+   NC    +    L+    G   P NS Y+
Sbjct:  510 QAVDFTTPFMNLGVSILYRKPIKQPPN-LFSFLSPLSLDVWIYMATAYLGVSVLLFILAKFTPYEWPAYTDAHGEKVESQFTLLNCMWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVERVAKGKGSYAFLMESTSIEYVTERNCELTQV-GGMLDTKSYGIATPPNSPYR 760          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Zebrafish
Match: grik5 (glutamate receptor, ionotropic, kainate 5 [Source:ZFIN;Acc:ZDB-GENE-070821-6])

HSP 1 Score: 68.5514 bits (166), Expect = 8.212e-13
Identity = 61/255 (23.92%), Postives = 112/255 (43.92%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMP-QPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLEN-------FWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRR----LYSK--SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  +N   +  + +  + LEN        W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I      G S  +   NS  +T +R    +YSK  S+ V    + + +      A L + +  +Y  S NC+   I    L+    G  +P  S ++
Sbjct:  240 KVIDFSKPFMTLGISILYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLSARLSPYEWYNP--HPCLRERRDLLENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESPDDLADQTNIQYGTIHGGSTMTFFMNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVVNSKYAFLLESTMNEYHRSLNCNLTQI-GGLLDTKGYGIGMPLGSPFR 491          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Zebrafish
Match: grik4 (glutamate receptor, ionotropic, kainate 4 [Source:ZFIN;Acc:ZDB-GENE-070821-5])

HSP 1 Score: 67.3958 bits (163), Expect = 1.977e-12
Identity = 59/255 (23.14%), Postives = 113/255 (44.31%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMP-QPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLEN-------FWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRR----LYSK--SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    +  ++S     +  VW+  L     ++    L ++ +P+  +N   +  ++   + L N       FW  +G F+ QG    P  +S R V   WW F+ +  ++Y+A+L + LT+   +   +++ +  D   I      G S  +  +NS  +T +R    +YSK  S+ V    + + +    N A L + +  +Y    NC+   I    L+    G  +P  S Y+
Sbjct:  509 KVIDFSKPFMTLGISIMYRVHIGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYNP--HPCLKGRCSLLINQYSLGNSFWFPVGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLADQTAIEYGTMHGGSTMTFFQNSRYQTYQRMWNFMYSKQPSVFVKSTEEGIARVLNSNYAYLLESTMNEYYRQRNCNLTQI-GGLLDTKGYGIGMPLGSVYR 760          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Zebrafish
Match: grik4 (glutamate receptor, ionotropic, kainate 4 [Source:ZFIN;Acc:ZDB-GENE-070821-5])

HSP 1 Score: 67.3958 bits (163), Expect = 1.977e-12
Identity = 59/255 (23.14%), Postives = 113/255 (44.31%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMP-QPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLEN-------FWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRR----LYSK--SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    +  ++S     +  VW+  L     ++    L ++ +P+  +N   +  ++   + L N       FW  +G F+ QG    P  +S R V   WW F+ +  ++Y+A+L + LT+   +   +++ +  D   I      G S  +  +NS  +T +R    +YSK  S+ V    + + +    N A L + +  +Y    NC+   I    L+    G  +P  S Y+
Sbjct:  509 KVIDFSKPFMTLGISIMYRVHIGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYNP--HPCLKGRCSLLINQYSLGNSFWFPVGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLADQTAIEYGTMHGGSTMTFFQNSRYQTYQRMWNFMYSKQPSVFVKSTEEGIARVLNSNYAYLLESTMNEYYRQRNCNLTQI-GGLLDTKGYGIGMPLGSVYR 760          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Zebrafish
Match: gria2b (glutamate receptor, ionotropic, AMPA 2b [Source:ZFIN;Acc:ZDB-GENE-020125-4])

HSP 1 Score: 67.0106 bits (162), Expect = 2.220e-12
Identity = 42/143 (29.37%), Postives = 68/143 (47.55%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQ-PKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIED----------EINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTI 399
            EV DFS P MS    I+ + PQ  K   +S    +   +W+  +     +++   L S+FSP+  W+   Y   ED          E     + W S+G F+ QG +  P  +S R V   WW F+ +  ++Y+A+L + LT+
Sbjct:  505 EVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEY---EDGQIQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTV 643          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Zebrafish
Match: grik5 (glutamate receptor, ionotropic, kainate 5 [Source:ZFIN;Acc:ZDB-GENE-070821-6])

HSP 1 Score: 67.0106 bits (162), Expect = 2.333e-12
Identity = 62/255 (24.31%), Postives = 112/255 (43.92%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMP-QPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLEN-------FWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRR----LYSK--SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  W  N +  + +  + LEN        W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I      G S  +   NS  +T +R    +YSK  S+ V    + + +      A L + +  +Y  S NC+   I    L+    G  +P  S ++
Sbjct:  521 KVIDFSKPFMTLGISILYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLSARLSPYE-W-YNPHPCLRERRDLLENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESPDDLADQTNIQYGTIHGGSTMTFFMNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVVNSKYAFLLESTMNEYHRSLNCNLTQI-GGLLDTKGYGIGMPLGSPFR 772          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 72.4034 bits (176), Expect = 5.824e-14
Identity = 56/253 (22.13%), Postives = 111/253 (43.87%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQ-PKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLN-----LYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  +N +      +  +E++     + W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I      G S  +  +NS  +T +R+++       S+ V    + + +      A L + +  +Y    NC+   I    L+    G  +P  S Y+
Sbjct:  458 KVIDFSKPFMTLGISILYRVQMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESADDLADQTNIEYGTIHGGSTMTFFQNSRYQTYQRMWNYMNSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQI-GGLLDTKGYGIGMPLGSPYR 709          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 69.3218 bits (168), Expect = 6.014e-13
Identity = 56/253 (22.13%), Postives = 110/253 (43.48%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQP-KTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWN-----LNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  +N        +  +E++     + W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I      G S  +  +NS  +T +R+++       S+ V    + + +      A L + +  +Y    NC+   I    L+    G  +P  S Y+
Sbjct:  502 KVIDFSKPFMTLGISILYRVQMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESADDLADQTNIEYGTIHGGSTMTFFQNSRYQTYQRMWNYMNSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQI-GGLLDTKGYGIGMPLGSPYR 753          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 68.9366 bits (167), Expect = 7.245e-13
Identity = 56/253 (22.13%), Postives = 110/253 (43.48%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQP-KTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWN-----LNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  +N        +  +E++     + W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I      G S  +  +NS  +T +R+++       S+ V    + + +      A L + +  +Y    NC+   I    L+    G  +P  S Y+
Sbjct:  223 KVIDFSKPFMTLGISILYRVQMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESADDLADQTNIEYGTIHGGSTMTFFQNSRYQTYQRMWNYMNSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQI-GGLLDTKGYGIGMPLGSPYR 474          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 68.9366 bits (167), Expect = 9.069e-13
Identity = 56/253 (22.13%), Postives = 110/253 (43.48%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQP-KTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWN-----LNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  +N        +  +E++     + W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I      G S  +  +NS  +T +R+++       S+ V    + + +      A L + +  +Y    NC+   I    L+    G  +P  S Y+
Sbjct:  504 KVIDFSKPFMTLGISILYRVQMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESADDLADQTNIEYGTIHGGSTMTFFQNSRYQTYQRMWNYMNSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQI-GGLLDTKGYGIGMPLGSPYR 755          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Xenopus
Match: ogfr (opioid growth factor receptor [Source:Xenbase;Acc:XB-GENE-997410])

HSP 1 Score: 68.1662 bits (165), Expect = 1.270e-12
Identity = 56/253 (22.13%), Postives = 110/253 (43.48%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQP-KTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWN-----LNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  +N        +  +E++     + W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I      G S  +  +NS  +T +R+++       S+ V    + + +      A L + +  +Y    NC+   I    L+    G  +P  S Y+
Sbjct:  503 KVIDFSKPFMTLGISILYRVQMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRERHHILENQYTLGNSLWFPVGGFMQQGSEVMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESADDLADQTNIEYGTIHGGSTMTFFQNSRYQTYQRMWNYMNSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQI-GGLLDTKGYGIGMPLGSPYR 754          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 68.5514 bits (166), Expect = 9.075e-13
Identity = 53/252 (21.03%), Postives = 109/252 (43.25%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTKW-WSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----YFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I+++ P       +S    ++  +W+  L     ++    + ++F+P+  +N +        +E+    L +FW  +G  + QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +    +  +     +I        S  +  K S   T  ++++      +S LV    + + +  T + A L + +  +Y+   NC+   I    +++   G   P  S Y+
Sbjct:  540 KVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQI-GGLIDSKGYGVGTPIGSPYR 790          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 68.1662 bits (165), Expect = 1.093e-12
Identity = 53/252 (21.03%), Postives = 109/252 (43.25%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTKW-WSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----YFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I+++ P       +S    ++  +W+  L     ++    + ++F+P+  +N +        +E+    L +FW  +G  + QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +    +  +     +I        S  +  K S   T  ++++      +S LV    + + +  T + A L + +  +Y+   NC+   I    +++   G   P  S Y+
Sbjct:  525 KVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQI-GGLIDSKGYGVGTPIGSPYR 775          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 68.1662 bits (165), Expect = 1.125e-12
Identity = 53/252 (21.03%), Postives = 109/252 (43.25%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTKW-WSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----YFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I+++ P       +S    ++  +W+  L     ++    + ++F+P+  +N +        +E+    L +FW  +G  + QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +    +  +     +I        S  +  K S   T  ++++      +S LV    + + +  T + A L + +  +Y+   NC+   I    +++   G   P  S Y+
Sbjct:  454 KVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQI-GGLIDSKGYGVGTPIGSPYR 704          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 68.1662 bits (165), Expect = 1.190e-12
Identity = 53/252 (21.03%), Postives = 109/252 (43.25%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTKW-WSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----YFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I+++ P       +S    ++  +W+  L     ++    + ++F+P+  +N +        +E+    L +FW  +G  + QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +    +  +     +I        S  +  K S   T  ++++      +S LV    + + +  T + A L + +  +Y+   NC+   I    +++   G   P  S Y+
Sbjct:  525 KVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQI-GGLIDSKGYGVGTPIGSPYR 775          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Mouse
Match: Grik1 (glutamate receptor, ionotropic, kainate 1 [Source:MGI Symbol;Acc:MGI:95814])

HSP 1 Score: 68.1662 bits (165), Expect = 1.271e-12
Identity = 53/252 (21.03%), Postives = 109/252 (43.25%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTKW-WSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLN----LYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I+++ P       +S    ++  +W+  L     ++    + ++F+P+  +N +        +E+    L +FW  +G  + QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +    +  +     +I        S  +  K S   T  ++++      +S LV    + + +  T + A L + +  +Y+   NC+   I    +++   G   P  S Y+
Sbjct:  540 KVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQI-GGLIDSKGYGVGTPIGSPYR 790          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. UniProt/SwissProt
Match: sp|P26591|GLRK_LYMST (Glutamate receptor OS=Lymnaea stagnalis OX=6523 PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 6.569e-13
Identity = 49/182 (26.92%), Postives = 95/182 (52.20%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTK-WWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLN--LYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLP-QTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS 537
             V DF+ P MS    I+ + PQP  K ++S  + ++  +W+  +     +++   L S+FSP + W+L+   +  I ++ +   + W S+G F+ QG +  P  +S R V + WW F+ +  ++Y+A+L + LT+ E+   P  +  +     EI     +  S  +  KNS  +T +R+++
Sbjct:  521 RVIDFTKPFMSLGISIMIKRPQPAGKHFFSFMEPLSSEIWMCIVFAYIGVSVVLFLVSRFSP-NEWHLSEAHHSYIANDFSISNSLWFSLGAFMQQGCDISPRSMSGRIVGSVWWFFTLIIISSYTANLAAFLTV-ERMLTPIDSAEDLARQTEIQYGTIMSGSTKAFFKNSQFQTYQRMWA 700          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. UniProt/SwissProt
Match: sp|P22756|GRIK1_RAT (Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus OX=10116 GN=Grik1 PE=1 SV=3)

HSP 1 Score: 67.781 bits (164), Expect = 1.062e-11
Identity = 53/252 (21.03%), Postives = 109/252 (43.25%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTKW-WSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----YFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I+++ P       +S    ++  +W+  L     ++    + ++F+P+  +N +        +E+    L +FW  +G  + QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +    +  +     +I        S  +  K S   T  ++++      +S LV    + + +  T + A L + +  +Y+   NC+   I    +++   G   P  S Y+
Sbjct:  540 KVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQSALVKNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQI-GGLIDSKGYGVGTPIGSPYR 790          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. UniProt/SwissProt
Match: sp|Q38PU4|GRIK1_MACFA (Glutamate receptor ionotropic, kainate 1 OS=Macaca fascicularis OX=9541 GN=GRIK1 PE=2 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.031e-11
Identity = 52/252 (20.63%), Postives = 109/252 (43.25%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTKW-WSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----YFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I+++ P       +S    ++  +W+  L     ++    + ++F+P+  +N +        +E+    L +FW  +G  + QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +    +  +     +I        S  +  K S   T  ++++      ++ LV    + + +  T + A L + +  +Y+   NC+   I    +++   G   P  S Y+
Sbjct:  540 KVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQI-GGLIDSKGYGVGTPIGSPYR 790          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. UniProt/SwissProt
Match: sp|Q16478|GRIK5_HUMAN (Glutamate receptor ionotropic, kainate 5 OS=Homo sapiens OX=9606 GN=GRIK5 PE=2 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 2.038e-11
Identity = 54/253 (21.34%), Postives = 109/253 (43.08%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQ-PKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYF-----AIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  +N +         +E++     + W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I        S  +  +NS  +T +R+++       S+ V    + + +      A L + +  +Y    NC+   I    L+    G  +P  S ++
Sbjct:  508 KVIDFSKPFMTLGISILYRVHMGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCLRARPHILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPVESADDLADQTNIEYGTIHAGSTMTFFQNSRYQTYQRMWNYMQSKQPSVFVKSTEEGIARVLNSRYAFLLESTMNEYHRRLNCNLTQI-GGLLDTKGYGIGMPLGSPFR 759          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. UniProt/SwissProt
Match: sp|P39086|GRIK1_HUMAN (Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens OX=9606 GN=GRIK1 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 2.088e-11
Identity = 52/252 (20.63%), Postives = 109/252 (43.25%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQPKTKW-WSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----YFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I+++ P       +S    ++  +W+  L     ++    + ++F+P+  +N +        +E+    L +FW  +G  + QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +    +  +     +I        S  +  K S   T  ++++      ++ LV    + + +  T + A L + +  +Y+   NC+   I    +++   G   P  S Y+
Sbjct:  540 KVIDFSKPFMTLGISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQI-GGLIDSKGYGVGTPIGSPYR 790          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. TrEMBL
Match: A0A1I8J1L9 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 4.003e-37
Identity = 75/241 (31.12%), Postives = 127/241 (52.70%), Query Frame = 1
Query:    1 NEVADFSHPIMSDPTVIIFQMPQPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYSKSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEY 723
            +EV DFS P+  +   I+   P P++K W +F    + VW+  +A + +    + + + FSPF+++NLNL FAI DE+   E  WS+IG FL QGQ+FYP+ +S+R   A WW+ S +   A++ DLT+ LT+    +  +T+ + T   EI  ++  G S  + L N+     +++    + +             N ACLTDY+    I   NC+++ +  E    +    +LP ++ Y
Sbjct:   63 DEVIDFSVPLFEESNAILLPRPAPESKLWRVFSPFTMSVWLSIVAALFVTTFATWVLAYFSPFTAYNLNLEFAIADEVWLQEYLWSAIGSFLQQGQDFYPFAMSSRTAMAFWWLLSVIICGAFNGDLTAHLTVTVTHYPIKTLDDLTGQTEIRPYVIAGTSLHTLLLNAESGVYKKITESMVELGPYDDCPTDPPNPNQACLTDYTYLLNIARKNCTQFYLAEELFLTAPIALMLPDDAFY 303          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. TrEMBL
Match: A0A1I8HAM9 (CCHC-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 2.679e-35
Identity = 79/242 (32.64%), Postives = 130/242 (53.72%), Query Frame = 1
Query:    7 VADFSHPIMSDPTVIIFQMPQPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYSK---SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEY 723
            V DFS P+  +   I+   P P++K W+++      VWIL + FI + A  + + + FSPF+++NL L FA  DEI   E  WS +G F+ QGQ+FYP+ +S R V A WW+F+ + +  Y+ DLT+ LTI+      +T+S+    + +   +  G +  + L  S     R++  K   S  +P+C +   Q +    ACLTDY+   Y    NCS+  I  E   ++   F+ P+++ +
Sbjct: 1024 VVDFSTPLFQEAYGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVSAAVTWVLAYFSPFTAYNLRLEFAFADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIKTLSDLVAQSAVKPLVPEGTNLYNLLTTSTGGVYRQVADKLQISDTIPECIEQTFQGKE---ACLTDYTALLYAARANCSKVYIADEIFNSATVAFMYPEDAYF 1262          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. TrEMBL
Match: A0A1I8HR46 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 5.426e-35
Identity = 75/241 (31.12%), Postives = 127/241 (52.70%), Query Frame = 1
Query:    1 NEVADFSHPIMSDPTVIIFQMPQPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYSKSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEY 723
            +EV DFS P+  +   I+   P P++K W +F    + VW+  +A + +    + + + FSPF+++NLNL FAI DE+   E  WS+IG FL QGQ+FYP+ +S+R   A WW+ S +   A++ DLT+ LT+    +  +T+ + T   EI  ++  G S  + L N+     +++    + +             N ACLTDY+    I   NC+++ +  E    +    +LP ++ Y
Sbjct:  309 DEVIDFSVPLFEESNAILLPRPAPESKLWRVFSPFTMSVWLFIVAALFVTTFATWVLAYFSPFTAYNLNLEFAIADEVWLQEYLWSAIGSFLQQGQDFYPFAMSSRTAMAFWWLLSVIICGAFNGDLTAHLTVTVTHYPIKTLDDLTGQTEIRPYVIAGTSLHTLLLNAESGVYKKITESMVELGPYDDCPTDPPNPNQACLTDYTYLLNIARKNCTQFYLAEELFLTAPIALMLPDDAFY 549          

HSP 2 Score: 111.309 bits (277), Expect = 4.001e-24
Identity = 73/241 (30.29%), Postives = 118/241 (48.96%), Query Frame = 1
Query:    1 NEVADFSHPIMSDPTVIIFQMPQPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYSKSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEY 723
            + V DFS P+    T ++   P P TK W+IF  ++  VW L L  +   ++   + + +SPFS++NL L +A+ DEI   E  WS+IG FL QGQ+FYP+ +S R V A WW+F+ + F A++ DL S    A K ++P   + +T        LT  ES             +++    +++P            + AC+ DY+        +CS Y +L E    S    +  +++ Y
Sbjct:  874 DSVIDFSTPLFDQSTAVMVPKPPPDTKMWNIFTPLSPSVWYLLLGTLACASVVMWVLAYYSPFSAYNLGLEYAVSDEIWLHEYIWSAIGSFLQQGQDFYPFAMSPRTVMAFWWMFTLIIFGAFT-DLVS--QTAVKPYVPTGTNHYT-------LLTTAESG----------IYKQIADAMVVMPAGEYCPYNPPKNDAACINDYTFLLGQAIRHCSLYYMLSETFNPSTVALMYSEDAFY 1094          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. TrEMBL
Match: A0A267FSX5 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g2 PE=4 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 1.890e-34
Identity = 80/242 (33.06%), Postives = 132/242 (54.55%), Query Frame = 1
Query:    1 NEVADFSHPIMSDPTVIIFQMPQPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYSKSIL---VPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNS 717
            + V DFS P+  +   I+   P P++K W+++      VWIL + FI + A  + + + FSPFS++NL L FAI DEI   E  WS +G F+ QGQ+FYP+ +S R V A WW+F+ + +  Y+ DLT+ LTI+      +T+S+    + +   +  G +  + L +S     R++  K ++   +P C +   Q +    ACLTDY+   Y+   NCS+  I  E    +   F+ P+++
Sbjct:  246 DSVVDFSTPLFQEANGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVCAAVTWVLAYFSPFSAYNLRLEFAIADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIKTLSDLVAQSAVKPLVPEGTNLDTLLSSSTGGVYRQVADKMLMSDTLPGCIEQTFQGKE---ACLTDYTALLYVARANCSKVYIADEIFNTATVAFMYPEDA 484          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. TrEMBL
Match: A0A267H134 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g1 PE=3 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 1.319e-33
Identity = 79/242 (32.64%), Postives = 132/242 (54.55%), Query Frame = 1
Query:    1 NEVADFSHPIMSDPTVIIFQMPQPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYSKSIL---VPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNS 717
            + V DFS P+  +   I+   P P++K W+++      VWIL + FI + A  + + + FSPF+++NL L FAI DEI   E  WS +G F+ QGQ+FYP+ +S R V A WW+F+ + +  Y+ DLT+ LTI+      +T+S+    + +   +  G +  + L +S     R++  K ++   +P C +   Q +    ACLTDY+   Y+   NCS+  I  E    +   F+ P+++
Sbjct:  444 DSVVDFSTPLFQEANGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVCAAVTWVLAYFSPFTAYNLRLEFAIADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIKTLSDLVAQSAVKPLVPEGTNLDTLLSSSTGGVYRQVADKMLMSDTLPGCIEQTFQGKE---ACLTDYTALLYVARANCSKVYIADEIFNTATVAFMYPEDA 682          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Cavefish
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 67.781 bits (164), Expect = 1.215e-12
Identity = 50/252 (19.84%), Postives = 107/252 (42.46%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQ-PKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLN----LYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
             V DFS P M+    I+++ P    + ++S    +   +W+  L     ++    + ++FSP+  ++ +        +E+    L +FW  +G  + QG E  P  +S R +   WW F+ +  ++Y+A+L + LT+        +  +     +I   +    +  S  K S   T  ++++       + LV      + +    + A L + +  +Y+   NC+   +    +++   G   PK S Y+
Sbjct:  523 RVIDFSKPFMNTGISILYRRPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPSSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSKQSTSLVKSIEDGIQRVLKSDYALLMESTTIEYVTRRNCNLTQV-GGIIDSKGYGIGTPKGSPYR 773          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Cavefish
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 67.3958 bits (163), Expect = 1.425e-12
Identity = 50/252 (19.84%), Postives = 107/252 (42.46%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQP-KTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLN----LYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
             V DFS P M+    I+++ P    + ++S    +   +W+  L     ++    + ++FSP+  ++ +        +E+    L +FW  +G  + QG E  P  +S R +   WW F+ +  ++Y+A+L + LT+        +  +     +I   +    +  S  K S   T  ++++       + LV      + +    + A L + +  +Y+   NC+   +    +++   G   PK S Y+
Sbjct:  477 RVIDFSKPFMNTGISILYRRPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPSSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSKQSTSLVKSIEDGIQRVLKSDYALLMESTTIEYVTRRNCNLTQV-GGIIDSKGYGIGTPKGSPYR 727          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Cavefish
Match: GRIK3 (glutamate ionotropic receptor kainate type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4581])

HSP 1 Score: 67.3958 bits (163), Expect = 1.583e-12
Identity = 50/252 (19.84%), Postives = 108/252 (42.86%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQP-KTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLN----LYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
             V DFS P M+    I+++ P    + ++S    +   +W+  L     ++    + ++FSP+  ++ +        +E+    L +FW  +G  + QG E  P  +S R +   WW F+ +  ++Y+A+L + LT+        +  +     +I   +    +  S  K S   T  ++++       + LV      + +    + A L + +  +Y+   NC+  + +   +++   G   PK S Y+
Sbjct:  525 RVIDFSKPFMNTGISILYRRPNSTNSGFFSFLNPMTPDIWVYILLAYLGVSCVLFVIARFSPYEWYDAHPCNPSSDVVENNFTLLNSFWFGVGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAFLTVERMDSPVDSADDLAKQTKIEYGVVKDGATMSFFKKSRVSTFEKMWAFMSSKQSTSLVKSIEDGIQRVLKSDYALLMESTTIEYVTRRNCN-LTQVGGIIDSKGYGIGTPKGSPYR 775          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Cavefish
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:103024859])

HSP 1 Score: 66.6254 bits (161), Expect = 3.093e-12
Identity = 61/255 (23.92%), Postives = 112/255 (43.92%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMP-QPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLEN-------FWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRR----LYSK--SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  +N   +  + +  + LEN        W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I      G S  +   NS  +T +R    +YSK  S+ V    + + +      A L + +  +Y  S NC+   I    L+    G  +P  S ++
Sbjct:  522 KVIDFSKPFMTLGISILYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNP--HPCLRERRDMLENQYTLGNSLWFPVGGFMQQGSEIMPKALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEAPIESPDDLADQTNIQYGTIHGGSTMTFFMNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVVNSKYAFLLESTMNEYHRSLNCNLTQI-GGLLDTKGYGIGMPLGSPFR 773          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Cavefish
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:103024859])

HSP 1 Score: 66.6254 bits (161), Expect = 3.366e-12
Identity = 62/255 (24.31%), Postives = 112/255 (43.92%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMP-QPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLEN-------FWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRR----LYSK--SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  W  N +  + +  + LEN        W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I      G S  +   NS  +T +R    +YSK  S+ V    + + +      A L + +  +Y  S NC+   I    L+    G  +P  S ++
Sbjct:  522 KVIDFSKPFMTLGISILYRVHIGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYE-W-YNPHPCLRERRDMLENQYTLGNSLWFPVGGFMQQGSEIMPKALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEAPIESPDDLADQTNIQYGTIHGGSTMTFFMNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVVNSKYAFLLESTMNEYHRSLNCNLTQI-GGLLDTKGYGIGMPLGSPFR 773          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 1.054e-12
Identity = 51/248 (20.56%), Postives = 105/248 (42.34%), Query Frame = 1
Query:   13 DFSHPIMSDPTVIIFQMPQPKTKW-WSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----YFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS-----KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            DFS P M+    I+++ P       +S    ++  +W+  L     ++    + ++FSP+  +N +        +E+    L +FW  +G  + QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +    +  +      I        S  +  K S   T  ++++     ++ L+    + + +  T + A L + +  +Y+   NC+   I    ++    G   P  S Y+
Sbjct:   28 DFSKPFMTLGISILYRKPNGTNPGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYNPHPCNPDSDVVENNFTMLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQTALIKNNEEGIQRVLTTDYAMLMESTNIEYVTQRNCNLTQI-GGLIDNKGYGIGTPLGSPYR 274          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002503.1 (pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:ENSPMAG00000002286.1 transcript:ENSPMAT00000002503.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.5286 bits (127), Expect = 3.380e-9
Identity = 33/169 (19.53%), Postives = 73/169 (43.20%), Query Frame = 1
Query:  220 IEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYS------KSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLP 708
            +E+    L + W  +G  + QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +    +  +     +I        S  +  K S   T  ++++      ++ LV    + + ++ T + A L + +  +++    C+   I    +++   G  +P
Sbjct:   19 LENNFTMLNSLWFGVGALMQQGSELMPRALSTRIVGGIWWFFTLILISSYTANLAAFLTVERMESPIGSADDLAKQTKIEYGAVRDGSTMTFFKKSRISTYEKMWAFMSSRHQTALVKNNEEGIHRALTTDFAMLMESTTIEHVTQRYCNLTQI-GGLIDSKGYGVGMP 186          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Sea Lamprey
Match: gria1b (glutamate receptor, ionotropic, AMPA 1b [Source:ZFIN;Acc:ZDB-GENE-020125-2])

HSP 1 Score: 53.9138 bits (128), Expect = 9.684e-9
Identity = 45/184 (24.46%), Postives = 75/184 (40.76%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQP-KTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIE-------------------------------DEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLP-QTISEFTDSNEI 456
            EV DFS P MS    I+ + PQ  K    S    +   +W+  +     +++   L S+FSP+  W  +    +E                               +E     + W S+G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+ E+   P ++  +     EI
Sbjct:  125 EVIDFSKPFMSLGISIMIKKPQKSKPGVISFLDPLAYEIWMCIIFAYIGVSVVLFLVSRFSPYE-WQRDDDTDVEPNGNGGAGGGGGGGGSGGGAGGGSGGGGEPPNEFGIFNSLWFSLGAFMQQGCEISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTV-ERMVSPIESADDLAKQTEI 306          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 56.6102 bits (135), Expect = 2.346e-9
Identity = 62/264 (23.48%), Postives = 112/264 (42.42%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQM---PQPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNL----------YFAIEDEINFLENFWSSIGEFLFQGQEF-YPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSN-LKNSNDETLRRLYS----KSILVPKCSKLLLQSETMNMACLTDYSRAKYIV-STNCSRYSILPEFLEASFT----GFLLPKNSEY 723
            +V DF+ P M+    ++      P+P  ++   FKS    +WI     +  + + + LFS  SPF  +   +          Y   +  ++FL + WSS   +L QG +  +P   S R   A WW    +  A Y+A++ + LT    Q   + I + +   E I +  +  S T N  ++S+ +  + ++     +  L P     + ++     A + D    +Y+   T C R  ++  +   +F     GF LPK S Y
Sbjct:  472 KVIDFTQPFMTSGIGVVMGTENSPKPYFRFLEPFKS---DLWITIFGAVLGMGVVNWLFSVVSPFGFYGRCVQSINKRVKKSYLKQKYSLSFLNSIWSSAAYYLGQGPDGNHPVSASGRAAVAVWWFVITILGATYTANMAAFLTTTRMQTPIRRIEDLSSQTE-IAYGCVENSLTQNFFQSSSVQRYQMMWEYMKLRRSLQPDTYTAIERTLKGKYAFIHDAPILEYLARKTYCGRIKLIGGYDTRTFGNAHYGFALPKKSPY 731          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Nematostella
Match: EDO41293 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J7])

HSP 1 Score: 46.9802 bits (110), Expect = 2.069e-6
Identity = 48/232 (20.69%), Postives = 88/232 (37.93%), Query Frame = 1
Query:   55 FQMPQPKTKWWS---IFKSINIYVWXXXXXXXXXXXXXSQLFSKFSP--FSSWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYSK----SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEY 723
            F MP  K  W     +  ++ I +W               +  +FSP  F +   N      DE +   + W + G  L QG +  P   S R + A +W+F+ +  + Y+A+L +  T    +    ++ +    +     +  G S  S  + S     ++++ K    +  V    + + +S T   A LTD     Y          ++   L+A      L +NSE+
Sbjct:    4 FLMPFQKDLWACCCLVVGAVTILMW---------------ILDRFSPYGFRAEAKNTGEGEGDEFSLPNSLWFATGSILQQGGDNTPRSGSGRVLAASFWLFTLILISTYTANLAAFFTAQNSKSTINSLEDLVAQDVFKYGVQQGGSLFSFFEKSKVRIYKKMFGKMSTLNTFVKGTDEGVNRSRTTPFAYLTDQPSLDYYNQRKPCNTMLVKNLLDAKSYALGLQRNSEW 220          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000001416.2 (glutamate receptor ionotropic, kainate 5 [Source:NCBI gene;Acc:101155942])

HSP 1 Score: 70.4774 bits (171), Expect = 1.405e-13
Identity = 64/255 (25.10%), Postives = 111/255 (43.53%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMP-QPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLEN-------FWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRR----LYSK--SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  W  N Y    +  + LEN        W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I      G S  +   NS  +T +R    +YSK  S+ V    + + +      A L + +  +Y  S NC+   I    L+    G  +P  S Y+
Sbjct:  487 KVIDFSKPFMTLGISILYRVHLGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYE-W-YNPYPCFRERRDILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEAPIESADDLADQTNIQYGTIHGGSTMTFFMNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSKYAFLMESTMNEYYRSLNCNLTQI-GGLLDTKGYGIGMPLGSPYR 738          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000026787.1 (glutamate receptor ionotropic, kainate 5 [Source:NCBI gene;Acc:101155942])

HSP 1 Score: 70.0922 bits (170), Expect = 2.109e-13
Identity = 64/255 (25.10%), Postives = 111/255 (43.53%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMP-QPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLEN-------FWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRR----LYSK--SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  W  N Y    +  + LEN        W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I      G S  +   NS  +T +R    +YSK  S+ V    + + +      A L + +  +Y  S NC+   I    L+    G  +P  S Y+
Sbjct:  518 KVIDFSKPFMTLGISILYRVHLGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYE-W-YNPYPCFRERRDILENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEAPIESADDLADQTNIQYGTIHGGSTMTFFMNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSKYAFLMESTMNEYYRSLNCNLTQI-GGLLDTKGYGIGMPLGSPYR 769          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Medaka
Match: grik5 (glutamate ionotropic receptor kainate type subunit 5 [Source:NCBI gene;Acc:101174774])

HSP 1 Score: 68.5514 bits (166), Expect = 5.776e-13
Identity = 58/253 (22.92%), Postives = 110/253 (43.48%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMP-QPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYF-----AIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRR----LYSK--SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    K  ++S     +  VW+  L     ++    L ++ SP+  +N +         +E++     + W  +G F+ QG E  P  +S R V   WW F+ +  ++Y+A+L + LT+   +   ++  +  D   I      G S  +   NS  +T +R    +YSK  S+ V    + + +      A L + +  +Y    NC+   I    L+    G  +P  S ++
Sbjct:  517 KVIDFSKPFMTLGISILYRVQLGRKPGYFSFLDPFSPAVWLFMLLAYLAVSCVLFLAARLSPYEWYNPHPCMRERRDMLENQYTLGNSLWFPVGGFMQQGSEIMPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEAPIESPDDLADQTNIEYGTIHGGSTMTFFMNSRYQTYQRMWNYMYSKQPSVFVKSTEEGIARVLNSKYAFLMESTMNEYHRGLNCNLTQI-GGLLDTKGYGIGMPLGSPFR 768          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Medaka
Match: grik4 (glutamate ionotropic receptor kainate type subunit 4 [Source:NCBI gene;Acc:101170037])

HSP 1 Score: 68.5514 bits (166), Expect = 7.173e-13
Identity = 59/255 (23.14%), Postives = 114/255 (44.71%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMP-QPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLEN-------FWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRR----LYSK--SILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            +V DFS P M+    I++++    +  ++S     +  VW+  L     ++    L ++ +P+  +N   +  ++ + N L N       FW  +G F+ QG    P  +S R V   WW F+ +  ++Y+A+L + LT+   +   +++ +  D   I      G S  +  +NS  +T +R    ++SK  S+ V    + + +    N A L + +  +Y    NC+   I    L+    G  +P  S Y+
Sbjct:  509 KVIDFSKPFMTLGISIMYRVHLGRRPGYFSFLDPFSPGVWLFMLLAYLAVSCVLFLVARLTPYEWYNP--HPCLKGQCNLLINQYSLGNSFWFPVGGFMQQGSTIAPRALSTRCVSGVWWAFTLIIISSYTANLAAFLTVQRMEVPIESVDDLADQTSIEYGTMHGGSTMTFFQNSRYQTYQRMWNFMHSKQPSVFVKSTEEGIARVLNSNYAYLLESTMNEYYHQRNCNLTQI-GGLLDTKGYGVGMPLGSVYR 760          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Medaka
Match: gria2b (glutamate ionotropic receptor AMPA type subunit 2 [Source:NCBI gene;Acc:101168274])

HSP 1 Score: 67.0106 bits (162), Expect = 1.905e-12
Identity = 42/143 (29.37%), Postives = 68/143 (47.55%), Query Frame = 1
Query:    4 EVADFSHPIMSDPTVIIFQMPQ-PKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIED----------EINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTI 399
            EV DFS P MS    I+ + PQ  K   +S    +   +W+  +     +++   L S+FSP+  W+   Y   ED          E     + W S+G F+ QG +  P  +S R V   WW F+ +  ++Y+A+L + LT+
Sbjct:  505 EVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEY---EDGQIQTNESTNEFGIFNSLWFSLGAFMRQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTV 643          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Planmine SMEST
Match: SMESG000073183.1 (SMESG000073183.1)

HSP 1 Score: 286.574 bits (732), Expect = 6.988e-96
Identity = 138/242 (57.02%), Postives = 179/242 (73.97%), Query Frame = 1
Query:    1 NEVADFSHPIMSDPTVIIFQMPQPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYSKSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            N+V D+S+PI+SDP V+++Q P  K +WW+   S NI VW L    +  I++F+ +  K+SPFS+WNL L F+I+DEI   E+ W+SIG F  QGQ+FY YPIS+R V A WWIFSA+F A YSADLTS+LTI   Q LP ++ E  DSNEI LHLT+G S TSNLKNS DE L +LY+KS  V +CSKLLL+ ET N+AC+ DYS  +YI   NCSRY+I+PE +EA+FTGFL+PK ++YK
Sbjct:   78 NQVVDYSYPILSDPLVVMYQNPSSKVRWWNFLLSFNINVWCLTFISMLAISIFTTILCKYSPFSAWNLCLPFSIKDEILLKEHLWTSIGSFFLQGQDFYAYPISSRMVTASWWIFSAIFVAVYSADLTSLLTINNGQKLPNSLQEIADSNEIFLHLTVGYSITSNLKNSRDEILHKLYTKSKFVSECSKLLLEMETSNIACIGDYSEMRYIRMLNCSRYTIVPEVVEATFTGFLIPKLADYK 319          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Planmine SMEST
Match: SMESG000020658.1 (SMESG000020658.1)

HSP 1 Score: 259.996 bits (663), Expect = 1.233e-86
Identity = 122/232 (52.59%), Postives = 167/232 (71.98%), Query Frame = 1
Query:   31 MSDPTVIIFQMPQPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYSKSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            M+DP ++I+Q P  K +WW+ F S+N+ +W++    + ++A+ + +F KFSPFS+WNL L F I+DEI F E+ W+SIG FL QGQ+FY YPIS+R + A WWI SA+F A YSADLTS+LTI   Q LP T+    DS EI LHLTIG + T+NLK S D TL++LY KS  VP C  +L    + N+AC++D+S+ KY+   NCSRY+I+ E +E++FTGFL+PK SEYK
Sbjct:    1 MTDPIIVIYQNPHHKYRWWNSFLSVNLSIWMVTFLSMCVVAILTTIFCKFSPFSAWNLQLTFYIKDEILFGEHLWTSIGSFLMQGQDFYAYPISSRMITATWWIVSAIFLAVYSADLTSILTIDRGQTLPDTLEGVADSEEITLHLTIGYAITANLKASKDSTLQKLYMKSKFVPDCYDMLKSPFSQNIACISDFSQMKYVQLMNCSRYTIVSEIIESTFTGFLVPKLSEYK 232          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Planmine SMEST
Match: SMESG000080411.1 (SMESG000080411.1)

HSP 1 Score: 256.914 bits (655), Expect = 1.866e-83
Identity = 120/242 (49.59%), Postives = 171/242 (70.66%), Query Frame = 1
Query:    1 NEVADFSHPIMSDPTVIIFQMPQPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYSKSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            N+V D+S+P+M+DP ++I++ P PK  WW+ F S    VWIL    + +I + + LF KF+PFS+WNL L F I+DEI F E+ W+SIG F  QGQ+FY YPIS+R V A WWI SA+  A YSADLTS+LT+     +P T+    DS+EIILHLTIG ++++N+K S D  ++++Y+KSI VP C  LL   E+ N+AC++D S ++Y    NCS+Y+I+ E +E +FTGFL+PK S++K
Sbjct:  225 NQVVDYSYPLMTDPQIVIYKNPLPKVHWWNPFLSFKAPVWILTFLSMFLIGVITTLFCKFTPFSAWNLKLNFCIKDEIMFAEHIWTSIGTFFMQGQDFYAYPISSRMVTASWWIVSAILLAVYSADLTSLLTLNNGPTMPDTLEGIADSDEIILHLTIGYASSANIKKSQDAVIQKMYAKSIFVPDCLALLTNPESENVACISDLSPSRYTKLLNCSKYTIVSEIIETTFTGFLIPKLSDFK 466          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Planmine SMEST
Match: SMESG000020658.1 (SMESG000020658.1)

HSP 1 Score: 254.218 bits (648), Expect = 1.425e-81
Identity = 122/242 (50.41%), Postives = 171/242 (70.66%), Query Frame = 1
Query:    1 NEVADFSHPIMSDPTVIIFQMPQPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYSKSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            N V D+++P+M+DP ++I+Q P  K +WW+ F S+N+ +W++    + ++A+ + +F KFSPFS+WNL L F I+DEI F E+ W+SIG      Q+FY YPIS+R + A WWI SA+F A YSADLTS+LTI   Q LP T+    DS EI LHLTIG + T+NLK S D TL++LY KS  VP C  +L    + N+AC++D+S+ KY+   NCSRY+I+ E +E++FTGFL+PK SEYK
Sbjct:  227 NGVVDYTYPLMTDPIIVIYQNPHHKYRWWNSFLSVNLSIWMVTFLSMCVVAILTTIFCKFSPFSAWNLQLTFYIKDEILFGEHLWTSIG------QDFYAYPISSRMITATWWIVSAIFLAVYSADLTSILTIDRGQTLPDTLEGVADSEEITLHLTIGYAITANLKASKDSTLQKLYMKSKFVPDCYDMLKSPFSQNIACISDFSQMKYVQLMNCSRYTIVSEIIESTFTGFLVPKLSEYK 462          
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Planmine SMEST
Match: SMESG000061291.1 (SMESG000061291.1)

HSP 1 Score: 240.35 bits (612), Expect = 3.658e-77
Identity = 122/242 (50.41%), Postives = 167/242 (69.01%), Query Frame = 1
Query:    1 NEVADFSHPIMSDPTVIIFQMPQPKTKWWSIFKSINIYVWXXXXXXXXXXXXXSQLFSKFSPFSSWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYPYPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSNEIILHLTIGESATSNLKNSNDETLRRLYSKSILVPKCSKLLLQSETMNMACLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK 726
            N V D++ P+MSDPTV+I+Q P  K+  W+ F   +I VWIL L  + II +F+ +F  +SPFS+WNL L FAI +E+ F E+ W+ IG F  QGQ+ Y  P+S+R V A WW+FSA+F A YSADLTS LT+   + LP T+ E  +SNEI+L+LT G    SNLKNS D   ++LY+KS  V  C K+L+   + N+AC+TDYS+ KY    NCSRY+I+PE +E+++ GFLLPK  +YK
Sbjct:   70 NVVVDYTFPVMSDPTVVIYQNPNRKSNLWNFFFPFSISVWILTLMGMIIIPIFTVIFCIYSPFSAWNLELRFAIYNEVLFEEHLWNGIGTFFMQGQDLYTNPLSSRMVTAFWWLFSAIFLAVYSADLTSRLTLNNGEKLPTTLYEIAESNEIVLYLTEGFYINSNLKNSRDVVFQKLYAKSKFVRDCYKMLIDPGSTNIACITDYSQVKYTKMLNCSRYTIVPEIIESAYIGFLLPKMVDYK 311          
The following BLAST results are available for this feature:
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK13.808e-1220.63glutamate ionotropic receptor kainate type subunit... [more]
GRIK54.244e-1221.34glutamate ionotropic receptor kainate type subunit... [more]
GRIK54.244e-1221.34glutamate ionotropic receptor kainate type subunit... [more]
GRIK14.349e-1220.63glutamate ionotropic receptor kainate type subunit... [more]
GRIK14.377e-1220.63glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-31.402e-1523.32GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-47.835e-1321.96GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-49.883e-1321.71GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-11.084e-1123.91Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot... [more]
glr-21.499e-1122.32Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ekar2.548e-1225.00gene:FBgn0039916 transcript:FBtr0110906[more]
Ekar2.695e-1225.00gene:FBgn0039916 transcript:FBtr0344874[more]
CG111553.611e-1223.72gene:FBgn0039927 transcript:FBtr0333701[more]
CG111553.611e-1223.72gene:FBgn0039927 transcript:FBtr0089195[more]
KaiR1D7.661e-1221.34gene:FBgn0038837 transcript:FBtr0083987[more]
back to top
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grik58.212e-1323.92glutamate receptor, ionotropic, kainate 5 [Source:... [more]
grik41.977e-1223.14glutamate receptor, ionotropic, kainate 4 [Source:... [more]
grik41.977e-1223.14glutamate receptor, ionotropic, kainate 4 [Source:... [more]
gria2b2.220e-1229.37glutamate receptor, ionotropic, AMPA 2b [Source:ZF... [more]
grik52.333e-1224.31glutamate receptor, ionotropic, kainate 5 [Source:... [more]
back to top
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ogfr5.824e-1422.13opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr6.014e-1322.13opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr7.245e-1322.13opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr9.069e-1322.13opioid growth factor receptor [Source:Xenbase;Acc:... [more]
ogfr1.270e-1222.13opioid growth factor receptor [Source:Xenbase;Acc:... [more]
back to top
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grik19.075e-1321.03glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik11.093e-1221.03glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik11.125e-1221.03glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik11.190e-1221.03glutamate receptor, ionotropic, kainate 1 [Source:... [more]
Grik11.271e-1221.03glutamate receptor, ionotropic, kainate 1 [Source:... [more]
back to top
BLAST of Lig_chan-Glu_bd domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26591|GLRK_LYMST6.569e-1326.92Glutamate receptor OS=Lymnaea stagnalis OX=6523 PE... [more]
sp|P22756|GRIK1_RAT1.062e-1121.03Glutamate receptor ionotropic, kainate 1 OS=Rattus... [more]
sp|Q38PU4|GRIK1_MACFA2.031e-1120.63Glutamate receptor ionotropic, kainate 1 OS=Macaca... [more]
sp|Q16478|GRIK5_HUMAN2.038e-1121.34Glutamate receptor ionotropic, kainate 5 OS=Homo s... [more]
sp|P39086|GRIK1_HUMAN2.088e-1120.63Glutamate receptor ionotropic, kainate 1 OS=Homo s... [more]
back to top
BLAST of Lig_chan-Glu_bd domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J1L94.003e-3731.12PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A1I8HAM92.679e-3532.64CCHC-type domain-containing protein OS=Macrostomum... [more]
A0A1I8HR465.426e-3531.12Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267FSX51.890e-3433.06PBPe domain-containing protein (Fragment) OS=Macro... [more]
A0A267H1341.319e-3332.64PBPe domain-containing protein (Fragment) OS=Macro... [more]
back to top
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIK31.215e-1219.84glutamate ionotropic receptor kainate type subunit... [more]
GRIK31.425e-1219.84glutamate ionotropic receptor kainate type subunit... [more]
GRIK31.583e-1219.84glutamate ionotropic receptor kainate type subunit... [more]
grik53.093e-1223.92glutamate ionotropic receptor kainate type subunit... [more]
grik53.366e-1224.31glutamate ionotropic receptor kainate type subunit... [more]
back to top
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000005084.11.054e-1220.56pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
ENSPMAT00000002503.13.380e-919.53pep scaffold:Pmarinus_7.0:GL492163:1:1446:1 gene:E... [more]
gria1b9.684e-924.46glutamate receptor, ionotropic, AMPA 1b [Source:ZF... [more]
back to top
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO466332.346e-923.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412932.069e-620.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000001416.21.405e-1325.10glutamate receptor ionotropic, kainate 5 [Source:N... [more]
ENSORLT00000026787.12.109e-1325.10glutamate receptor ionotropic, kainate 5 [Source:N... [more]
grik55.776e-1322.92glutamate ionotropic receptor kainate type subunit... [more]
grik47.173e-1323.14glutamate ionotropic receptor kainate type subunit... [more]
gria2b1.905e-1229.37glutamate ionotropic receptor AMPA type subunit 2 ... [more]
back to top
BLAST of Lig_chan-Glu_bd domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000073183.16.988e-9657.02SMESG000073183.1[more]
SMESG000020658.11.233e-8652.59SMESG000020658.1[more]
SMESG000080411.11.866e-8349.59SMESG000080411.1[more]
SMESG000020658.11.425e-8150.41SMESG000020658.1[more]
SMESG000061291.13.658e-7750.41SMESG000061291.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031596 ID=SMED30031596|Name=Lig_chan-Glu_bd domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=726bp
AATGAGGTGGCAGATTTCAGTCATCCAATAATGTCTGACCCGACGGTGAT
CATTTTTCAAATGCCACAACCAAAAACAAAATGGTGGAGCATTTTTAAAT
CAATCAATATTTACGTCTGGATCCTTGCGCTTGCATTTATTGGAATCATT
GCTTTGTTTTCTCAACTTTTCTCAAAATTCAGCCCATTTTCTTCGTGGAA
TTTGAATTTATATTTTGCTATTGAAGATGAGATAAATTTCCTTGAAAATT
TTTGGTCAAGTATTGGAGAATTCTTATTTCAAGGACAAGAATTTTATCCT
TATCCAATATCAGCAAGATTCGTCAGAGCCTGTTGGTGGATATTTTCTGC
TGTCTTCTTTGCTGCATATTCTGCTGATCTCACTTCTGTATTGACGATTG
CCGAAAAGCAATTTCTTCCGCAAACCATTTCTGAATTCACAGACAGTAAT
GAGATCATTCTTCACTTAACAATTGGGGAGTCAGCAACAAGCAATTTAAA
AAACAGTAACGATGAAACATTACGACGTTTATATTCCAAAAGTATCCTAG
TTCCCAAGTGCTCTAAACTACTTCTACAGTCTGAGACAATGAATATGGCA
TGCTTAACTGATTACAGCCGAGCAAAATATATTGTCTCTACTAATTGTTC
GAGATATTCTATTTTACCTGAATTCTTGGAAGCTTCATTTACAGGGTTTT
TACTGCCTAAAAATTCCGAATATAAA
back to top

protein sequence of SMED30031596-orf-1

>SMED30031596-orf-1 ID=SMED30031596-orf-1|Name=SMED30031596-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=242bp
NEVADFSHPIMSDPTVIIFQMPQPKTKWWSIFKSINIYVWILALAFIGII
ALFSQLFSKFSPFSSWNLNLYFAIEDEINFLENFWSSIGEFLFQGQEFYP
YPISARFVRACWWIFSAVFFAAYSADLTSVLTIAEKQFLPQTISEFTDSN
EIILHLTIGESATSNLKNSNDETLRRLYSKSILVPKCSKLLLQSETMNMA
CLTDYSRAKYIVSTNCSRYSILPEFLEASFTGFLLPKNSEYK
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0004970ionotropic glutamate receptor activity
GO:0004872receptor activity
GO:0005216ion channel activity
GO:0005234extracellular-glutamate-gated ion channel activity
GO:0008066glutamate receptor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR001320Iontro_rcpt
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030424axon
GO:0030425dendrite
GO:0032839dendrite cytoplasm
GO:0043195terminal bouton
GO:0043204perikaryon
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0007165signal transduction
GO:0007268chemical synaptic transmission
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0042391regulation of membrane potential
GO:0051967negative regulation of synaptic transmission, glutamatergic
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 24..137
e-value: 5.8E-30
score: 106.3
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 14..231
e-value: 5.8E-30
score: 106.3
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 2..242
e-value: 5.8E-30
score: 106.3
NoneNo IPR availablePANTHERPTHR42643:SF13IONOTROPIC RECEPTOR 40A-RELATEDcoord: 2..241
NoneNo IPR availablePANTHERPTHR42643FAMILY NOT NAMEDcoord: 2..241
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 2..241
NoneNo IPR availableTMHMMTMhelixcoord: 35..57
NoneNo IPR availableTMHMMTMhelixcoord: 112..134
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 38..166
e-value: 2.4E-17
score: 63.1