Stomatin-like protein 1

Overview
NameStomatin-like protein 1
Smed IDSMED30031593
Length (bp)1311
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Stomatin-like protein 1 (SMED30031593) t-SNE clustered cells

Violin plots show distribution of expression levels for Stomatin-like protein 1 (SMED30031593) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Stomatin-like protein 1 (SMED30031593) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Stomatin-like protein 1 (SMED30031593) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031593

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30031593SMESG000000757.1 SmedASXL_013435SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30031593SMESG000000757.1 dd_Smed_v4_14375_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031593SMESG000000757.1 dd_Smed_v6_14375_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Stomatin-like protein 1 vs. Ensembl Human
Match: STOML1 (stomatin like 1 [Source:HGNC Symbol;Acc:HGNC:14560])

HSP 1 Score: 73.9442 bits (180), Expect = 8.204e-14
Identity = 49/198 (24.75%), Postives = 95/198 (47.98%), Query Frame = 1
Query:  229 LGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVR--NWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKV--LVDNITQKKEPESS---LD-VLKKINFKDLGRQLTSMT 795
            LGFL++L  FP+ GWF+LK++    ++ VFR G++     PG+  ++P IDS + +D   +   V      +KD  ++ +   +++RI DP   ++ V+  N    +  +  ++   + +  R       +I+     Q+   +N      GLE+ +V   V+ + Q  +   +   LD  L+++    LG  + SM 
Sbjct:   20 LGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKIS----DQLLLEINDVTRAWGLEVDRVELAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGSMNSMA 213          
BLAST of Stomatin-like protein 1 vs. Ensembl Human
Match: STOML1 (stomatin like 1 [Source:HGNC Symbol;Acc:HGNC:14560])

HSP 1 Score: 69.707 bits (169), Expect = 1.025e-13
Identity = 31/100 (31.00%), Postives = 58/100 (58.00%), Query Frame = 1
Query:  229 LGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            LGFL++L  FP+ GWF+LK++    ++ VFR G++     PG+  ++P IDS + +D   +   V      +KD  ++ +   +++RI DP   ++ V++
Sbjct:   20 LGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKD 119          
BLAST of Stomatin-like protein 1 vs. Ensembl Human
Match: STOML1 (stomatin like 1 [Source:HGNC Symbol;Acc:HGNC:14560])

HSP 1 Score: 73.9442 bits (180), Expect = 1.109e-13
Identity = 49/198 (24.75%), Postives = 95/198 (47.98%), Query Frame = 1
Query:  229 LGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVR--NWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKV--LVDNITQKKEPESS---LD-VLKKINFKDLGRQLTSMT 795
            LGFL++L  FP+ GWF+LK++    ++ VFR G++     PG+  ++P IDS + +D   +   V      +KD  ++ +   +++RI DP   ++ V+  N    +  +  ++   + +  R       +I+     Q+   +N      GLE+ +V   V+ + Q  +   +   LD  L+++    LG  + SM 
Sbjct:   62 LGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKIS----DQLLLEINDVTRAWGLEVDRVELAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGSMNSMA 255          
BLAST of Stomatin-like protein 1 vs. Ensembl Human
Match: STOML1 (stomatin like 1 [Source:HGNC Symbol;Acc:HGNC:14560])

HSP 1 Score: 73.1738 bits (178), Expect = 1.143e-13
Identity = 49/198 (24.75%), Postives = 95/198 (47.98%), Query Frame = 1
Query:  229 LGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVR--NWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKV--LVDNITQKKEPESS---LD-VLKKINFKDLGRQLTSMT 795
            LGFL++L  FP+ GWF+LK++    ++ VFR G++     PG+  ++P IDS + +D   +   V      +KD  ++ +   +++RI DP   ++ V+  N    +  +  ++   + +  R       +I+     Q+   +N      GLE+ +V   V+ + Q  +   +   LD  L+++    LG  + SM 
Sbjct:   62 LGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKIS----DQLLLEINDVTRAWGLEVDRVELAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGSMNSMA 255          
BLAST of Stomatin-like protein 1 vs. Ensembl Human
Match: STOML1 (stomatin like 1 [Source:HGNC Symbol;Acc:HGNC:14560])

HSP 1 Score: 54.6842 bits (130), Expect = 5.414e-9
Identity = 23/57 (40.35%), Postives = 38/57 (66.67%), Query Frame = 1
Query:  229 LGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYID 396
            LGFL++L  FP+ GWF+LK++    ++ VFR G++     PG+  ++P IDS + +D
Sbjct:   20 LGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVD 76          
BLAST of Stomatin-like protein 1 vs. Ensembl Celegans
Match: unc-24 (UNC-24 [Source:UniProtKB/TrEMBL;Acc:G5ED76])

HSP 1 Score: 64.6994 bits (156), Expect = 4.554e-11
Identity = 51/184 (27.72%), Postives = 80/184 (43.48%), Query Frame = 1
Query:  235 FLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNITQKKEPES-SLDVLKKINFKDLGRQL 783
              +V+  P+   F+LK I  + KL V R G+  K   PGI  VIP ID+   +  +I    V      T D GLVE+   +  +I DP   +  V++         R + +  + N   Y +   +   D E   FT       + G+EI  V + ++   KE E+  +  L  +   D G+QL
Sbjct:  117 LFVVMTMPLSLLFALKFISTSEKLVVLRLGRAQKTRGPGITLVIPCIDTTHKVTMSITAFNVPPLQIITTDRGLVELGATVFLKIRDPIAAVCGVQD---------RNASVRTLANTMLYRYISKKRICDDELGSFTC------QFGVEITDVEISDVKIVKEGENMGMSALSSVAKSDAGQQL 285          
BLAST of Stomatin-like protein 1 vs. Ensembl Celegans
Match: sto-4 (Stomatin-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22165])

HSP 1 Score: 63.1586 bits (152), Expect = 6.538e-11
Identity = 39/106 (36.79%), Postives = 59/106 (55.66%), Query Frame = 1
Query:  217 ITIILGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            I  I+ +L+VLF  P+  +F LKV++   +  +FR G+L       PGI F+IP I+S K ID  +    V      +KD   V +D VI +RI++ T  +INV +
Sbjct:   29 IITIISYLVVLFTLPLSAFFCLKVVQEYERAVIFRLGRLKHGGARGPGIFFIIPCIESFKKIDLRVVSFDVPPQEILSKDSVTVSVDAVIYFRISNATVSVINVED 134          
BLAST of Stomatin-like protein 1 vs. Ensembl Celegans
Match: sto-4 (Stomatin-4 [Source:UniProtKB/Swiss-Prot;Acc:Q22165])

HSP 1 Score: 63.1586 bits (152), Expect = 6.538e-11
Identity = 39/106 (36.79%), Postives = 59/106 (55.66%), Query Frame = 1
Query:  217 ITIILGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            I  I+ +L+VLF  P+  +F LKV++   +  +FR G+L       PGI F+IP I+S K ID  +    V      +KD   V +D VI +RI++ T  +INV +
Sbjct:   29 IITIISYLVVLFTLPLSAFFCLKVVQEYERAVIFRLGRLKHGGARGPGIFFIIPCIESFKKIDLRVVSFDVPPQEILSKDSVTVSVDAVIYFRISNATVSVINVED 134          
BLAST of Stomatin-like protein 1 vs. Ensembl Celegans
Match: mec-2 (Mechanosensory protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q27433])

HSP 1 Score: 62.7734 bits (151), Expect = 1.890e-10
Identity = 41/167 (24.55%), Postives = 81/167 (48.50%), Query Frame = 1
Query:  217 ITIILGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            I  IL +L++ F  P+     +KV++   +  +FR G+L+      PGI F++P ID+ + +D  +    V      +KD   V +D V+ +RI++ T  + NV +         + +L  ++      +    R A  +  Q+ T+L+   E  G+++ +V V ++
Sbjct:  120 ILTILSYLLIFFTLPISACMCIKVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREA--ISHQMQTTLDEATEPWGVKVERVEVKDV 284          
BLAST of Stomatin-like protein 1 vs. Ensembl Celegans
Match: mec-2 (Mechanosensory protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q27433])

HSP 1 Score: 62.003 bits (149), Expect = 2.372e-10
Identity = 41/167 (24.55%), Postives = 81/167 (48.50%), Query Frame = 1
Query:  217 ITIILGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            I  IL +L++ F  P+     +KV++   +  +FR G+L+      PGI F++P ID+ + +D  +    V      +KD   V +D V+ +RI++ T  + NV +         + +L  ++      +    R A  +  Q+ T+L+   E  G+++ +V V ++
Sbjct:   61 ILTILSYLLIFFTLPISACMCIKVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREA--ISHQMQTTLDEATEPWGVKVERVEVKDV 225          
BLAST of Stomatin-like protein 1 vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0344807)

HSP 1 Score: 60.4622 bits (145), Expect = 1.180e-9
Identity = 43/161 (26.71%), Postives = 77/161 (47.83%), Query Frame = 1
Query:  238 LMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSR--IAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            +M L F +F  F  KV++   +  +FR G+L++     PGI F++P IDS   +D   +   V      TKD   V +D V+ YR+++ T  I NV N         + +L   M     ++    R  I+G ++ Q    L+   +  G+++ +V + ++
Sbjct:   87 IMTLPFSLFVCF--KVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQ----LDEATDAWGIKVERVEIKDV 241          
BLAST of Stomatin-like protein 1 vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0333583)

HSP 1 Score: 60.077 bits (144), Expect = 1.525e-9
Identity = 43/161 (26.71%), Postives = 77/161 (47.83%), Query Frame = 1
Query:  238 LMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSR--IAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            +M L F +F  F  KV++   +  +FR G+L++     PGI F++P IDS   +D   +   V      TKD   V +D V+ YR+++ T  I NV N         + +L   M     ++    R  I+G ++ Q    L+   +  G+++ +V + ++
Sbjct:   75 IMTLPFSLFVCF--KVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQ----LDEATDAWGIKVERVEIKDV 229          
BLAST of Stomatin-like protein 1 vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0333584)

HSP 1 Score: 60.077 bits (144), Expect = 1.544e-9
Identity = 43/161 (26.71%), Postives = 77/161 (47.83%), Query Frame = 1
Query:  238 LMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSR--IAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            +M L F +F  F  KV++   +  +FR G+L++     PGI F++P IDS   +D   +   V      TKD   V +D V+ YR+++ T  I NV N         + +L   M     ++    R  I+G ++ Q    L+   +  G+++ +V + ++
Sbjct:   91 IMTLPFSLFVCF--KVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQ----LDEATDAWGIKVERVEIKDV 245          
BLAST of Stomatin-like protein 1 vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0301096)

HSP 1 Score: 60.077 bits (144), Expect = 1.563e-9
Identity = 43/161 (26.71%), Postives = 77/161 (47.83%), Query Frame = 1
Query:  238 LMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSR--IAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            +M L F +F  F  KV++   +  +FR G+L++     PGI F++P IDS   +D   +   V      TKD   V +D V+ YR+++ T  I NV N         + +L   M     ++    R  I+G ++ Q    L+   +  G+++ +V + ++
Sbjct:   80 IMTLPFSLFVCF--KVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQ----LDEATDAWGIKVERVEIKDV 234          
BLAST of Stomatin-like protein 1 vs. Ensembl Fly
Match: CG42540 (gene:FBgn0260657 transcript:FBtr0301097)

HSP 1 Score: 59.6918 bits (143), Expect = 1.845e-9
Identity = 43/161 (26.71%), Postives = 77/161 (47.83%), Query Frame = 1
Query:  238 LMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSR--IAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            +M L F +F  F  KV++   +  +FR G+L++     PGI F++P IDS   +D   +   V      TKD   V +D V+ YR+++ T  I NV N         + +L   M     ++    R  I+G ++ Q    L+   +  G+++ +V + ++
Sbjct:   79 IMTLPFSLFVCF--KVVQEYERAVIFRLGRLMQGGAKGPGIFFILPCIDSYARVDLRTRTYDVPPQEVLTKDSVTVSVDAVVYYRVSNATVSIANVENAHHSTRLLAQTTLRNTMGTRHLHEILSERMTISGTMQVQ----LDEATDAWGIKVERVEIKDV 233          
BLAST of Stomatin-like protein 1 vs. Ensembl Zebrafish
Match: stoml1 (stomatin (EPB72)-like 1 [Source:ZFIN;Acc:ZDB-GENE-070209-241])

HSP 1 Score: 70.8626 bits (172), Expect = 6.912e-13
Identity = 34/105 (32.38%), Postives = 57/105 (54.29%), Query Frame = 1
Query:  223 IILGFLMVLF----FPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            +I+ FL+ LF    FP+ GWF LKV+    ++ VFR G++     PG+  ++P ID  + +D   +   +      TKD GLV +   I++RI  P   ++ V++
Sbjct:   72 LIVTFLVFLFTFVTFPISGWFVLKVVPNYERVVVFRLGRIRPPKGPGVVLILPFIDQWQRVDLRTRAFNIPPCKVCTKDGGLVSVGADIQFRIWSPVMSVVAVQD 176          
BLAST of Stomatin-like protein 1 vs. Ensembl Zebrafish
Match: stoml1 (stomatin (EPB72)-like 1 [Source:ZFIN;Acc:ZDB-GENE-070209-241])

HSP 1 Score: 70.8626 bits (172), Expect = 6.912e-13
Identity = 34/105 (32.38%), Postives = 57/105 (54.29%), Query Frame = 1
Query:  223 IILGFLMVLF----FPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            +I+ FL+ LF    FP+ GWF LKV+    ++ VFR G++     PG+  ++P ID  + +D   +   +      TKD GLV +   I++RI  P   ++ V++
Sbjct:   72 LIVTFLVFLFTFVTFPISGWFVLKVVPNYERVVVFRLGRIRPPKGPGVVLILPFIDQWQRVDLRTRAFNIPPCKVCTKDGGLVSVGADIQFRIWSPVMSVVAVQD 176          
BLAST of Stomatin-like protein 1 vs. Ensembl Zebrafish
Match: zgc:112408 (zgc:112408 [Source:ZFIN;Acc:ZDB-GENE-050417-63])

HSP 1 Score: 62.003 bits (149), Expect = 3.043e-10
Identity = 46/181 (25.41%), Postives = 90/181 (49.72%), Query Frame = 1
Query:  238 LMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLKIV-DPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVR--NWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFT-SLNTKVEEKGLEILKVLVDNITQK---KEPESSLDVLKKI 756
            L++ F FPV  WF +KV++   +  +FR G+LL     PG+ ++IP +D+ + +D       +      TKD   + +D V+ YRI +PT  I  V   N+   ++ +T +  +   K+      +   ++  +E+ +++ S N  ++ + +E+  V +    Q+    E E+S D   K+
Sbjct:   50 LLIFFTFPVSVWFCMKVVQEYERAVIFRLGRLLGGAKGPGLFWIIPCMDTFRKVDLRTVSFDIPAQEVLTKDSVTIMVDAVVYYRIFNPTVSITKVENANYATQMLAQTTLRNMLGTKSLADILKDREEMSEQMEAVLYSASKNWGIKVERVELKDVKLPTTLQRAMAAEAEASRDARAKV 230          
BLAST of Stomatin-like protein 1 vs. Ensembl Zebrafish
Match: zgc:112408 (zgc:112408 [Source:ZFIN;Acc:ZDB-GENE-050417-63])

HSP 1 Score: 62.003 bits (149), Expect = 3.218e-10
Identity = 46/181 (25.41%), Postives = 90/181 (49.72%), Query Frame = 1
Query:  238 LMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLKIV-DPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVR--NWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFT-SLNTKVEEKGLEILKVLVDNITQK---KEPESSLDVLKKI 756
            L++ F FPV  WF +KV++   +  +FR G+LL     PG+ ++IP +D+ + +D       +      TKD   + +D V+ YRI +PT  I  V   N+   ++ +T +  +   K+      +   ++  +E+ +++ S N  ++ + +E+  V +    Q+    E E+S D   K+
Sbjct:   63 LLIFFTFPVSVWFCMKVVQEYERAVIFRLGRLLGGAKGPGLFWIIPCMDTFRKVDLRTVSFDIPAQEVLTKDSVTIMVDAVVYYRIFNPTVSITKVENANYATQMLAQTTLRNMLGTKSLADILKDREEMSEQMEAVLYSASKNWGIKVERVELKDVKLPTTLQRAMAAEAEASRDARAKV 243          
BLAST of Stomatin-like protein 1 vs. Ensembl Zebrafish
Match: stoml3b (stomatin (EPB72)-like 3b [Source:ZFIN;Acc:ZDB-GENE-050417-366])

HSP 1 Score: 61.6178 bits (148), Expect = 3.419e-10
Identity = 41/168 (24.40%), Postives = 82/168 (48.81%), Query Frame = 1
Query:  217 ITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLL--KIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN--WTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            + II  F  +L FP+  + S+K+++   +  +FR G++   K   PGI F+IP  DS   +D       +      TKD   V +D V+ +R+ DP   + NV N  ++  ++ +T +  +   KN      +   I+  ++    T+L+   +  G+++ +V + ++
Sbjct:   32 LVIISAFFSILVFPISIFISIKIVKEYERAVIFRLGRITARKAKGPGIFFIIPCTDSFIKVDLRTVSFDIPPQEILTKDSVTVSVDGVVYFRVNDPVASVANVSNADYSTRLLAQTTLRNVLGTKNLAEVLSDREGISHSMQ----TTLDEATDSWGIKVERVEIKDV 195          
BLAST of Stomatin-like protein 1 vs. Ensembl Xenopus
Match: dbt (dihydrolipoamide branched chain transacylase E2 [Source:Xenbase;Acc:XB-GENE-965456])

HSP 1 Score: 60.8474 bits (146), Expect = 1.669e-9
Identity = 46/175 (26.29%), Postives = 88/175 (50.29%), Query Frame = 1
Query:  235 FLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLL---FVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGL--EILKVLVDNITQKKEPESSLDV 744
              +++ FP+  W  LK++    ++ +FR G++     PG+  + PLID  + +D   K   V  +   ++D  LV +   I++ I DP   +++V++   F+   T  +L+      K  R    + +RIA  L+      LN +V+  GL  E +++ +++I Q   PE++L V
Sbjct:   46 LFLIVTFPLSAWCFLKMVPDYQRIVIFRLGRVQAARGPGLVLLFPLIDQFQRVDMRTKAFSVPPSKVKSRDGVLVSMGADIQFCICDPVLSVLSVQD-LNFVTRNTAQNLMTQSLGRKYLREIQNDRARIAEHLKE----DLNEQVKPWGLCVERVELALESILQT--PENALIV 213          
BLAST of Stomatin-like protein 1 vs. Ensembl Xenopus
Match: myo10.2 (myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995373])

HSP 1 Score: 60.077 bits (144), Expect = 2.203e-9
Identity = 38/162 (23.46%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  235 FLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEF--IITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            F  +L FP+  W  +K+++   +  +FR G++L+     PG+ FV+P  DS   +D       +      TKD   V +D V+ YR+ + T  + N+ N      ++ +T +  +   KN      +   IA +++S    +L+   ++ G+++ +V + ++
Sbjct:   61 FFTLLTFPISVWMCIKIVKEYERAIIFRLGRILRGGAKGPGLFFVLPCTDSFINVDMRTISFDIPPQEILTKDSVTVSVDGVVYYRVNNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQS----TLDVATDDWGIKVERVEIKDV 218          
BLAST of Stomatin-like protein 1 vs. Ensembl Xenopus
Match: myo10.2 (myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995373])

HSP 1 Score: 59.3066 bits (142), Expect = 2.373e-9
Identity = 38/162 (23.46%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  235 FLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNW--TEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            F  +L FP+  W  +K+++   +  +FR G++L+     PG+ FV+P  DS   +D       +      TKD   V +D V+ YR+ + T  + N+ N      ++ +T +  +   KN      +   IA +++S    +L+   ++ G+++ +V + ++
Sbjct:   22 FFTLLTFPISVWMCIKIVKEYERAIIFRLGRILRGGAKGPGLFFVLPCTDSFINVDMRTISFDIPPQEILTKDSVTVSVDGVVYYRVNNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQS----TLDVATDDWGIKVERVEIKDV 179          
BLAST of Stomatin-like protein 1 vs. Ensembl Xenopus
Match: myo10.2 (myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995373])

HSP 1 Score: 59.3066 bits (142), Expect = 2.726e-9
Identity = 38/162 (23.46%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  235 FLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNW--TEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            F  +L FP+  W  +K+++   +  +FR G++L+     PG+ FV+P  DS   +D       +      TKD   V +D V+ YR+ + T  + N+ N      ++ +T +  +   KN      +   IA +++S    +L+   ++ G+++ +V + ++
Sbjct:   29 FFTLLTFPISVWMCIKIVKEYERAIIFRLGRILRGGAKGPGLFFVLPCTDSFINVDMRTISFDIPPQEILTKDSVTVSVDGVVYYRVNNATLAVANITNADSATRLLAQTTLRNVLGTKNLSQILSDREEIAHNMQS----TLDVATDDWGIKVERVEIKDV 186          
BLAST of Stomatin-like protein 1 vs. Ensembl Xenopus
Match: atp8b3 (ATPase, aminophospholipid transporter, class I, type 8B, member 3 [Source:Xenbase;Acc:XB-GENE-992174])

HSP 1 Score: 55.4546 bits (132), Expect = 4.942e-8
Identity = 31/105 (29.52%), Postives = 51/105 (48.57%), Query Frame = 1
Query:  217 ITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLL--KIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            I I+  F+  + FP+  WF +K+I+   +  VFR G+++  K   PG+ FV+P  D+   +D  +    +      TKD     +D V+ Y I      + NV N
Sbjct:   34 ILILSAFMAAITFPLSIWFCVKIIQEYERAVVFRLGRIISGKAKGPGVMFVLPCTDTFIKVDLRVISFAIPPQEILTKDSVTTTVDGVVYYNIQSAIKAVANVNN 138          
BLAST of Stomatin-like protein 1 vs. Ensembl Mouse
Match: Stoml1 (stomatin-like 1 [Source:MGI Symbol;Acc:MGI:1916356])

HSP 1 Score: 67.0106 bits (162), Expect = 1.395e-11
Identity = 44/187 (23.53%), Postives = 86/187 (45.99%), Query Frame = 1
Query:  253 FPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVR--NWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNITQKKEPESSLDV------LKKINFKDLGRQLTS 789
            FP+ GWF+LK++    ++ VFR G++     PG+  ++P IDS + +D   +   V      +KD  ++ +   +++RI DP   ++ V+  N    +     ++   + +  +       +I GD   Q+   +N      GLE+ +V +      + P+ SL V      L+++    LG  + S
Sbjct:   71 FPISGWFALKIVPTYERMIVFRLGRIRNPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMAVKDLNTATRMTAHNAMTKALLRRPLQEIQMEKLKI-GD---QLLLEINDVTRAWGLEVDRVELAVEAVLQPPQDSLTVPSLDSTLQQLALHLLGGSMNS 253          
BLAST of Stomatin-like protein 1 vs. Ensembl Mouse
Match: Stom (stomatin [Source:MGI Symbol;Acc:MGI:95403])

HSP 1 Score: 58.151 bits (139), Expect = 5.111e-9
Identity = 35/162 (21.60%), Postives = 79/162 (48.77%), Query Frame = 1
Query:  235 FLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNW--TEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            F +++ FP+  W  +K+++   ++ +FR G++L+     PG+ F++P  DS   +D       +      TKD   + +D V+ YR+ + T  + N+ N      ++ +T +      KN      +   IA  ++S    +L+   ++ G+++ +V + ++
Sbjct:   40 FFVIITFPISIWICIKIVKEYERVIIFRLGRILQGGAKGPGLFFILPCTDSLIKVDMRTISFDIPPQEVLTKDSVTISVDGVVYYRVQNATLAVANITNADSATRLLAQTTLRNALGTKNLSQILSDREEIAHHMQS----TLDDATDDWGIKVERVEIKDV 197          
BLAST of Stomatin-like protein 1 vs. Ensembl Mouse
Match: Nphs2 (nephrosis 2, podocin [Source:MGI Symbol;Acc:MGI:2157018])

HSP 1 Score: 55.8398 bits (133), Expect = 2.999e-8
Identity = 34/128 (26.56%), Postives = 65/128 (50.78%), Query Frame = 1
Query:  205 NYCPITIILGFLM--VLFFPVFGWFSLKVIRRNNKLAVFRYGKLL--KIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFM---IINVRNWTEFIITETRVSLL 567
              C   ++L  L+  ++ FP   WF +KV++   ++ +FR G LL  +   PG+ F +P +D+   +D  ++   +      TKD  ++EID V  YR+ + + +   + +V    +F++  T   LL
Sbjct:   26 GACEWLLVLASLIFIIMTFPFSIWFCIKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVVTKDMFIMEIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLL 153          
BLAST of Stomatin-like protein 1 vs. Ensembl Mouse
Match: Nphs2 (nephrosis 2, podocin [Source:MGI Symbol;Acc:MGI:2157018])

HSP 1 Score: 53.9138 bits (128), Expect = 2.167e-7
Identity = 34/128 (26.56%), Postives = 65/128 (50.78%), Query Frame = 1
Query:  205 NYCPITIILGFLM--VLFFPVFGWFSLKVIRRNNKLAVFRYGKLL--KIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFM---IINVRNWTEFIITETRVSLL 567
              C   ++L  L+  ++ FP   WF +KV++   ++ +FR G LL  +   PG+ F +P +D+   +D  ++   +      TKD  ++EID V  YR+ + + +   + +V    +F++  T   LL
Sbjct:  101 GACEWLLVLASLIFIIMTFPFSIWFCIKVVQEYERVIIFRLGHLLPGRAKGPGLFFFLPCLDTYHKVDLRLQTLEIPFHEVVTKDMFIMEIDAVCYYRMENASLLLSSLAHVSKAIQFLVQTTMKRLL 228          
BLAST of Stomatin-like protein 1 vs. Ensembl Mouse
Match: Stoml3 (stomatin (Epb7.2)-like 3 [Source:MGI Symbol;Acc:MGI:2388072])

HSP 1 Score: 48.1358 bits (113), Expect = 9.782e-6
Identity = 29/104 (27.88%), Postives = 49/104 (47.12%), Query Frame = 1
Query:  253 FPVFGWFSLKVIRRNNKLAVFRYGKLL--KIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTE--FIITET 552
            FP+  W  LK+I+   +  VFR G++   K   PG+  V+P ID    +D       +      T+D    ++D V+ YRI      + NV +  +  F++ +T
Sbjct:   39 FPISVWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPCIDVFVKVDLRTVTCNIPPQEILTRDSVTTQVDGVVYYRIYSAVSAVANVNDVHQATFLLAQT 142          
BLAST of Stomatin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q9UBI4|STML1_HUMAN (Stomatin-like protein 1 OS=Homo sapiens OX=9606 GN=STOML1 PE=1 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 5.327e-13
Identity = 49/198 (24.75%), Postives = 95/198 (47.98%), Query Frame = 1
Query:  229 LGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVR--NWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKV--LVDNITQKKEPESS---LD-VLKKINFKDLGRQLTSMT 795
            LGFL++L  FP+ GWF+LK++    ++ VFR G++     PG+  ++P IDS + +D   +   V      +KD  ++ +   +++RI DP   ++ V+  N    +  +  ++   + +  R       +I+     Q+   +N      GLE+ +V   V+ + Q  +   +   LD  L+++    LG  + SM 
Sbjct:   62 LGFLLLLVTFPISGWFALKIVPTYERMIVFRLGRIRTPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMTVKDLNTATRMTAQNAMTKALLKRPLREIQMEKLKIS----DQLLLEINDVTRAWGLEVDRVELAVEAVLQPPQDSPAGPNLDSTLQQLALHFLGGSMNSMA 255          
BLAST of Stomatin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q8CI66|STML1_MOUSE (Stomatin-like protein 1 OS=Mus musculus OX=10090 GN=Stoml1 PE=2 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.077e-10
Identity = 44/187 (23.53%), Postives = 86/187 (45.99%), Query Frame = 1
Query:  253 FPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVR--NWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNITQKKEPESSLDV------LKKINFKDLGRQLTS 789
            FP+ GWF+LK++    ++ VFR G++     PG+  ++P IDS + +D   +   V      +KD  ++ +   +++RI DP   ++ V+  N    +     ++   + +  +       +I GD   Q+   +N      GLE+ +V +      + P+ SL V      L+++    LG  + S
Sbjct:   71 FPISGWFALKIVPTYERMIVFRLGRIRNPQGPGMVLLLPFIDSFQRVDLRTRAFNVPPCKLASKDGAVLSVGADVQFRIWDPVLSVMAVKDLNTATRMTAHNAMTKALLRRPLQEIQMEKLKI-GD---QLLLEINDVTRAWGLEVDRVELAVEAVLQPPQDSLTVPSLDSTLQQLALHLLGGSMNS 253          
BLAST of Stomatin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q22165|STO4_CAEEL (Stomatin-4 OS=Caenorhabditis elegans OX=6239 GN=sto-4 PE=3 SV=2)

HSP 1 Score: 63.1586 bits (152), Expect = 8.317e-10
Identity = 39/106 (36.79%), Postives = 59/106 (55.66%), Query Frame = 1
Query:  217 ITIILGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            I  I+ +L+VLF  P+  +F LKV++   +  +FR G+L       PGI F+IP I+S K ID  +    V      +KD   V +D VI +RI++ T  +INV +
Sbjct:   29 IITIISYLVVLFTLPLSAFFCLKVVQEYERAVIFRLGRLKHGGARGPGIFFIIPCIESFKKIDLRVVSFDVPPQEILSKDSVTVSVDAVIYFRISNATVSVINVED 134          
BLAST of Stomatin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q27433|MEC2_CAEEL (Mechanosensory protein 2 OS=Caenorhabditis elegans OX=6239 GN=mec-2 PE=1 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 3.024e-9
Identity = 41/167 (24.55%), Postives = 81/167 (48.50%), Query Frame = 1
Query:  217 ITIILGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            I  IL +L++ F  P+     +KV++   +  +FR G+L+      PGI F++P ID+ + +D  +    V      +KD   V +D V+ +RI++ T  + NV +         + +L  ++      +    R A  +  Q+ T+L+   E  G+++ +V V ++
Sbjct:  120 ILTILSYLLIFFTLPISACMCIKVVQEYERAVIFRLGRLMPGGAKGPGIFFIVPCIDTYRKVDLRVLSFEVPPQEILSKDSVTVAVDAVVYFRISNATISVTNVEDAARSTKLLAQTTLRNILGTKTLAEMLSDREA--ISHQMQTTLDEATEPWGVKVERVEVKDV 284          
BLAST of Stomatin-like protein 1 vs. UniProt/SwissProt
Match: sp|Q19200|STO1_CAEEL (Stomatin-1 OS=Caenorhabditis elegans OX=6239 GN=sto-1 PE=3 SV=2)

HSP 1 Score: 60.8474 bits (146), Expect = 5.951e-9
Identity = 45/184 (24.46%), Postives = 88/184 (47.83%), Query Frame = 1
Query:  238 LMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLKIV-DPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEF--IITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI--------TQKKEPESSLDVLKKI 756
            L+ L FPV  +  +K+++   +  VFR G+L+  V  PGI F+IP ID+   ID  +    V +    ++D   V +D V+ +++ DP   ++ V N T+   ++ +T +  +           +  +I+ D++     SL+   E  G+++ +V + ++            E E++ D   KI
Sbjct:   51 LIFLTFPVSVFMCIKIVQEYQRAVVFRLGRLVPDVKGPGIFFIIPCIDTFLNIDLRVASYNVPSQEILSRDSVTVSVDAVVYFKVFDPITSVVGVGNATDSTKLLAQTTLRTILGTHTLSEILSDREKISADMK----ISLDEATEPWGIKVERVELRDVRLPSQMQRAMAAEAEATRDAGAKI 230          
BLAST of Stomatin-like protein 1 vs. TrEMBL
Match: A0A158QEG6 (PHB domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS7385 PE=4 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 1.046e-22
Identity = 58/202 (28.71%), Postives = 103/202 (50.99%), Query Frame = 1
Query:  205 NYCPITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIIN-VRNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNITQKKEPESSLDVLKKINFKDLGRQLTSMTPLFM 807
             Y  + ++    ++L FP+   F +K + ++ KL +FR GK+LK   PG   ++P +D C  +D   +   VK  +  T D G VE+ C + + I +P   +    RN  +FI  +   +L+  +   +W D      + D+ S + +SLN      G++IL+V +      K+P    D +  I+F+ LG+Q+ S++PL M
Sbjct:  148 TYIFLVLLSALFLILTFPISTLFCIKRLPKSKKLIIFRLGKVLKPRGPGCILILPFVDECHIVDLAEQSLAVKPLTATTSDTGEVEVGCQVVFHIVEPEAAVTYWSRNPHDFISKKAETALVAAVARIQWDDIISGHGSPDIASDVRSSLNAYCSPIGIQILEVKLTAAKCIKDPPKLSDQVHSIDFQKLGKQIASLSPLLM 349          
BLAST of Stomatin-like protein 1 vs. TrEMBL
Match: A0A564YY34 (PHB domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS10731 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.356e-22
Identity = 58/202 (28.71%), Postives = 103/202 (50.99%), Query Frame = 1
Query:  205 NYCPITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIIN-VRNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNITQKKEPESSLDVLKKINFKDLGRQLTSMTPLFM 807
             Y  + ++    ++L FP+   F +K + ++ KL +FR GK+LK   PG   ++P +D C  +D   +   VK  +  T D G VE+ C + + I +P   +    RN  +FI  +   +L+  +   +W D      + D+ S + +SLN      G++IL+V +      K+P    D +  I+F+ LG+Q+ S++PL M
Sbjct:  148 TYIFLVLLSALFLILTFPISTLFCIKRLPKSKKLIIFRLGKVLKPRGPGCILILPFVDECHIVDLAEQSLAVKPLTATTSDTGEVEVGCQVVFHIVEPEAAVTYWSRNPHDFISKKAETALVAAVARIQWDDIISGHGSPDIASDVRSSLNAYCSPIGIQILEVKLTAAKCIKDPPKLSDQVHSIDFQKLGKQIASLSPLLM 349          
BLAST of Stomatin-like protein 1 vs. TrEMBL
Match: A0A0R3WM23 (PHB domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1798 PE=4 SV=1)

HSP 1 Score: 107.457 bits (267), Expect = 2.189e-21
Identity = 53/201 (26.37%), Postives = 100/201 (49.75%), Query Frame = 1
Query:  208 YCPITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIIN-VRNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNITQKKEPESSLDVLKKINFKDLGRQLTSMTPLFM 807
            Y  +  +  FL +  FPV   F +K + +  ++ VFR G+ LK   PG   ++P +D    +D   +   VK  S  T D G VE+ C + Y I +    + + +R+   F++ + + +L    +   W+D        D+   +  S+N+     G++IL+V +  +   +EP  + D +  I+F+ LG+Q+ S++PL +
Sbjct:  148 YLLLVSLSAFLFLFAFPVTAIFCIKRLSKTKRVVVFRLGRRLKPRGPGYVLILPFVDEYHVVDLAEQALEVKPMSASTADGGEVELGCCLVYHIIEVELAVTHWIRDPRHFVLEKAQSALPAATRRMDWHDIISGHALSDIACDVRASVNSCCSSYGIQILEVKLSEVVSVREPSITSDKVHNIDFQKLGKQIASLSPLLL 348          
BLAST of Stomatin-like protein 1 vs. TrEMBL
Match: A0A0X3PHB1 (PHB domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR161726 PE=4 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 1.266e-18
Identity = 53/185 (28.65%), Postives = 93/185 (50.27%), Query Frame = 1
Query:  256 PVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINV-RNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNITQKKEPESSLDVLKKINFKDLGRQLTSMTPLFM 807
            P+  W  +K + R  ++ +FR G+  K+  PG   ++P +D    ID   +   VK  S  T D  +VE+ C + +RI DP   I  + +   E +I +T+ SLL  +   +W D     +  D+   + ++LNT     G++I  V +  +   KEP      LK++N   LG+Q+ +++PL +
Sbjct:  227 PILAWIFIKRLSRYERIIIFRLGRRRKLKGPGFVVLLPFVDQYHLIDLDDQHVDVKPVSGGTVDEAIVEVGCRVFFRIIDPEAAISRMAKRPDEVLIRKTQSSLLSALSRVKWADLTSGHVTTDVACAVRSALNTYCGSLGIQISVVNLGEVATTKEPPPVTTALKRLNLSTLGQQIANLSPLLL 411          
BLAST of Stomatin-like protein 1 vs. TrEMBL
Match: A0A0R3WFE0 (PHB domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS9584 PE=4 SV=1)

HSP 1 Score: 97.4413 bits (241), Expect = 4.436e-18
Identity = 50/186 (26.88%), Postives = 90/186 (48.39%), Query Frame = 1
Query:  253 FPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIIN-VRNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNITQKKEPESSLDVLKKINFKDLGRQLTSMTPLFM 807
            FP+   F +K + +  ++ +FR G+ LK   PG   V+P +D C  ID   +   +K  S  T D G VE+ C+I Y I +    +    R+    ++ + + +L   +    W D        D+   I  S+N+     G++IL+V +      +EP  + D +  I+F  +G+Q+ S++PL +
Sbjct:  153 FPITALFCIKRLSKTKRVVIFRLGRQLKPRGPGYVLVLPFVDECHVIDLDEQTLEIKPISALTADGGQVEMGCLIVYHIIEVELAVTYWARDPRNLVLQKAQPALSSAICRMNWCDIVSGHALSDIACDIRASVNSCCSSYGIQILEVKLSEAMSLQEPSVTPDQVHSIDFHKIGKQIASLSPLLI 338          
BLAST of Stomatin-like protein 1 vs. Ensembl Cavefish
Match: stoml1 (stomatin like 1 [Source:NCBI gene;Acc:103047797])

HSP 1 Score: 70.8626 bits (172), Expect = 6.825e-13
Identity = 34/104 (32.69%), Postives = 56/104 (53.85%), Query Frame = 1
Query:  217 ITIILGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            I I L F+  L  FP+  WF+LK +    ++ +FR G++     PG+  V+PLID  + +D   +   +      TKD GLV I   I++RI +P   ++ V++
Sbjct:   68 IVIFLVFVCTLITFPISAWFALKTVPNYQRIVIFRLGRIRPPKGPGVVLVLPLIDQWQRVDLRTRAFNIPPCKVTTKDGGLVSIGADIQFRIWNPVMSVVAVQD 171          
BLAST of Stomatin-like protein 1 vs. Ensembl Cavefish
Match: nphs2 (NPHS2 stomatin family member, podocin [Source:ZFIN;Acc:ZDB-GENE-051102-2])

HSP 1 Score: 64.3142 bits (155), Expect = 7.490e-11
Identity = 40/147 (27.21%), Postives = 75/147 (51.02%), Query Frame = 1
Query:  217 ITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLL--KIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDF--NDSRIAGDLESQIFT 645
            +T+ +   ++LFFP+  WF +K++R + +  VFR G LL  K   PG+ F +P +D C+ +D  +K  +V +    T+D    E+  V  YRI + T     +      +    +VS+  V+ +  +     N S +A +++ Q+ +
Sbjct:  110 LTVAVLATVILFFPLSIWFCVKIVREHERAVVFRLGHLLQRKPRGPGLLFYLPFLDVCQKVDIRLKMLKVPSHVV-TQDLVCTEVSAVCYYRIENLTVCCSTLDGVPAVLQALVQVSVREVLAHHTFTHILQNRSTVAQEIQVQVLS 255          
BLAST of Stomatin-like protein 1 vs. Ensembl Cavefish
Match: zgc:112408 (erythrocyte band 7 integral membrane protein-like [Source:NCBI gene;Acc:103025999])

HSP 1 Score: 58.5362 bits (140), Expect = 2.500e-9
Identity = 32/110 (29.09%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  205 NYCPITII-LGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLKIV-DPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
             +C I +  L FL++L  FP+  W  +K+++   +  +FR G+LL     PGI +++P +D+ + +D       +      TKD   + +D V+ YR+ +PT  I  V +
Sbjct:   22 GFCGILLTALSFLLILATFPISVWSCMKIVKEYERAVIFRLGRLLGGAKGPGIFWILPCVDTFRKVDLRTVSFNIPPQEVLTKDSVTIMVDGVVYYRVFNPTVSITKVED 131          
BLAST of Stomatin-like protein 1 vs. Ensembl Cavefish
Match: zgc:112408 (erythrocyte band 7 integral membrane protein-like [Source:NCBI gene;Acc:103025999])

HSP 1 Score: 58.9214 bits (141), Expect = 2.534e-9
Identity = 32/110 (29.09%), Postives = 58/110 (52.73%), Query Frame = 1
Query:  205 NYCPITII-LGFLMVLF-FPVFGWFSLKVIRRNNKLAVFRYGKLLKIV-DPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
             +C I +  L FL++L  FP+  W  +K+++   +  +FR G+LL     PGI +++P +D+ + +D       +      TKD   + +D V+ YR+ +PT  I  V +
Sbjct:   33 GFCGILLTALSFLLILATFPISVWSCMKIVKEYERAVIFRLGRLLGGAKGPGIFWILPCVDTFRKVDLRTVSFNIPPQEVLTKDSVTIMVDGVVYYRVFNPTVSITKVED 142          
BLAST of Stomatin-like protein 1 vs. Ensembl Cavefish
Match: stoml3b (stomatin (EPB72)-like 3b [Source:ZFIN;Acc:ZDB-GENE-050417-366])

HSP 1 Score: 56.9954 bits (136), Expect = 1.403e-8
Identity = 38/159 (23.90%), Postives = 78/159 (49.06%), Query Frame = 1
Query:  244 VLFFPVFGWFSLKVIRRNNKLAVFRYGKLL--KIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN--WTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            VL FPV  +  +K+++   +  +FR G++   K   PGI F++P  DS   +D       +      TKD   V +D V+ +R++DP   + NV N  ++  ++ +T +  +   KN      +   I+  ++S    +L+   +  G+++ +V + ++
Sbjct:  104 VLLFPVMIFVCIKIVQEYERAVIFRLGRITARKAKGPGIFFILPCTDSFIKVDMRTISFDIPPQEILTKDSVTVSVDGVVYFRVSDPIASVANVTNADYSTRLLAQTTLRNVLGTKNLAEVLSDREGISHSMQS----TLDEATDSWGIKVERVEIKDV 258          
BLAST of Stomatin-like protein 1 vs. Ensembl Sea Lamprey
Match: stoml1 (stomatin (EPB72)-like 1 [Source:ZFIN;Acc:ZDB-GENE-070209-241])

HSP 1 Score: 72.4034 bits (176), Expect = 3.433e-14
Identity = 43/154 (27.92%), Postives = 77/154 (50.00%), Query Frame = 1
Query:  241 MVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVR--NWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEK-GLEILKV 693
            MVL FP+  WF LK++ ++ ++ VFR G+L   + PG+A V+P ID  + +DT  +   V      T+D  LV +   ++ R+  P  ++   +  N +      T ++ L    +        +++A +L  ++     TKV E  GLE+ +V
Sbjct:   62 MVLTFPLSVWFCLKIVPQHERIVVFRLGRLRAPLGPGVALVLPCIDRWRRVDTRPRAFNVPPCRAMTRDGALVSVGADVRVRVHCPVLLLTAAQDVNRSSRSAAHTALASLLPRHSLHELQSESAKMADELALEV-----TKVTEPWGLEVERV 210          
BLAST of Stomatin-like protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006522.1 (pep scaffold:Pmarinus_7.0:GL477331:35910:45947:-1 gene:ENSPMAG00000005879.1 transcript:ENSPMAT00000006522.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.4698 bits (158), Expect = 3.041e-12
Identity = 52/171 (30.41%), Postives = 83/171 (48.54%), Query Frame = 1
Query:  226 ILGFL----MVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINV--RNWTEFIITETRVSLLFVMKNFRWYDFNDSR--IAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            +LG L    +VL FP+  WF LKV+R   +  VFR GKLL    + PG+  V+P ID+   +D       V      T+D   V +D V+ YR+ D T  + NV   +    ++ +T  +L  V+      D    R  IA  ++    TSL+   E  G+++ +V + ++
Sbjct:   24 LLGILSMVVVVLTFPLSVWFCLKVVREYERAVVFRLGKLLPGGAIGPGLFLVLPCIDTFVKVDMRTVTFDVPPQEILTRDSVTVAVDAVVYYRVHDATAAVTNVVFADGATRLLAQT--ALRNVLGTRSLSDIVSEREVIARSMQ----TSLDEATEPWGIKVQRVEIKDV 188          
BLAST of Stomatin-like protein 1 vs. Ensembl Nematostella
Match: EDO32231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVP0])

HSP 1 Score: 65.4698 bits (158), Expect = 1.045e-11
Identity = 44/181 (24.31%), Postives = 84/181 (46.41%), Query Frame = 1
Query:  217 ITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFI--ITETRVSLLFVMKNFRWYDFNDSRIAGD---LESQIFTSLNTKVEEKGLEILKVLVDNITQKKEPESSLDV 744
            +T +   L+VL FP+  +F +KV+R   +  +FR G+L+K   PG+  +IP +D+   +D   +   V      TKD G V +   +++RI D       ++N  + +  I +T +S     +          +  GD   +  ++   +N    + G E+ +V + ++   KEP  +  V
Sbjct:   42 VTGLFTLLIVLTFPISAFFCIKVLRDYERAVIFRLGRLIKPKGPGVILIIPCLDNWTRVDMRSRAFNVPPQKVHTKDDGWVMVGADVQFRIRDAVLSQTAIQNLNQSLRSIAQTSLSNCVARRTV-------PQAQGDRKFINIEVKDGVNKMAGKWGAEVERVQMSDVQVLKEPRDTGGV 215          
BLAST of Stomatin-like protein 1 vs. Ensembl Nematostella
Match: EDO43325 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ14])

HSP 1 Score: 62.003 bits (149), Expect = 6.546e-11
Identity = 38/110 (34.55%), Postives = 57/110 (51.82%), Query Frame = 1
Query:  211 CPITIILGF---LMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            C   II G    L VL FP+  +F +K+++   +  +FR G+LL+     PG+ F++P IDS + +D       V      TKD   V +D V+ +RI + T  I NV N
Sbjct:    2 CCDYIITGLSILLFVLTFPIAVFFCIKIVQEYERAVIFRLGRLLEGGAKGPGMFFILPCIDSYQKVDLRTVSFDVPPQEILTKDSVTVAVDAVVYFRIANATMSITNVEN 111          
BLAST of Stomatin-like protein 1 vs. Ensembl Nematostella
Match: EDO43326 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ15])

HSP 1 Score: 61.2326 bits (147), Expect = 1.381e-10
Identity = 32/99 (32.32%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  235 FLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
             + ++ FP+  +  LK+++   +  +FR G+LLK     PG+ F++P IDS + +D  +    V      TKD   V +D V+ +RI + T  I NV N
Sbjct:   39 LIFIITFPIAIFMCLKIVQEYERAVIFRLGRLLKGGAKGPGLFFILPCIDSYQKVDLRVVSFDVPPQEILTKDSVTVAVDAVVYFRIANATMSITNVEN 137          
BLAST of Stomatin-like protein 1 vs. Ensembl Nematostella
Match: EDO31853 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWR9])

HSP 1 Score: 54.6842 bits (130), Expect = 1.835e-8
Identity = 35/105 (33.33%), Postives = 51/105 (48.57%), Query Frame = 1
Query:  217 ITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            ITI     ++  FP   +F LKV+    +  +FR G++L      PGI FV+P ID  + +D       V      TKD   V +D V+ +R+ + T  I NV N
Sbjct:    8 ITICCYIGVICTFPFSLFFCLKVVSEYERAVIFRIGRILSGGARGPGIFFVLPCIDEFRKVDIRTVSFDVPPQEVLTKDSVTVTVDAVVYFRVENATVSITNVEN 112          
BLAST of Stomatin-like protein 1 vs. Ensembl Nematostella
Match: EDO28629 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5Y2])

HSP 1 Score: 54.299 bits (129), Expect = 2.146e-8
Identity = 35/105 (33.33%), Postives = 51/105 (48.57%), Query Frame = 1
Query:  217 ITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            ITI     ++  FP   +F LKV+    +  +FR G++L      PGI FV+P ID  + +D       V      TKD   V +D V+ +R+ + T  I NV N
Sbjct:    8 ITICCYIGVICTFPFSLFFCLKVVSEYERAVIFRIGRILSGGARGPGIFFVLPCIDEFRKVDIRTVSFDVPPQEVLTKDSVTVTVDAVVYFRVENATVSITNVEN 112          
BLAST of Stomatin-like protein 1 vs. Ensembl Medaka
Match: stoml3b (erythrocyte band 7 integral membrane protein-like [Source:NCBI gene;Acc:101173000])

HSP 1 Score: 70.8626 bits (172), Expect = 1.740e-13
Identity = 45/168 (26.79%), Postives = 85/168 (50.60%), Query Frame = 1
Query:  217 ITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLL--KIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN--WTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            I I+ GF  VL FP+  WF LK+++   +  +FR G+++  K   PGI F++P  DS   +D       +      TKD   V +D V+ +R++DP   + NV N  ++  ++ +T +  +   KN      +   IA  ++S    +L+   +  G+++ +V + ++
Sbjct:   33 IVILSGFFTVLLFPITVWFCLKIVQEYERAVIFRLGRIIDKKPKGPGIFFILPCTDSLIRVDLRTVSFDIPPQEILTKDSVTVSVDGVVYFRVSDPIASVANVTNADFSTRLLAQTTLRNVLGTKNLAEVLSDREGIAHSMQS----NLDEATDNWGIKVERVEIKDV 196          
BLAST of Stomatin-like protein 1 vs. Ensembl Medaka
Match: stoml3b (erythrocyte band 7 integral membrane protein-like [Source:NCBI gene;Acc:101173000])

HSP 1 Score: 70.8626 bits (172), Expect = 1.740e-13
Identity = 45/168 (26.79%), Postives = 85/168 (50.60%), Query Frame = 1
Query:  217 ITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLL--KIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN--WTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            I I+ GF  VL FP+  WF LK+++   +  +FR G+++  K   PGI F++P  DS   +D       +      TKD   V +D V+ +R++DP   + NV N  ++  ++ +T +  +   KN      +   IA  ++S    +L+   +  G+++ +V + ++
Sbjct:   33 IVILSGFFTVLLFPITVWFCLKIVQEYERAVIFRLGRIIDKKPKGPGIFFILPCTDSLIRVDLRTVSFDIPPQEILTKDSVTVSVDGVVYFRVSDPIASVANVTNADFSTRLLAQTTLRNVLGTKNLAEVLSDREGIAHSMQS----NLDEATDNWGIKVERVEIKDV 196          
BLAST of Stomatin-like protein 1 vs. Ensembl Medaka
Match: cyp11a (stomatin like 1 [Source:NCBI gene;Acc:101172577])

HSP 1 Score: 70.0922 bits (170), Expect = 1.020e-12
Identity = 30/94 (31.91%), Postives = 54/94 (57.45%), Query Frame = 1
Query:  244 VLFFPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            ++ FP+ GWF LK +    ++ VFR G++     PGI FV+PLID  + +D   +   +      T+D GL+ +   I++RI +P   +++V++
Sbjct:   69 LITFPLSGWFVLKTVPNYQRIVVFRLGRICPPKGPGIVFVLPLIDQWQRVDLRTRAFNIPPCQVITRDGGLLLVGADIQFRIWNPVMSVVSVQD 162          
BLAST of Stomatin-like protein 1 vs. Ensembl Medaka
Match: stoml3b (erythrocyte band 7 integral membrane protein [Source:NCBI gene;Acc:101162729])

HSP 1 Score: 67.0106 bits (162), Expect = 3.962e-12
Identity = 44/168 (26.19%), Postives = 85/168 (50.60%), Query Frame = 1
Query:  217 ITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLL--KIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINV--RNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            I I+ GF  VL FP+   + LK+++   +  +FR G+++  K   PGI F++P  DS   +D  I    +      TKD   V +D V+ +R++DP   + NV   N++  ++ +T +  +   KN      +   IA  ++S    +L+   +  G+++ +V + ++
Sbjct:   35 IVILSGFFTVLLFPITICYCLKIVQEYERAVIFRLGRIIDKKPKGPGIFFILPCTDSLVKVDLRIISFDIPPQEILTKDSVTVSVDGVVYFRVSDPIASVANVTNANYSTRLLAQTTLRNVLGTKNLAEVLSDREGIAHSMQS----NLDEATDNWGIKVERVEIKDV 198          
BLAST of Stomatin-like protein 1 vs. Ensembl Medaka
Match: stoml3b (erythrocyte band 7 integral membrane protein [Source:NCBI gene;Acc:101162729])

HSP 1 Score: 67.0106 bits (162), Expect = 4.355e-12
Identity = 44/168 (26.19%), Postives = 85/168 (50.60%), Query Frame = 1
Query:  217 ITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLL--KIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINV--RNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            I I+ GF  VL FP+   + LK+++   +  +FR G+++  K   PGI F++P  DS   +D  I    +      TKD   V +D V+ +R++DP   + NV   N++  ++ +T +  +   KN      +   IA  ++S    +L+   +  G+++ +V + ++
Sbjct:   26 IVILSGFFTVLLFPITICYCLKIVQEYERAVIFRLGRIIDKKPKGPGIFFILPCTDSLVKVDLRIISFDIPPQEILTKDSVTVSVDGVVYFRVSDPIASVANVTNANYSTRLLAQTTLRNVLGTKNLAEVLSDREGIAHSMQS----NLDEATDNWGIKVERVEIKDV 189          
BLAST of Stomatin-like protein 1 vs. Planmine SMEST
Match: SMESG000000757.1 (SMESG000000757.1)

HSP 1 Score: 722.235 bits (1863), Expect = 0.000e+0
Identity = 404/409 (98.78%), Postives = 406/409 (99.27%), Query Frame = 1
Query:   25 MKTKYKRCKSKDSENLSNVSNAFCFDTQFDFYSNNYNNYKSIFSYXXXXXXXXXXXXXXXNYCPITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNITQKKEPESSLDVLKKINFKDLGRQLTSMTPLFMXXXXXXXXXXXXXXXXXXKEKALKDFFEKLEIIKNIAINNISQQKESEKSVSFSQSPNAEAQLILGKLIKDFVLQNLSIMEIGKIVSEKSLSPLFENTEKVLELSTCIKEITRVYNVQGNILFDVTNYFKIPSYFHYNYEQGLLADGK 1251
            MKTKYKRCKSKDSENLSNVSNAFCFDTQFDFYSNNYNNYKSIFSYKTIDIDEDDEEIKETNYCPITIILGFLMVLFFP+FGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNITQKKEPESSLDVLKKINFKDLGRQLTSMTPLFMGSSSSNS N SENETGSSKEKALKDFFEKLEIIKNIAINNISQQKESEKSVSFSQ PNAEAQLILGKLIKDFVLQN+SIMEIGKIVSEKSLSPLFENTEKVLELSTCIKEITRVYNVQGNILFDVTNYFKIPSYFHYNYEQGLLADGK
Sbjct:    1 MKTKYKRCKSKDSENLSNVSNAFCFDTQFDFYSNNYNNYKSIFSYKTIDIDEDDEEIKETNYCPITIILGFLMVLFFPLFGWFSLKVIRRNNKLAVFRYGKLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNITQKKEPESSLDVLKKINFKDLGRQLTSMTPLFMGSSSSNSENPSENETGSSKEKALKDFFEKLEIIKNIAINNISQQKESEKSVSFSQPPNAEAQLILGKLIKDFVLQNVSIMEIGKIVSEKSLSPLFENTEKVLELSTCIKEITRVYNVQGNILFDVTNYFKIPSYFHYNYEQGLLADGK 409          
BLAST of Stomatin-like protein 1 vs. Planmine SMEST
Match: SMESG000011117.1 (SMESG000011117.1)

HSP 1 Score: 69.3218 bits (168), Expect = 1.366e-12
Identity = 46/154 (29.87%), Postives = 74/154 (48.05%), Query Frame = 1
Query:  253 FPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            FP    FSLKVI +  +  VFR GKL+    + PG+ F++P +DS K ID       V      T+D   V +D V+ YRI DP   ++NV +         + +L  V+     Y     R   D+ S +  +L+   +  G+++ +V V ++
Sbjct:   79 FPFSLIFSLKVIAQYQRAVVFRLGKLISRGPLGPGLIFILPCLDSMKRIDLRTLTFDVPTQEVLTRDSVTVAVDAVVYYRIFDPVMSVVNVEDANRSTRLLAQTTLRNVLGTVDLYSLLTDR--EDIASSMQETLDVATDAWGMKVERVEVKDV 230          
BLAST of Stomatin-like protein 1 vs. Planmine SMEST
Match: SMESG000026539.1 (SMESG000026539.1)

HSP 1 Score: 66.6254 bits (161), Expect = 7.391e-12
Identity = 37/103 (35.92%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  223 IILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            II  F++V+FFP   +F L V+ +  +  +FR G+L       PG+ F+IP +DS + ID       +      TKD   V +D V+ YRI +P   I+NV N
Sbjct:   74 IISLFILVIFFPFSLFFCLNVVAQYERAVIFRLGRLQGKGPKGPGLVFIIPCLDSIRKIDLRTFTFNIPTQEVLTKDSVTVAVDAVVYYRIFNPVMSIVNVEN 176          
BLAST of Stomatin-like protein 1 vs. Planmine SMEST
Match: SMESG000011117.1 (SMESG000011117.1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.090e-10
Identity = 36/93 (38.71%), Postives = 50/93 (53.76%), Query Frame = 1
Query:  253 FPVFGWFSLKVIRRNNKLAVFRYGKLLK--IVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRN 525
            FP    FSLKVI +  +  VFR GKL+    + PG+ F++P +DS K ID       V      T+D   V +D V+ YRI DP   ++NV +
Sbjct:   79 FPFSLIFSLKVIAQYQRAVVFRLGKLISRGPLGPGLIFILPCLDSMKRIDLRTLTFDVPTQEVLTRDSVTVAVDAVVYYRIFDPVMSVVNVED 171          
BLAST of Stomatin-like protein 1 vs. Planmine SMEST
Match: SMESG000076275.1 (SMESG000076275.1)

HSP 1 Score: 60.4622 bits (145), Expect = 9.126e-10
Identity = 41/161 (25.47%), Postives = 76/161 (47.20%), Query Frame = 1
Query:  238 LMVLFFPVFGWFSLKVIRRNNKLAVFRYGKLL--KIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCVIKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDF--NDSRIAGDLESQIFTSLNTKVEEKGLEILKVLVDNI 708
            L V+ FP   +  LKV+ +  +  +FR G+L+  +   PG+ F++P +DS K +D       V      TKD   V +D V+ YRI +P   ++NV +         + +L  V+     Y       +IA +++      L+   E  G+++ +V + ++
Sbjct:   75 LAVMTFPFSMFACLKVVAQYERAVIFRLGRLISSQPKGPGLVFILPCLDSVKLVDLRTFTFNVPTQEVLTKDSVTVAVDAVVYYRIFEPIMSVVNVEDANRSTRLLAQTTLRNVLGTVDLYQLLCGREQIAHNMQD----CLDAATETWGVKVERVDIKDV 231          
The following BLAST results are available for this feature:
BLAST of Stomatin-like protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
STOML18.204e-1424.75stomatin like 1 [Source:HGNC Symbol;Acc:HGNC:14560... [more]
STOML11.025e-1331.00stomatin like 1 [Source:HGNC Symbol;Acc:HGNC:14560... [more]
STOML11.109e-1324.75stomatin like 1 [Source:HGNC Symbol;Acc:HGNC:14560... [more]
STOML11.143e-1324.75stomatin like 1 [Source:HGNC Symbol;Acc:HGNC:14560... [more]
STOML15.414e-940.35stomatin like 1 [Source:HGNC Symbol;Acc:HGNC:14560... [more]
back to top
BLAST of Stomatin-like protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-244.554e-1127.72UNC-24 [Source:UniProtKB/TrEMBL;Acc:G5ED76][more]
sto-46.538e-1136.79Stomatin-4 [Source:UniProtKB/Swiss-Prot;Acc:Q2216... [more]
sto-46.538e-1136.79Stomatin-4 [Source:UniProtKB/Swiss-Prot;Acc:Q2216... [more]
mec-21.890e-1024.55Mechanosensory protein 2 [Source:UniProtKB/Swiss-... [more]
mec-22.372e-1024.55Mechanosensory protein 2 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Stomatin-like protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG425401.180e-926.71gene:FBgn0260657 transcript:FBtr0344807[more]
CG425401.525e-926.71gene:FBgn0260657 transcript:FBtr0333583[more]
CG425401.544e-926.71gene:FBgn0260657 transcript:FBtr0333584[more]
CG425401.563e-926.71gene:FBgn0260657 transcript:FBtr0301096[more]
CG425401.845e-926.71gene:FBgn0260657 transcript:FBtr0301097[more]
back to top
BLAST of Stomatin-like protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stoml16.912e-1332.38stomatin (EPB72)-like 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
stoml16.912e-1332.38stomatin (EPB72)-like 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
zgc:1124083.043e-1025.41zgc:112408 [Source:ZFIN;Acc:ZDB-GENE-050417-63][more]
zgc:1124083.218e-1025.41zgc:112408 [Source:ZFIN;Acc:ZDB-GENE-050417-63][more]
stoml3b3.419e-1024.40stomatin (EPB72)-like 3b [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Stomatin-like protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dbt1.669e-926.29dihydrolipoamide branched chain transacylase E2 [S... [more]
myo10.22.203e-923.46myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995... [more]
myo10.22.373e-923.46myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995... [more]
myo10.22.726e-923.46myosin 10, gene 2 [Source:Xenbase;Acc:XB-GENE-5995... [more]
atp8b34.942e-829.52ATPase, aminophospholipid transporter, class I, ty... [more]
back to top
BLAST of Stomatin-like protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Stoml11.395e-1123.53stomatin-like 1 [Source:MGI Symbol;Acc:MGI:1916356... [more]
Stom5.111e-921.60stomatin [Source:MGI Symbol;Acc:MGI:95403][more]
Nphs22.999e-826.56nephrosis 2, podocin [Source:MGI Symbol;Acc:MGI:21... [more]
Nphs22.167e-726.56nephrosis 2, podocin [Source:MGI Symbol;Acc:MGI:21... [more]
Stoml39.782e-627.88stomatin (Epb7.2)-like 3 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Stomatin-like protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9UBI4|STML1_HUMAN5.327e-1324.75Stomatin-like protein 1 OS=Homo sapiens OX=9606 GN... [more]
sp|Q8CI66|STML1_MOUSE1.077e-1023.53Stomatin-like protein 1 OS=Mus musculus OX=10090 G... [more]
sp|Q22165|STO4_CAEEL8.317e-1036.79Stomatin-4 OS=Caenorhabditis elegans OX=6239 GN=st... [more]
sp|Q27433|MEC2_CAEEL3.024e-924.55Mechanosensory protein 2 OS=Caenorhabditis elegans... [more]
sp|Q19200|STO1_CAEEL5.951e-924.46Stomatin-1 OS=Caenorhabditis elegans OX=6239 GN=st... [more]
back to top
BLAST of Stomatin-like protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QEG61.046e-2228.71PHB domain-containing protein OS=Hymenolepis dimin... [more]
A0A564YY341.356e-2228.71PHB domain-containing protein OS=Hymenolepis dimin... [more]
A0A0R3WM232.189e-2126.37PHB domain-containing protein OS=Hydatigena taenia... [more]
A0A0X3PHB11.266e-1828.65PHB domain-containing protein OS=Schistocephalus s... [more]
A0A0R3WFE04.436e-1826.88PHB domain-containing protein OS=Taenia asiatica O... [more]
back to top
BLAST of Stomatin-like protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stoml16.825e-1332.69stomatin like 1 [Source:NCBI gene;Acc:103047797][more]
nphs27.490e-1127.21NPHS2 stomatin family member, podocin [Source:ZFIN... [more]
zgc:1124082.500e-929.09erythrocyte band 7 integral membrane protein-like ... [more]
zgc:1124082.534e-929.09erythrocyte band 7 integral membrane protein-like ... [more]
stoml3b1.403e-823.90stomatin (EPB72)-like 3b [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of Stomatin-like protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
stoml13.433e-1427.92stomatin (EPB72)-like 1 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000006522.13.041e-1230.41pep scaffold:Pmarinus_7.0:GL477331:35910:45947:-1 ... [more]
back to top
BLAST of Stomatin-like protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Stomatin-like protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO322311.045e-1124.31Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433256.546e-1134.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433261.381e-1032.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO318531.835e-833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286292.146e-833.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Stomatin-like protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stoml3b1.740e-1326.79erythrocyte band 7 integral membrane protein-like ... [more]
stoml3b1.740e-1326.79erythrocyte band 7 integral membrane protein-like ... [more]
cyp11a1.020e-1231.91stomatin like 1 [Source:NCBI gene;Acc:101172577][more]
stoml3b3.962e-1226.19erythrocyte band 7 integral membrane protein [Sour... [more]
stoml3b4.355e-1226.19erythrocyte band 7 integral membrane protein [Sour... [more]
back to top
BLAST of Stomatin-like protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000757.10.000e+098.78SMESG000000757.1[more]
SMESG000011117.11.366e-1229.87SMESG000011117.1[more]
SMESG000026539.17.391e-1235.92SMESG000026539.1[more]
SMESG000011117.11.090e-1038.71SMESG000011117.1[more]
SMESG000076275.19.126e-1025.47SMESG000076275.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031593 ID=SMED30031593|Name=Stomatin-like protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1311bp
CATTGTTATATTTGAAATTTAATAATGAAAACTAAGTATAAAAGATGTAA
AAGTAAAGACTCGGAAAATCTGTCTAATGTATCAAATGCTTTTTGCTTTG
ATACTCAATTTGATTTTTATTCGAATAATTATAATAACTATAAGTCCATA
TTTTCATACAAAACCATAGACATAGATGAAGATGACGAAGAAATAAAAGA
GACTAATTATTGTCCAATAACTATAATTTTAGGTTTTCTTATGGTTTTAT
TTTTCCCAGTATTTGGATGGTTCTCTTTAAAGGTTATCCGAAGAAATAAT
AAACTTGCAGTATTCCGCTATGGAAAGTTGCTGAAGATAGTTGATCCTGG
AATCGCATTTGTTATCCCACTAATTGATTCTTGCAAATACATTGATACGA
CAATTAAAGAGAGTCGTGTAAAAAATGCTTCATGTCCAACTAAAGATCAT
GGTCTAGTGGAGATTGATTGTGTAATAAAGTATCGAATAACAGATCCGAC
CTTTATGATAATAAATGTCAGAAACTGGACAGAATTTATAATTACCGAAA
CCCGAGTTTCTCTTCTGTTTGTCATGAAAAATTTTAGATGGTATGATTTT
AATGATTCCCGAATAGCTGGTGACCTAGAAAGTCAAATATTTACTTCTTT
GAACACTAAGGTAGAAGAAAAAGGTCTTGAAATACTTAAAGTCCTTGTAG
ATAATATAACTCAGAAAAAAGAACCTGAATCATCATTAGATGTTTTGAAG
AAAATTAATTTTAAAGATTTGGGTCGGCAATTGACGTCCATGACGCCGTT
ATTTATGGGTTCAAGTTCAAGCAATTCTGCAAATTCTTCGGAAAATGAAA
CTGGTTCGTCTAAAGAAAAAGCTTTAAAAGATTTTTTTGAAAAACTCGAA
ATTATCAAAAATATTGCCATTAATAATATATCACAACAGAAAGAGTCCGA
AAAGTCTGTTTCATTTAGTCAGTCTCCTAATGCTGAAGCACAATTGATAT
TGGGAAAATTAATTAAGGACTTTGTTCTGCAAAACTTATCAATTATGGAA
ATTGGCAAAATTGTGTCTGAAAAATCATTGTCACCTCTTTTTGAAAACAC
CGAAAAGGTTTTGGAACTCTCTACGTGCATTAAAGAGATAACACGAGTGT
ATAATGTCCAAGGAAACATATTATTTGATGTAACAAATTACTTCAAAATT
CCCTCATATTTCCATTACAATTATGAGCAAGGATTACTGGCAGATGGGAA
AATAGATGACAATATAATTATGATATCATTATGATCTCTAAATATTAAAT
GCGACCTTTGT
back to top

protein sequence of SMED30031593-orf-1

>SMED30031593-orf-1 ID=SMED30031593-orf-1|Name=SMED30031593-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=420bp
MKTKYKRCKSKDSENLSNVSNAFCFDTQFDFYSNNYNNYKSIFSYKTIDI
DEDDEEIKETNYCPITIILGFLMVLFFPVFGWFSLKVIRRNNKLAVFRYG
KLLKIVDPGIAFVIPLIDSCKYIDTTIKESRVKNASCPTKDHGLVEIDCV
IKYRITDPTFMIINVRNWTEFIITETRVSLLFVMKNFRWYDFNDSRIAGD
LESQIFTSLNTKVEEKGLEILKVLVDNITQKKEPESSLDVLKKINFKDLG
RQLTSMTPLFMGSSSSNSANSSENETGSSKEKALKDFFEKLEIIKNIAIN
NISQQKESEKSVSFSQSPNAEAQLILGKLIKDFVLQNLSIMEIGKIVSEK
SLSPLFENTEKVLELSTCIKEITRVYNVQGNILFDVTNYFKIPSYFHYNY
EQGLLADGKIDDNIIMISL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043202Band-7_stomatin-like
IPR036013Band_7/SPFH_dom_sf
IPR001107Band_7
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001107Band 7 domainSMARTSM00244PHB_4coord: 83..245
e-value: 3.4E-7
score: 39.9
IPR001107Band 7 domainPFAMPF01145Band_7coord: 87..233
e-value: 9.8E-18
score: 64.8
NoneNo IPR availableGENE3DG3DSA:3.30.479.30coord: 111..240
e-value: 7.0E-12
score: 47.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 260..280
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 260..274
NoneNo IPR availableTMHMMTMhelixcoord: 62..84
IPR043202Band-7 stomatin-likePANTHERPTHR10264BAND 7 PROTEIN-RELATEDcoord: 65..238
IPR036013Band 7/SPFH domain superfamilySUPERFAMILYSSF117892Band 7/SPFH domaincoord: 114..235