Glycogen [starch] synthase

Overview
NameGlycogen [starch] synthase
Smed IDSMED30031587
Length (bp)2524
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Glycogen [starch] synthase (SMED30031587) t-SNE clustered cells

Violin plots show distribution of expression levels for Glycogen [starch] synthase (SMED30031587) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Glycogen [starch] synthase (SMED30031587) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Glycogen [starch] synthase (SMED30031587) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031587

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30031587h1SMcG0015714 dd_Smed_v4_3119_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031587h1SMcG0015714 dd_Smed_v4_3119_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30031587h1SMcG0015714 dd_Smed_v4_3119_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30031587h1SMcG0015714 dd_Smed_v4_3119_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031587h1SMcG0015714 dd_Smed_v4_3119_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Glycogen [starch] synthase vs. Ensembl Human
Match: GYS1 (glycogen synthase 1 [Source:HGNC Symbol;Acc:HGNC:4706])

HSP 1 Score: 811.601 bits (2095), Expect = 0.000e+0
Identity = 387/649 (59.63%), Postives = 489/649 (75.35%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNID-KEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSP 2078
            N  +FE+AWEV NKVGGIYTV++TKA  T DE GDNY L+GP  E  +RT+V++LE P+  L   ++ M S G K+ FGRWLI+G PLVVL D+G+SAW ++ WK ELW+  +IG+P  D E ND+V+ G L TWFLG F    + K H     ++AHFHEWL  VGL  CR R L +AT+FTTHATLLGRYL A + D YNNL  F+VDKEAG+R IYHRYC+ERAAAHC H FTTVSQIT +E+Q+LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +F++GHFYGHL+F+LDKTLYFFIAGRYEF NKGAD+F+E+LARLN+ L+   S+ TVVAF I PARTNNFNVE+ + QA+ KQL +T   ++   G++++E  L G++P    +L ++D   +KR I++ QRQS PP+ THN+LDD++DPIL  +RR  +FNS +DRVKVIFHPEFLSS +PL+P+DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFME+H+ DP +YGIYI+DRR RS ++S  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG YY  +R +ALSK  P  F Y      +E+D  + + +   RP S P SP+ S  S+P        P
Sbjct:   26 NAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPH-----VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEP----NEAD--AAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDP 663          
BLAST of Glycogen [starch] synthase vs. Ensembl Human
Match: GYS2 (glycogen synthase 2 [Source:HGNC Symbol;Acc:HGNC:4707])

HSP 1 Score: 767.303 bits (1980), Expect = 0.000e+0
Identity = 362/594 (60.94%), Postives = 457/594 (76.94%), Query Frame = 3
Query:  153 IAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLF 1934
            +AWEV NKVGGIYTVI+TKA TT DE G+NY L+GP  E  M+T+V+  E  +  +  A++ M  HG ++ FGRWLI+G P VVLFDIG SAW +D WK +LWEA  +GIP  D E ND +I G L  WFL   +   D   GKY  ++A FHEW   +GLI  R R L IAT+FTTHATLLGRYL A++ D YN+L KF++DKEAG+R IYHRYC+ERA+ HC H FTTVS+IT +E++++L RK DV+TPNGLNV KF+A+HEFQN HA  K +I  F++GHFYGHL+FDL+KTL+ FIAGRYEF NKGAD+F+ESL+RLN  L+  KSD+TV+ F I PA+TNNFNVE+ + QA+ KQL +    ++   GK++++  L+G +P   D+L +DD+  +KR I+S QRQSLPP++THN++DD+ DPIL  +RR  +FN+R+DRVKVI HPEFLSS +PL+PMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFM++HV DP +YGIYIVDRR RS ++S  QLT ++  F + SRRQRI+ RNRTERLS+LLDW  LG YY+ +R + LS+  P  F
Sbjct:   33 VAWEVTNKVGGIYTVIQTKAKTTADEWGENYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDIGYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFL---KEVTDHADGKY--VVAQFHEWQAGIGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYHRYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYKARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDITVMVFFIMPAKTNNFNVETLKGQAVRKQLWDVAHSVKEKFGKKLYDALLRGEIPDLNDILDRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEHVADPTAYGIYIVDRRFRSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYLGRYYQHARHLTLSRAFPDKF 621          
BLAST of Glycogen [starch] synthase vs. Ensembl Human
Match: GYS1 (glycogen synthase 1 [Source:HGNC Symbol;Acc:HGNC:4706])

HSP 1 Score: 644.425 bits (1661), Expect = 0.000e+0
Identity = 306/495 (61.82%), Postives = 384/495 (77.58%), Query Frame = 3
Query:  594 IIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSP 2078
            ++AHFHEWL  VGL  CR R L +AT+FTTHATLLGRYL A + D YNNL  F+VDKEAG+R IYHRYC+ERAAAHC H FTTVSQIT +E+Q+LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +F++GHFYGHL+F+LDKTLYFFIAGRYEF NKGAD+F+E+LARLN+ L+   S+ TVVAF I PARTNNFNVE+ + QA+ KQL +T   ++   G++++E  L G++P    +L ++D   +KR I++ QRQS PP+ THN+LDD++DPIL  +RR  +FNS +DRVKVIFHPEFLSS +PL+P+DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFME+H+ DP +YGIYI+DRR RS ++S  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG YY  +R +ALSK  P  F Y      +E+D  + + +   RP S P SP+ S  S+P        P
Sbjct:  111 VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEP----NEAD--AAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDP 599          

HSP 2 Score: 92.0485 bits (227), Expect = 1.815e-18
Identity = 41/77 (53.25%), Postives = 54/77 (70.13%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKII 365
            N  +FE+AWEV NKVGGIYTV++TKA  T DE GDNY L+GP  E  +RT+V++LE P+  L   ++ M S G K +
Sbjct:   26 NAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKFL 102          
BLAST of Glycogen [starch] synthase vs. Ensembl Human
Match: GYS1 (glycogen synthase 1 [Source:HGNC Symbol;Acc:HGNC:4706])

HSP 1 Score: 53.1434 bits (126), Expect = 7.421e-8
Identity = 34/53 (64.15%), Postives = 42/53 (79.25%), Query Frame = 3
Query: 1719 IYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLG 1877
            IYI+DRR RS ++S  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG
Sbjct:    2 IYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLG 54          
BLAST of Glycogen [starch] synthase vs. Ensembl Celegans
Match: gsy-1 (Glycogen [starch] synthase [Source:UniProtKB/Swiss-Prot;Acc:Q9U2D9])

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 362/602 (60.13%), Postives = 452/602 (75.08%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTP-IIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKS----DVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSP 1925
             R+VFE AWEV NKVGGIYTV+++KA  + +ELGD Y + GP+ +   R EVD +E  +  +  A+   ++ G + ++GRWLI+GYP V+LFD+GS A +++ WK EL+E   IGIP +D E ND+VILG +V  FL  FR ++      YTP ++AHFHEW   VGL+  R   LDIATV+TTHATLLGR+L A  ADLYNNL  FD+D EAG R IYH+YCLERAA    H FTTVS+IT LE+++ L RK DV+TPNGLNV+KFAALHEFQN HAQ KEKI+QFI+GHF+GHL+FDLDKTLYFF AGRYEF NKG D+FIESLARLNH LK         VTVVAFLI+PA  N+FNVES + QA+ KQL+  V  I+  +G+R+F++CL+G++P   +++   D I LKRCI S    SLPPI THN++  A+DP+L +LRR  +FN   DRVKV+FHPEFLSS +PLI +DYE+FVRGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFM++HV D +  GIY++DRRH++ EESV++L   M DF   SRRQRI+LRN  E LS LLDW NLG +Y+  R +AL +  P
Sbjct:   43 GRFVFECAWEVANKVGGIYTVLRSKAQISTEELGDQYCMFGPMKDGKWRLEVDPIEPENRTIRAAMKRFQADGFRCMYGRWLIEGYPKVILFDLGSGAVKMNEWKHELFEQCKIGIPHEDIESNDAVILGFMVALFLKHFRESVTS----YTPLVVAHFHEWQAGVGLLMTRLWKLDIATVYTTHATLLGRHLCAGGADLYNNLDSFDLDAEAGKRKIYHQYCLERAACQTAHIFTTVSEITGLEAEHFLCRKPDVLTPNGLNVVKFAALHEFQNLHAQNKEKINQFIRGHFHGHLDFDLDKTLYFFTAGRYEFSNKGGDMFIESLARLNHYLKTTSDPRHMGVTVVAFLIYPAPANSFNVESLKGQAVTKQLKEAVDRIKEKVGQRIFDICLQGHLPEPEELMSPADNILLKRCIMSLHNSSLPPICTHNMI-RADDPVLESLRRTSLFNKPEDRVKVVFHPEFLSSVSPLIGLDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMQEHVEDHEQKGIYVIDRRHKAAEESVQELAQVMYDFCGQSRRQRIILRNSNEGLSALLDWQNLGVFYRDCRRLALERLHP 639          
BLAST of Glycogen [starch] synthase vs. Ensembl Fly
Match: GlyS (gene:FBgn0266064 transcript:FBtr0083037)

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 402/644 (62.42%), Postives = 504/644 (78.26%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSG-PLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRG---NIDKEHGKYTP-IIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTP 2051
            NR+ FE+AWEV NKVGGIYTVI++KA  + +E+G+   +MGP  E C RTE++ +E P G PL +A+N +RS G KI  GRWL+DG P ++LFDIGS+AW++D +K E+WE  HIGIP  D E ND++ILG ++  FL  FR       + +    P I+AHFHEW   VGLI  RTR ++IATVFTTHATLLGRYL A + D YNNL KF VD+EAG R IYHRYCLER A H  H FTTVS+IT  E+++LL RK D+ITPNGLNV KF+A+HEFQN HA AKEKI++F++GHFYGH++FDLDKTLYFFIAGRYEF NKGAD+FIE+LARLN  LK  K D TVVAFLIFP +TNNFNV+S R  A+ KQLR+T+ ++Q  +GKR+F+ CL+GN+P   D+LQ+DD++K+KRC+++ QR S+PP++THNV DD NDP+L ++RRC +FNSR DRVK++FHPEFL+S NPL  +DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFME+H+ DPKSYGIYIVDRR+   E SV+QL+++MM+FS+ +RRQRI+ RNRTERLS+LLDW  LG YY+++R+ AL    P   DY   +SL      S+ +   SRP+S P SPT+S  +TP
Sbjct:   48 NRWNFEVAWEVANKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEMEFPRGNPLLDAVNSLRSRGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFMIAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLLGRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHLLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIAGRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSSFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYP---DYVDELSL----YGSKNNLIFSRPHSEPPSPTSSRHTTP 684          
BLAST of Glycogen [starch] synthase vs. Ensembl Fly
Match: GlyS (gene:FBgn0266064 transcript:FBtr0333276)

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 402/644 (62.42%), Postives = 504/644 (78.26%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSG-PLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRG---NIDKEHGKYTP-IIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTP 2051
            NR+ FE+AWEV NKVGGIYTVI++KA  + +E+G+   +MGP  E C RTE++ +E P G PL +A+N +RS G KI  GRWL+DG P ++LFDIGS+AW++D +K E+WE  HIGIP  D E ND++ILG ++  FL  FR       + +    P I+AHFHEW   VGLI  RTR ++IATVFTTHATLLGRYL A + D YNNL KF VD+EAG R IYHRYCLER A H  H FTTVS+IT  E+++LL RK D+ITPNGLNV KF+A+HEFQN HA AKEKI++F++GHFYGH++FDLDKTLYFFIAGRYEF NKGAD+FIE+LARLN  LK  K D TVVAFLIFP +TNNFNV+S R  A+ KQLR+T+ ++Q  +GKR+F+ CL+GN+P   D+LQ+DD++K+KRC+++ QR S+PP++THNV DD NDP+L ++RRC +FNSR DRVK++FHPEFL+S NPL  +DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFME+H+ DPKSYGIYIVDRR+   E SV+QL+++MM+FS+ +RRQRI+ RNRTERLS+LLDW  LG YY+++R+ AL    P   DY   +SL      S+ +   SRP+S P SPT+S  +TP
Sbjct:   28 NRWNFEVAWEVANKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEMEFPRGNPLLDAVNSLRSRGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFMIAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLLGRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHLLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIAGRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSSFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYP---DYVDELSL----YGSKNNLIFSRPHSEPPSPTSSRHTTP 664          
BLAST of Glycogen [starch] synthase vs. Ensembl Fly
Match: GlyS (gene:FBgn0266064 transcript:FBtr0083035)

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 402/644 (62.42%), Postives = 504/644 (78.26%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSG-PLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRG---NIDKEHGKYTP-IIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTP 2051
            NR+ FE+AWEV NKVGGIYTVI++KA  + +E+G+   +MGP  E C RTE++ +E P G PL +A+N +RS G KI  GRWL+DG P ++LFDIGS+AW++D +K E+WE  HIGIP  D E ND++ILG ++  FL  FR       + +    P I+AHFHEW   VGLI  RTR ++IATVFTTHATLLGRYL A + D YNNL KF VD+EAG R IYHRYCLER A H  H FTTVS+IT  E+++LL RK D+ITPNGLNV KF+A+HEFQN HA AKEKI++F++GHFYGH++FDLDKTLYFFIAGRYEF NKGAD+FIE+LARLN  LK  K D TVVAFLIFP +TNNFNV+S R  A+ KQLR+T+ ++Q  +GKR+F+ CL+GN+P   D+LQ+DD++K+KRC+++ QR S+PP++THNV DD NDP+L ++RRC +FNSR DRVK++FHPEFL+S NPL  +DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFME+H+ DPKSYGIYIVDRR+   E SV+QL+++MM+FS+ +RRQRI+ RNRTERLS+LLDW  LG YY+++R+ AL    P   DY   +SL      S+ +   SRP+S P SPT+S  +TP
Sbjct:   28 NRWNFEVAWEVANKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEMEFPRGNPLLDAVNSLRSRGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFMIAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLLGRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHLLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIAGRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSSFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYP---DYVDELSL----YGSKNNLIFSRPHSEPPSPTSSRHTTP 664          
BLAST of Glycogen [starch] synthase vs. Ensembl Fly
Match: GlyS (gene:FBgn0266064 transcript:FBtr0083036)

HSP 1 Score: 831.632 bits (2147), Expect = 0.000e+0
Identity = 402/644 (62.42%), Postives = 504/644 (78.26%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSG-PLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRG---NIDKEHGKYTP-IIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTP 2051
            NR+ FE+AWEV NKVGGIYTVI++KA  + +E+G+   +MGP  E C RTE++ +E P G PL +A+N +RS G KI  GRWL+DG P ++LFDIGS+AW++D +K E+WE  HIGIP  D E ND++ILG ++  FL  FR       + +    P I+AHFHEW   VGLI  RTR ++IATVFTTHATLLGRYL A + D YNNL KF VD+EAG R IYHRYCLER A H  H FTTVS+IT  E+++LL RK D+ITPNGLNV KF+A+HEFQN HA AKEKI++F++GHFYGH++FDLDKTLYFFIAGRYEF NKGAD+FIE+LARLN  LK  K D TVVAFLIFP +TNNFNV+S R  A+ KQLR+T+ ++Q  +GKR+F+ CL+GN+P   D+LQ+DD++K+KRC+++ QR S+PP++THNV DD NDP+L ++RRC +FNSR DRVK++FHPEFL+S NPL  +DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFME+H+ DPKSYGIYIVDRR+   E SV+QL+++MM+FS+ +RRQRI+ RNRTERLS+LLDW  LG YY+++R+ AL    P   DY   +SL      S+ +   SRP+S P SPT+S  +TP
Sbjct:   28 NRWNFEVAWEVANKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEMEFPRGNPLLDAVNSLRSRGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFMIAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLLGRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHLLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIAGRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSSFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYP---DYVDELSL----YGSKNNLIFSRPHSEPPSPTSSRHTTP 664          
BLAST of Glycogen [starch] synthase vs. Ensembl Zebrafish
Match: gys2 (glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-030826-31])

HSP 1 Score: 785.408 bits (2027), Expect = 0.000e+0
Identity = 371/597 (62.14%), Postives = 462/597 (77.39%), Query Frame = 3
Query:  144 VFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLF 1934
            +FE+AWEV NKVGGIYTVI+TKA  T DE G+NY +MGP  E   +T+V+  E P+  +  A++ + ++G ++ FGRWLI+G P V+LFDIG++AW +D WK +LW A  IG+P  D E NDS+ILG LV WF   F+   D+   K   ++AHFHEW    GL+  R+RNL +AT+FTTHATLLGRYL A +AD YNNL KFD+D+EAG+R IYHRYCLERAA HC H FTTVSQIT +E+ ++L R  DV+TPNGLNV KF+A+HEFQN H+  K KI +F++GHFYGHL+F+L+KTL+FFIAGRYEF NKGADLF+ESL+RLN+ L+  KSDVTVV F I PA+TNNFNVES + QA+ KQL +T   ++   GK+++E  L+G +P    +L +DD   +KR IY+ QR SLPP++THN+LDD+ DPIL N+RR  +FN R+DRVK++FHPEFLSS +PL+PMDYEEFVRGCHLGVFPSYYEPWGYTP ECTVMGIPSVTTNLSGFGCFME+HV DP  YGIYIVDRR RS +ES  QLT +M  F Q SRRQRI+ RNRTERLS+LLDW  LG +Y  +R +ALS+  P  F
Sbjct:   30 LFEVAWEVTNKVGGIYTVIQTKAKITVDEWGENYFMMGPYYEHNFKTQVEKCEPPNQAIRAAMDSLINNGCQVHFGRWLIEGSPYVILFDIGAAAWNLDRWKGDLWSACGIGLPYHDREANDSLILGSLVAWF---FKELTDQLQDKLN-VVAHFHEWQAGTGLVLSRSRNLPLATIFTTHATLLGRYLCAGNADFYNNLDKFDIDREAGERQIYHRYCLERAAVHCAHVFTTVSQITAVEADHMLHRNPDVVTPNGLNVRKFSAMHEFQNLHSMNKSKIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADLFLESLSRLNYLLRVHKSDVTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAQSVKEKFGKKLYESLLRGEIPDMSKILDRDDFTIMKRAIYATQRHSLPPVTTHNMLDDSTDPILGNIRRIGLFNGRNDRVKIVFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFMEEHVSDPSEYGIYIVDRRFRSADESCNQLTQFMFSFCQKSRRQRIIQRNRTERLSDLLDWRYLGRFYMHARHLALSRSFPEKF 622          
BLAST of Glycogen [starch] synthase vs. Ensembl Zebrafish
Match: gys2 (glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-030826-31])

HSP 1 Score: 785.023 bits (2026), Expect = 0.000e+0
Identity = 371/597 (62.14%), Postives = 462/597 (77.39%), Query Frame = 3
Query:  144 VFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLF 1934
            +FE+AWEV NKVGGIYTVI+TKA  T DE G+NY +MGP  E   +T+V+  E P+  +  A++ + ++G ++ FGRWLI+G P V+LFDIG++AW +D WK +LW A  IG+P  D E NDS+ILG LV WF   F+   D+   K   ++AHFHEW    GL+  R+RNL +AT+FTTHATLLGRYL A +AD YNNL KFD+D+EAG+R IYHRYCLERAA HC H FTTVSQIT +E+ ++L R  DV+TPNGLNV KF+A+HEFQN H+  K KI +F++GHFYGHL+F+L+KTL+FFIAGRYEF NKGADLF+ESL+RLN+ L+  KSDVTVV F I PA+TNNFNVES + QA+ KQL +T   ++   GK+++E  L+G +P    +L +DD   +KR IY+ QR SLPP++THN+LDD+ DPIL N+RR  +FN R+DRVK++FHPEFLSS +PL+PMDYEEFVRGCHLGVFPSYYEPWGYTP ECTVMGIPSVTTNLSGFGCFME+HV DP  YGIYIVDRR RS +ES  QLT +M  F Q SRRQRI+ RNRTERLS+LLDW  LG +Y  +R +ALS+  P  F
Sbjct:   30 LFEVAWEVTNKVGGIYTVIQTKAKITVDEWGENYFMMGPYYEHNFKTQVEKCEPPNQAIRAAMDSLINNGCQVHFGRWLIEGSPYVILFDIGAAAWNLDRWKGDLWSACGIGLPYHDREANDSLILGSLVAWF---FKELTDQLQDKLN-VVAHFHEWQAGTGLVLSRSRNLPLATIFTTHATLLGRYLCAGNADFYNNLDKFDIDREAGERQIYHRYCLERAAVHCAHVFTTVSQITAVEADHMLHRNPDVVTPNGLNVRKFSAMHEFQNLHSMNKSKIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADLFLESLSRLNYLLRVHKSDVTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAQSVKEKFGKKLYESLLRGEIPDMSKILDRDDFTIMKRAIYATQRHSLPPVTTHNMLDDSTDPILGNIRRIGLFNGRNDRVKIVFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFMEEHVSDPSEYGIYIVDRRFRSADESCNQLTQFMFSFCQKSRRQRIIQRNRTERLSDLLDWRYLGRFYMHARHLALSRSFPEKF 622          
BLAST of Glycogen [starch] synthase vs. Ensembl Zebrafish
Match: gys2 (glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-030826-31])

HSP 1 Score: 784.637 bits (2025), Expect = 0.000e+0
Identity = 371/597 (62.14%), Postives = 462/597 (77.39%), Query Frame = 3
Query:  144 VFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLF 1934
            +FE+AWEV NKVGGIYTVI+TKA  T DE G+NY +MGP  E   +T+V+  E P+  +  A++ + ++G ++ FGRWLI+G P V+LFDIG++AW +D WK +LW A  IG+P  D E NDS+ILG LV WF   F+   D+   K   ++AHFHEW    GL+  R+RNL +AT+FTTHATLLGRYL A +AD YNNL KFD+D+EAG+R IYHRYCLERAA HC H FTTVSQIT +E+ ++L R  DV+TPNGLNV KF+A+HEFQN H+  K KI +F++GHFYGHL+F+L+KTL+FFIAGRYEF NKGADLF+ESL+RLN+ L+  KSDVTVV F I PA+TNNFNVES + QA+ KQL +T   ++   GK+++E  L+G +P    +L +DD   +KR IY+ QR SLPP++THN+LDD+ DPIL N+RR  +FN R+DRVK++FHPEFLSS +PL+PMDYEEFVRGCHLGVFPSYYEPWGYTP ECTVMGIPSVTTNLSGFGCFME+HV DP  YGIYIVDRR RS +ES  QLT +M  F Q SRRQRI+ RNRTERLS+LLDW  LG +Y  +R +ALS+  P  F
Sbjct:   30 LFEVAWEVTNKVGGIYTVIQTKAKITVDEWGENYFMMGPYYEHNFKTQVEKCEPPNQAIRAAMDSLINNGCQVHFGRWLIEGSPYVILFDIGAAAWNLDRWKGDLWSACGIGLPYHDREANDSLILGSLVAWF---FKELTDQLQDKLN-VVAHFHEWQAGTGLVLSRSRNLPLATIFTTHATLLGRYLCAGNADFYNNLDKFDIDREAGERQIYHRYCLERAAVHCAHVFTTVSQITAVEADHMLHRNPDVVTPNGLNVRKFSAMHEFQNLHSMNKSKIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADLFLESLSRLNYLLRVHKSDVTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAQSVKEKFGKKLYESLLRGEIPDMSKILDRDDFTIMKRAIYATQRHSLPPVTTHNMLDDSTDPILGNIRRIGLFNGRNDRVKIVFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFMEEHVSDPSEYGIYIVDRRFRSADESCNQLTQFMFSFCQKSRRQRIIQRNRTERLSDLLDWRYLGRFYMHARHLALSRSFPEKF 622          
BLAST of Glycogen [starch] synthase vs. Ensembl Zebrafish
Match: gys1 (glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-GENE-040426-1243])

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 370/629 (58.82%), Postives = 473/629 (75.20%), Query Frame = 3
Query:  144 VFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPT 2030
            +FEIAWEV NKVGGIYTVI+TKA  T +E G+NY L+GP  E  +RT+V+++E  +  L   I++M S G K+ FGRWLI+G P VVL D+G +AW +D WK ELWE  +IG+P  D E ND+V+ G L  W LG +    D+       I+AHFHEWL  +GL+ CR R L ++T+FTTHATLLGRYL A + D YNNL++F+VDKEAGDR IYHRYCLERAA  C H FTTVSQIT +E+++LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +F++GHFYGHL+F+LDKT++ FIAGRYEF NKGAD+F+E+LARLN+ L+   S+VTV+AF I PARTNNFNVE+ + QA+ KQL +T   ++   GK+++E  L G +P    +L ++D   +KR I++ QRQ  PP+ THN+L+D++DPIL  +RR  +FNS  DRVKVIFHPEFLSS +PL+PMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFME+H+ DP +YGIYI+DRR+RS +ES  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  + Y      +  +  S   +   RP S P SP 
Sbjct:   29 LFEIAWEVANKVGGIYTVIQTKARLTCEEWGENYFLVGPYMESNVRTQVELIEPCNAALRRTIDKMNSSGCKVYFGRWLIEGSPYVVLLDVGFTAWSLDRWKSELWEKCNIGVPWFDREANDAVLFGFLTAWLLGEYAAQCDEP----PHIVAHFHEWLAGLGLVLCRQRQLPVSTIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYHRYCLERAACRCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSEVTVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQSVKERFGKKLYESLLVGQLPDVSKMLDKEDFTMMKRAIFATQRQCQPPVCTHNMLEDSSDPILNCIRRIGLFNSAQDRVKVIFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRYRSVDESCNQLTSFLFQFCQQSRRQRIIQRNRTERLSDLLDWRYLGRYYVSARHLALAKAYPDTYIY------EPQEPSSAAGFRYPRPASVPPSPA 647          
BLAST of Glycogen [starch] synthase vs. Ensembl Zebrafish
Match: gys1 (glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-GENE-040426-1243])

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 370/629 (58.82%), Postives = 473/629 (75.20%), Query Frame = 3
Query:  144 VFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPT 2030
            +FEIAWEV NKVGGIYTVI+TKA  T +E G+NY L+GP  E  +RT+V+++E  +  L   I++M S G K+ FGRWLI+G P VVL D+G +AW +D WK ELWE  +IG+P  D E ND+V+ G L  W LG +    D+       I+AHFHEWL  +GL+ CR R L ++T+FTTHATLLGRYL A + D YNNL++F+VDKEAGDR IYHRYCLERAA  C H FTTVSQIT +E+++LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +F++GHFYGHL+F+LDKT++ FIAGRYEF NKGAD+F+E+LARLN+ L+   S+VTV+AF I PARTNNFNVE+ + QA+ KQL +T   ++   GK+++E  L G +P    +L ++D   +KR I++ QRQ  PP+ THN+L+D++DPIL  +RR  +FNS  DRVKVIFHPEFLSS +PL+PMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFME+H+ DP +YGIYI+DRR+RS +ES  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  + Y      +  +  S   +   RP S P SP 
Sbjct:   29 LFEIAWEVANKVGGIYTVIQTKARLTCEEWGENYFLVGPYMESNVRTQVELIEPCNAALRRTIDKMNSSGCKVYFGRWLIEGSPYVVLLDVGFTAWSLDRWKSELWEKCNIGVPWFDREANDAVLFGFLTAWLLGEYAAQCDEP----PHIVAHFHEWLAGLGLVLCRQRQLPVSTIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYHRYCLERAACRCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSEVTVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQSVKERFGKKLYESLLVGQLPDVSKMLDKEDFTMMKRAIFATQRQCQPPVCTHNMLEDSSDPILNCIRRIGLFNSAQDRVKVIFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRYRSVDESCNQLTSFLFQFCQQSRRQRIIQRNRTERLSDLLDWRYLGRYYVSARHLALAKAYPDTYIY------EPQEPSSAAGFRYPRPASVPPSPA 647          
BLAST of Glycogen [starch] synthase vs. Ensembl Xenopus
Match: wdr90 (WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-5825492])

HSP 1 Score: 790.801 bits (2041), Expect = 0.000e+0
Identity = 384/641 (59.91%), Postives = 477/641 (74.41%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDY--HTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTP 2051
            N  +FE+AWEV NKVGGIYTVI+TKA  T DE G+NY L+GP  E  +RT+V+++E     +  A++ M + G K+ FGRWLI+G P V+L DI ++AW +D WK ELW++  IGIP  D E ND+V+ G L  WFLG F    +++      IIAHFHEWL  VGL  CR R L +AT+FTTHATLLGRYL A + D YNNL  F+VDKEAGDR IYHRYC+ERAA  C+H FTTVSQIT +E+++LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +FI+GHFYGHL+F+LDKTL+FFIAGRYEF NKGAD+F+E+LARLN+ L+   S+ T+VAF I PARTNNFNVE+ + QA+ KQL +T   I+   GK+++E  L GN+P    +L ++D   LKR I++ QR S PPI THN+LDD+ D IL  +RR  +FNS SDRVKVIFHPEFLSS NPL+PMD EEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFME+H+ DP +YGIYI DRR RS +ES  QLT+++  FSQ +RRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  F Y  H P         + + +   RP S P SP+ S  S+P
Sbjct:   26 NSILFEVAWEVANKVGGIYTVIQTKAKVTTDEWGENYFLIGPYFENNVRTQVELIEPTHPAIKRALDSMNAKGCKVYFGRWLIEGSPYVILIDIAATAWNLDRWKTELWDSCDIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEEKPF----IIAHFHEWLAGVGLCLCRIRKLPVATIFTTHATLLGRYLCAGNVDFYNNLQSFNVDKEAGDRQIYHRYCMERAAVQCSHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKGRIQEFIRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNHSETTIVAFFIMPARTNNFNVETLKGQAVRKQLCDTANTIKEKFGKKLYESLLVGNLPDMNKMLDKEDFTMLKRAIFATQRHSFPPICTHNMLDDSTDAILNTIRRIGLFNSSSDRVKVIFHPEFLSSTNPLLPMDNEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPTAYGIYIQDRRFRSVDESCTQLTSFLYSFSQQTRRQRIIQRNRTERLSDLLDWKYLGRYYTYARHMALAKAFPDNFTYEPHEPT--------AAQGFRYPRPASVPPSPSLSRHSSP 654          
BLAST of Glycogen [starch] synthase vs. Ensembl Xenopus
Match: wdr90 (WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-5825492])

HSP 1 Score: 790.801 bits (2041), Expect = 0.000e+0
Identity = 383/639 (59.94%), Postives = 476/639 (74.49%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTP 2051
            N  +FE+AWEV NKVGGIYTVI+TKA  T DE G+NY L+GP  E  +RT+V+++E     +  A++ M + G K+ FGRWLI+G P V+L DI ++AW +D WK ELW++  IGIP  D E ND+V+ G L  WFLG F    +++      IIAHFHEWL  VGL  CR R L +AT+FTTHATLLGRYL A + D YNNL  F+VDKEAGDR IYHRYC+ERAA  C+H FTTVSQIT +E+++LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +FI+GHFYGHL+F+LDKTL+FFIAGRYEF NKGAD+F+E+LARLN+ L+   S+ T+VAF I PARTNNFNVE+ + QA+ KQL +T   I+   GK+++E  L GN+P    +L ++D   LKR I++ QR S PPI THN+LDD+ D IL  +RR  +FNS SDRVKVIFHPEFLSS NPL+PMD EEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFME+H+ DP +YGIYI DRR RS +ES  QLT+++  FSQ +RRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  F Y       E    + + +   RP S P SP+ S  S+P
Sbjct:   26 NSILFEVAWEVANKVGGIYTVIQTKAKVTTDEWGENYFLIGPYFENNVRTQVELIEPTHPAIKRALDSMNAKGCKVYFGRWLIEGSPYVILIDIAATAWNLDRWKTELWDSCDIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEEKPF----IIAHFHEWLAGVGLCLCRIRKLPVATIFTTHATLLGRYLCAGNVDFYNNLQSFNVDKEAGDRQIYHRYCMERAAVQCSHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKGRIQEFIRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNHSETTIVAFFIMPARTNNFNVETLKGQAVRKQLCDTANTIKEKFGKKLYESLLVGNLPDMNKMLDKEDFTMLKRAIFATQRHSFPPICTHNMLDDSTDAILNTIRRIGLFNSSSDRVKVIFHPEFLSSTNPLLPMDNEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPTAYGIYIQDRRFRSVDESCTQLTSFLYSFSQQTRRQRIIQRNRTERLSDLLDWKYLGRYYTYARHMALAKAFPDNFTY-------EPHEPTAQGFRYPRPASVPPSPSLSRHSSP 653          
BLAST of Glycogen [starch] synthase vs. Ensembl Xenopus
Match: wdr90 (WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-5825492])

HSP 1 Score: 790.801 bits (2041), Expect = 0.000e+0
Identity = 384/641 (59.91%), Postives = 477/641 (74.41%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDY--HTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTP 2051
            N  +FE+AWEV NKVGGIYTVI+TKA  T DE G+NY L+GP  E  +RT+V+++E     +  A++ M + G K+ FGRWLI+G P V+L DI ++AW +D WK ELW++  IGIP  D E ND+V+ G L  WFLG F    +++      IIAHFHEWL  VGL  CR R L +AT+FTTHATLLGRYL A + D YNNL  F+VDKEAGDR IYHRYC+ERAA  C+H FTTVSQIT +E+++LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +FI+GHFYGHL+F+LDKTL+FFIAGRYEF NKGAD+F+E+LARLN+ L+   S+ T+VAF I PARTNNFNVE+ + QA+ KQL +T   I+   GK+++E  L GN+P    +L ++D   LKR I++ QR S PPI THN+LDD+ D IL  +RR  +FNS SDRVKVIFHPEFLSS NPL+PMD EEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFME+H+ DP +YGIYI DRR RS +ES  QLT+++  FSQ +RRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  F Y  H P         + + +   RP S P SP+ S  S+P
Sbjct:   26 NSILFEVAWEVANKVGGIYTVIQTKAKVTTDEWGENYFLIGPYFENNVRTQVELIEPTHPAIKRALDSMNAKGCKVYFGRWLIEGSPYVILIDIAATAWNLDRWKTELWDSCDIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEEKPF----IIAHFHEWLAGVGLCLCRIRKLPVATIFTTHATLLGRYLCAGNVDFYNNLQSFNVDKEAGDRQIYHRYCMERAAVQCSHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKGRIQEFIRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNHSETTIVAFFIMPARTNNFNVETLKGQAVRKQLCDTANTIKEKFGKKLYESLLVGNLPDMNKMLDKEDFTMLKRAIFATQRHSFPPICTHNMLDDSTDAILNTIRRIGLFNSSSDRVKVIFHPEFLSSTNPLLPMDNEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPTAYGIYIQDRRFRSVDESCTQLTSFLYSFSQQTRRQRIIQRNRTERLSDLLDWKYLGRYYTYARHMALAKAFPDNFTYEPHEPT--------AAQGFRYPRPASVPPSPSLSRHSSP 654          
BLAST of Glycogen [starch] synthase vs. Ensembl Xenopus
Match: wdr90 (WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-5825492])

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 384/641 (59.91%), Postives = 476/641 (74.26%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDY--HTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTP 2051
            N  +FE+AWEV NKVGGIYTVI+TKA  T DE G+NY L+GP  E  +RT+V+++E     +  A++ M + G K+ FGRWLI+G P V+L DI ++AW +D WK ELW++  IGIP  D E ND+V+ G L  WFLG F    +++      IIAHFHEWL  VGL  CR R L +AT+FTTHATLLGRYL A + D YNNL  F+VDKEAGDR IYHRYC+ERAA  C+H FTTVSQIT +E+++LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +FI+GHFYGHL+F+LDKTL+FFIAGRYEF NKGAD+F+E+LARLN+ L+   S+ T+VAF I PARTNNFNVE+ + QA+ KQL +T   I+   GK+++E  L GN+P    +L ++D   LKR I++ QR S PPI THN+LDD+ D IL  +RR  +FNS SDRVKVIFHPEFLSS NPL+PMD EEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFME+H+ DP +YGIYI DRR RS +ES  QLT+++  FSQ +RRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  F Y  H P +           +   RP S P SP+ S  S+P
Sbjct:   26 NSILFEVAWEVANKVGGIYTVIQTKAKVTTDEWGENYFLIGPYFENNVRTQVELIEPTHPAIKRALDSMNAKGCKVYFGRWLIEGSPYVILIDIAATAWNLDRWKTELWDSCDIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEEKPF----IIAHFHEWLAGVGLCLCRIRKLPVATIFTTHATLLGRYLCAGNVDFYNNLQSFNVDKEAGDRQIYHRYCMERAAVQCSHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKGRIQEFIRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNHSETTIVAFFIMPARTNNFNVETLKGQAVRKQLCDTANTIKEKFGKKLYESLLVGNLPDMNKMLDKEDFTMLKRAIFATQRHSFPPICTHNMLDDSTDAILNTIRRIGLFNSSSDRVKVIFHPEFLSSTNPLLPMDNEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPTAYGIYIQDRRFRSVDESCTQLTSFLYSFSQQTRRQRIIQRNRTERLSDLLDWKYLGRYYTYARHMALAKAFPDNFTYEPHEPTA----------GFRYPRPASVPPSPSLSRHSSP 652          
BLAST of Glycogen [starch] synthase vs. Ensembl Xenopus
Match: wdr90 (WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-5825492])

HSP 1 Score: 771.541 bits (1991), Expect = 0.000e+0
Identity = 375/627 (59.81%), Postives = 466/627 (74.32%), Query Frame = 3
Query:  177 VGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDY--HTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTP 2051
            VGGIYTVI+TKA  T DE G+NY L+GP  E  +RT+V+++E     +  A++ M + G K+ FGRWLI+G P V+L DI ++AW +D WK ELW++  IGIP  D E ND+V+ G L  WFLG F    +++      IIAHFHEWL  VGL  CR R L +AT+FTTHATLLGRYL A + D YNNL  F+VDKEAGDR IYHRYC+ERAA  C+H FTTVSQIT +E+++LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +FI+GHFYGHL+F+LDKTL+FFIAGRYEF NKGAD+F+E+LARLN+ L+   S+ T+VAF I PARTNNFNVE+ + QA+ KQL +T   I+   GK+++E  L GN+P    +L ++D   LKR I++ QR S PPI THN+LDD+ D IL  +RR  +FNS SDRVKVIFHPEFLSS NPL+PMD EEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFME+H+ DP +YGIYI DRR RS +ES  QLT+++  FSQ +RRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  F Y  H P         + + +   RP S P SP+ S  S+P
Sbjct:   33 VGGIYTVIQTKAKVTTDEWGENYFLIGPYFENNVRTQVELIEPTHPAIKRALDSMNAKGCKVYFGRWLIEGSPYVILIDIAATAWNLDRWKTELWDSCDIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEEKPF----IIAHFHEWLAGVGLCLCRIRKLPVATIFTTHATLLGRYLCAGNVDFYNNLQSFNVDKEAGDRQIYHRYCMERAAVQCSHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKGRIQEFIRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNHSETTIVAFFIMPARTNNFNVETLKGQAVRKQLCDTANTIKEKFGKKLYESLLVGNLPDMNKMLDKEDFTMLKRAIFATQRHSFPPICTHNMLDDSTDAILNTIRRIGLFNSSSDRVKVIFHPEFLSSTNPLLPMDNEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPTAYGIYIQDRRFRSVDESCTQLTSFLYSFSQQTRRQRIIQRNRTERLSDLLDWKYLGRYYTYARHMALAKAFPDNFTYEPHEPT--------AAQGFRYPRPASVPPSPSLSRHSSP 647          
BLAST of Glycogen [starch] synthase vs. Ensembl Mouse
Match: Gys1 (glycogen synthase 1, muscle [Source:MGI Symbol;Acc:MGI:101805])

HSP 1 Score: 808.52 bits (2087), Expect = 0.000e+0
Identity = 392/662 (59.21%), Postives = 493/662 (74.47%), Query Frame = 3
Query:   93 EDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSP 2078
            ED F    DPE   N  +FE+AWEV NKVGGIYTV++TKA  T DE GDNY L+GP  E  +RT+V++LE P+  L   ++ M S G K+ FGRWLI+G PLVVL D+G+SAW ++ WK ELW+  +IG+P  D E ND+V+ G L TWFLG F      E   Y  ++AHFHEWL  VGL  CR R L +AT+FTTHATLLGRYL A + D YNNL  F+VDKEAG+R IYHRYC+ERAAAHC H FTTVSQIT +E+Q+LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +F++GHFYGHL+F+LDKTLYFFIAGRYEF NKGAD+F+E+LARLN+ L+   S+ TVVAF I PARTNNFNVE+ + QA+ KQL +T   ++   G++++E  L G++P    +L ++D   +KR I++ QRQS PP+ THN+LDD++DPIL  +RR  +FNS +DRVKVIFHPEFLSS +PL+P+DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFME+H+ DP +YGIYI+DRR RS ++S  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  F Y  P  +D +     + +   RP S P SP+ S  S+P        P
Sbjct:   19 EDEF----DPE---NAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYYLVGPYTEQGVRTQVELLEPPTPELKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQ--NEEKPY--VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALAKAFPDHFTYE-PHEVDAT-----QGYRYPRPASVPPSPSLSRHSSPHQSEDEEEP 663          
BLAST of Glycogen [starch] synthase vs. Ensembl Mouse
Match: Gys2 (glycogen synthase 2 [Source:MGI Symbol;Acc:MGI:2385254])

HSP 1 Score: 763.837 bits (1971), Expect = 0.000e+0
Identity = 367/611 (60.07%), Postives = 462/611 (75.61%), Query Frame = 3
Query:  144 VFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRF 1976
            +FE++WEV NKVGGI TVI+TKA TT DE G+NY L+GP  E  M+T+V+  E  +  +  A++ M  HG ++ FGRWLI+G P VVLFDI SSAW +D WK + WEA  +GIP  D E ND +I G L  WFL     + D +H     +IA FHEW    GLI  R R L IATVFTTHATLLGRYL A++ D YN L KFD+DKEAG+R IYHRYC+ERA+ HC H FTTVS+IT +E++++L RK DV+TPNGLNV KF+A+HEFQN HA  K +I  F++GHFYGHL+FDL+KTL+ FIAGRYEF NKGAD+F+ESL+RLN  L+  KS+VTVV F I PA+TNNFNVE+ + QA+ KQL +TV  ++   GK++++  L+G +P    +L +DD+  +KR I+S QRQSLPP++THN++DD+ DPIL  +RR  +FN+R+DRVKVI HPEFLSS +PL+PMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCF+++HV DP +YGIYIVDRR RS ++S  QLT ++  F + SRRQRI+ RNRTERLS+LLDW  LG YY+ +R + LS+  P  F +  P S   +D F
Sbjct:   30 LFEVSWEVTNKVGGICTVIQTKAKTTADEWGENYFLIGPYFEHNMKTQVEQCEPTNDAVRKAVDAMNKHGCQVHFGRWLIEGSPYVVLFDISSSAWNLDRWKGDFWEACGVGIPHHDREANDMLIFGSLTAWFLKEVTDHADGKH-----VIAQFHEWQAGTGLILSRARKLPIATVFTTHATLLGRYLCAANIDFYNQLDKFDIDKEAGERQIYHRYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYKARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSNVTVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTVHCLKEKFGKKLYDGLLRGEIPDMNSILDRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRADRVKVILHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFVQEHVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYLGRYYQHARHLTLSRAFPDKF-HLEPTSPPTTDGF 634          
BLAST of Glycogen [starch] synthase vs. Ensembl Mouse
Match: Gys1 (glycogen synthase 1, muscle [Source:MGI Symbol;Acc:MGI:101805])

HSP 1 Score: 641.728 bits (1654), Expect = 0.000e+0
Identity = 305/495 (61.62%), Postives = 383/495 (77.37%), Query Frame = 3
Query:  594 IIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSP 2078
            ++AHFHEWL  VGL  CR R L +AT+FTTHATLLGRYL A + D YNNL  F+VDKEAG+R IYHRYC+ERAAAHC H FTTVSQIT +E+Q+LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +F++GHFYGHL+F+LDKTLYFFIAGRYEF NKGAD+F+E+LARLN+ L+   S+ TVVAF I PARTNNFNVE+ + QA+ KQL +T   ++   G++++E  L G++P    +L ++D   +KR I++ QRQS PP+ THN+LDD++DPIL  +RR  +FNS +DRVKVIFHPEFLSS +PL+P+DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFME+H+ DP +YGIYI+DRR RS ++S  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  F Y  P  +D +     + +   RP S P SP+ S  S+P        P
Sbjct:  111 VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALAKAFPDHFTYE-PHEVDAT-----QGYRYPRPASVPPSPSLSRHSSPHQSEDEEEP 599          
BLAST of Glycogen [starch] synthase vs. Ensembl Mouse
Match: Gys1 (glycogen synthase 1, muscle [Source:MGI Symbol;Acc:MGI:101805])

HSP 1 Score: 213.772 bits (543), Expect = 3.580e-64
Identity = 106/148 (71.62%), Postives = 125/148 (84.46%), Query Frame = 3
Query: 1497 IFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDY 1940
            IFHPEFLSS +PL+P+DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFME+H+ DP +YGIYI+DRR RS ++S  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  F Y
Sbjct:    2 IFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALAKAFPDHFTY 149          
BLAST of Glycogen [starch] synthase vs. UniProt/SwissProt
Match: sp|Q9VFC8|GYS_DROME (Glycogen [starch] synthase OS=Drosophila melanogaster OX=7227 GN=GlyS PE=1 SV=2)

HSP 1 Score: 832.787 bits (2150), Expect = 0.000e+0
Identity = 402/644 (62.42%), Postives = 504/644 (78.26%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSG-PLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRG---NIDKEHGKYTP-IIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTP 2051
            NR+ FE+AWEV NKVGGIYTVI++KA  + +E+G+   +MGP  E C RTE++ +E P G PL +A+N +RS G KI  GRWL+DG P ++LFDIGS+AW++D +K E+WE  HIGIP  D E ND++ILG ++  FL  FR       + +    P I+AHFHEW   VGLI  RTR ++IATVFTTHATLLGRYL A + D YNNL KF VD+EAG R IYHRYCLER A H  H FTTVS+IT  E+++LL RK D+ITPNGLNV KF+A+HEFQN HA AKEKI++F++GHFYGH++FDLDKTLYFFIAGRYEF NKGAD+FIE+LARLN  LK  K D TVVAFLIFP +TNNFNV+S R  A+ KQLR+T+ ++Q  +GKR+F+ CL+GN+P   D+LQ+DD++K+KRC+++ QR S+PP++THNV DD NDP+L ++RRC +FNSR DRVK++FHPEFL+S NPL  +DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFME+H+ DPKSYGIYIVDRR+   E SV+QL+++MM+FS+ +RRQRI+ RNRTERLS+LLDW  LG YY+++R+ AL    P   DY   +SL      S+ +   SRP+S P SPT+S  +TP
Sbjct:   48 NRWNFEVAWEVANKVGGIYTVIRSKAYVSTEEMGEQLCMMGPYKEHCARTEMEEMEFPRGNPLLDAVNSLRSRGYKIHTGRWLVDGNPQLILFDIGSAAWKLDQFKSEMWEKCHIGIPHLDIETNDAIILGFMIAEFLEEFRNFAVTYSQNNELSAPRIVAHFHEWQAGVGLIVLRTRLVEIATVFTTHATLLGRYLCAGNTDFYNNLDKFAVDEEAGKRQIYHRYCLERGATHLAHVFTTVSEITGYEAEHLLKRKPDIITPNGLNVKKFSAIHEFQNLHAVAKEKINEFVRGHFYGHIDFDLDKTLYFFIAGRYEFGNKGADIFIEALARLNAMLKHEKPDTTVVAFLIFPTKTNNFNVDSLRGHAVIKQLRDTINNVQQAVGKRMFDTCLQGNIPNADDLLQKDDLVKIKRCMFAMQRDSMPPVTTHNVADDWNDPVLSSIRRCHLFNSRHDRVKMVFHPEFLTSTNPLFGIDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHISDPKSYGIYIVDRRYIGLENSVQQLSSFMMEFSRLNRRQRIIQRNRTERLSDLLDWRTLGIYYRQARVKALQAVYP---DYVDELSL----YGSKNNLIFSRPHSEPPSPTSSRHTTP 684          
BLAST of Glycogen [starch] synthase vs. UniProt/SwissProt
Match: sp|P13807|GYS1_HUMAN (Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2)

HSP 1 Score: 811.601 bits (2095), Expect = 0.000e+0
Identity = 387/649 (59.63%), Postives = 489/649 (75.35%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNID-KEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSP 2078
            N  +FE+AWEV NKVGGIYTV++TKA  T DE GDNY L+GP  E  +RT+V++LE P+  L   ++ M S G K+ FGRWLI+G PLVVL D+G+SAW ++ WK ELW+  +IG+P  D E ND+V+ G L TWFLG F    + K H     ++AHFHEWL  VGL  CR R L +AT+FTTHATLLGRYL A + D YNNL  F+VDKEAG+R IYHRYC+ERAAAHC H FTTVSQIT +E+Q+LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +F++GHFYGHL+F+LDKTLYFFIAGRYEF NKGAD+F+E+LARLN+ L+   S+ TVVAF I PARTNNFNVE+ + QA+ KQL +T   ++   G++++E  L G++P    +L ++D   +KR I++ QRQS PP+ THN+LDD++DPIL  +RR  +FNS +DRVKVIFHPEFLSS +PL+P+DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFME+H+ DP +YGIYI+DRR RS ++S  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG YY  +R +ALSK  P  F Y      +E+D  + + +   RP S P SP+ S  S+P        P
Sbjct:   26 NAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPH-----VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEP----NEAD--AAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDP 663          
BLAST of Glycogen [starch] synthase vs. UniProt/SwissProt
Match: sp|Q5R9H0|GYS1_PONAB (Glycogen [starch] synthase, muscle OS=Pongo abelii OX=9601 GN=GYS1 PE=2 SV=1)

HSP 1 Score: 809.675 bits (2090), Expect = 0.000e+0
Identity = 384/648 (59.26%), Postives = 488/648 (75.31%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSP 2078
            N  +FE+AWEV NKVGGIYTV++TKA  T DE G NY L+GP  E  +RT+V++LE P+  L   ++ M S G K+ FGRWLI+G PLVVL D+G+SAW ++ WK ELW+  +IG+P  D E ND+V+ G L TWFLG F    +++      ++AHFHEWL  +GL  CR R L +AT+FTTHATLLGRYL A + D YNNL  F+VDKEAG+R IYHRYC+ERAAAHC H FTTVSQIT +E+QYLL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +F++GHFYGHL+F+LDKTLYFFIAGRYEF NKGAD+F+E+LARLN+ L+   S+ TVVAF I PARTNNFNVE+ + QA+ KQL +T   ++   G++++E  L G++P    +L ++D   +KR I++ QRQS PP+ THN+LDD++DPIL  +RR  +FNS +DRVKVIFHPEFLSS +PL+P+DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFME+H+ DP +YGIYI+DRR RS ++S  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG YY  +R +ALSK  P  F Y      +E+D  + + +   RP S P SP+ S  S+P        P
Sbjct:   26 NAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGANYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEK----LHVVAHFHEWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQYLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALSKAFPEHFTYEP----NEAD--AAQGYRYPRPASVPPSPSLSRHSSPHQSEDEEDP 663          
BLAST of Glycogen [starch] synthase vs. UniProt/SwissProt
Match: sp|A2RRU1|GYS1_RAT (Glycogen [starch] synthase, muscle OS=Rattus norvegicus OX=10116 GN=Gys1 PE=1 SV=1)

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 392/662 (59.21%), Postives = 493/662 (74.47%), Query Frame = 3
Query:   93 EDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSP 2078
            ED F    DPE   N  +FE+AWEV NKVGGIYTV++TKA  T DE GDNY L+GP  E  +RT+V++LE P+  L   ++ M S G K+ FGRWLI+G PLVVL D+G+SAW ++ WK ELW+  +IG+P  D E ND+V+ G L TWFLG F      E   Y  ++AHFHEWL  VGL  CR R L +AT+FTTHATLLGRYL A + D YNNL  F+VDKEAG+R IYHRYC+ERAAAHC H FTTVSQIT +E+Q+LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +F++GHFYGHL+F+LDKTLYFFIAGRYEF NKGAD+F+E+LARLN+ L+   S+ TVVAF I PARTNNFNVE+ + QA+ KQL +T   ++   G++++E  L G++P    +L ++D   +KR I++ QRQS PP+ THN+LDD++DPIL  +RR  +FNS +DRVKVIFHPEFLSS +PL+P+DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFME+H+ DP +YGIYI+DRR RS ++S  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  F Y  P  +D +     + +   RP S P SP+ S  S+P        P
Sbjct:   19 EDEF----DPE---NAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYYLVGPYTEQGVRTQVELLEPPTPELKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQ--NEEKPY--VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADIFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALAKAFPDHFTYE-PHEVDAT-----QGYRYPRPASVPPSPSLSRHSSPHQSEDEEEP 663          
BLAST of Glycogen [starch] synthase vs. UniProt/SwissProt
Match: sp|A7MB78|GYS1_BOVIN (Glycogen [starch] synthase, muscle OS=Bos taurus OX=9913 GN=GYS1 PE=2 SV=1)

HSP 1 Score: 809.29 bits (2089), Expect = 0.000e+0
Identity = 387/649 (59.63%), Postives = 488/649 (75.19%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNID-KEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSP 2078
            N  +FE+AWEV NKVGGIYTV++TKA  T DE GDNY L+GP  E  +RT+V++LE P+  L   ++ M S G K+ FGRWLI+G PLVVL D+G+SAW ++ WK ELW+  +IG+P  D E ND+V+ G L TWFLG F    + K H     ++AHFHEWL  VGL  CR R L +AT+FTTHATLLGRYL A + D YNNL  F+VDKEAG+R IYHRYC+ERAAAHC H FTTVSQIT +E+Q+LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +F++GHFYGHL+F+LDKTLYFFIAGRYEF NKGAD+F+E+LARLN+ L+   S+ TVVAF I PARTNNFNVE+ + QA+ KQL +T   ++   G++++E  L G++P    +L ++D   +KR I++ QRQS PP+ THN+LDD++DPIL  +RR  +FNS +DRVKVIFHPEFLSS +PL+P+DYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFME+H+ DP +YGIYI+DRR RS ++S  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  F Y       E+D  + + +   RP S P SP+ S  S+P        P
Sbjct:   26 NTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGDNYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVGASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPH-----VVAHFHEWLAGVGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYHRYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQTVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPEFLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKYLGRYYMSARHMALAKAFPEYFTYEP----HEAD--ATQGYRYPRPASVPPSPSLSRHSSPHQSEDEEEP 663          
BLAST of Glycogen [starch] synthase vs. TrEMBL
Match: A0A5K3EMN3 (Glycogen [starch] synthase OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 1039.25 bits (2686), Expect = 0.000e+0
Identity = 500/709 (70.52%), Postives = 592/709 (83.50%), Query Frame = 3
Query:   36 MQRKNSVGKFLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEH-GKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPIS-LDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSPSLXXXXXXXXXXXXXXXLGLADLAIS 2156
            M R+ SVG+F+KD   NV        ID ++Y  +YVFE+AWEVVNKVGGIYTVI+TKAATT +ELGD Y+L+GPLNE+CMRTEVDI+E  S PL  AI ++R H I ++FGRWLI+GYP V+LFDIGSSAWRIDSWKKELW++ +IGIPV DSECNDS+I G LV WFL  FR  +D E  G   PIIAHFHEWL   GLIF RTR++++AT+FTTHATLLGRYL A+S DLYNNL KFD+DKEAGDRNIYHRYCLERAA +C H+FTTVS+IT LES+YLL R+ D+ITPNGLNV+KFAALHEFQNRHA AK+K+HQFIQGHFYGH +FDLDKTLYFFIAGRYEF+NKGAD+FIE+LARLNHRL+E  SDVTVVAFLIFPA TN+FNV+SFR+QAI KQLR TV DIQ +MG R+FE+CL+G +P G DVLQQ+DI++LKRCIY+ QR +LPPI THN++ D+ D +LCNLRRC++FN+R DRVKVIFHPEFLSS NPL+PMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFME+H+ DP SYGIY+VDRR +S + SVEQLT  + +F QYSRRQR+VLRNRTERLSELLDW NLG YY ++R++AL +Q P LF    P    D  +  S KS+ + RP+SAP SP+AS  S+P   SGR++P+  LEEDEVDEN ER+ELGL  ++I+
Sbjct:    1 MHRRASVGRFIKDIPANVGAWGLDRTIDEDMYKQKYVFEVAWEVVNKVGGIYTVIRTKAATTVEELGDRYVLIGPLNEVCMRTEVDIVEPASEPLKRAIQKLREHDINMVFGRWLIEGYPYVLLFDIGSSAWRIDSWKKELWDSCNIGIPVHDSECNDSLIFGALVAWFLKEFRDELDAESDGVQLPIIAHFHEWLAGSGLIFTRTRHINVATIFTTHATLLGRYLCAASVDLYNNLDKFDLDKEAGDRNIYHRYCLERAAVYCAHAFTTVSKITGLESKYLLQREPDIITPNGLNVVKFAALHEFQNRHAIAKQKLHQFIQGHFYGHYDFDLDKTLYFFIAGRYEFQNKGADIFIEALARLNHRLQEQGSDVTVVAFLIFPAATNSFNVDSFRAQAIVKQLRETVNDIQKDMGTRLFEVCLRGRIPTGEDVLQQEDIVRLKRCIYATQRNNLPPICTHNIVQDSIDLVLCNLRRCRLFNNRYDRVKVIFHPEFLSSTNPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHIEDPASYGIYVVDRRFQSVDASVEQLTRCLHEFCQYSRRQRVVLRNRTERLSELLDWKNLGAYYSRARMVALYRQRPDLFTQPAPKGDSDAEETASAKSFRLCRPFSAPPSPSASRGSSPSRLSGRSTPASTLEEDEVDENTERLELGLQMISIN 709          
BLAST of Glycogen [starch] synthase vs. TrEMBL
Match: A0A158QRZ9 (Glycogen [starch] synthase OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS62 PE=3 SV=1)

HSP 1 Score: 1033.86 bits (2672), Expect = 0.000e+0
Identity = 500/715 (69.93%), Postives = 592/715 (82.80%), Query Frame = 3
Query:   36 MQRKNSVGKFLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEH-GKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNY------MMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPIS-LDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSPSLXXXXXXXXXXXXXXXLGLADLAIS 2156
            M R+ SVG+F+KD   NV        ID ++Y  +YVFE+AWEVVNKVGGIYTVI+TKAATT +ELGD Y+L+GPLNE+CMRTEVDI+E  S PL  AI ++R H I ++FGRWLI+GYP V+LFDIGSSAWRIDSWKKELW++ +IGIPV DSECNDS+I G LV WFL  FR  +D E  G   PIIAHFHEWL   GLIF RTR++++AT+FTTHATLLGRYL A+S DLYNNL KFD+DKEAGDRNIYHRYCLERAA +C H+FTTVS+IT LES+YLL R+ D+ITPNGLNV+KFAALHEFQNRHA AK+K+HQFIQGHFYGH +FDLDKTLYFFIAGRYEF+NKGAD+FIE+LARLNHRL+E  SDVTVVAFLIFPA TN+FNV+SFR+QAI KQLR TV DIQ +MG R+FE+CL+G +P G DVLQQ+DI++LKRCIY+ QR +LPPI THN++ D+ D +LCNLRRC++FN+R DRVKVIFHPEFLSS NPL+PMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFME+H+ DP SYGIY+VDRR +S + SVEQLT        + +F QYSRRQR+VLRNRTERLSELLDW NLG YY ++R++AL +Q P LF    P    D  +  S KS+ + RP+SAP SP+AS  S+P   SGR++P+  LEEDEVDEN ER+ELGL  ++I+
Sbjct:    9 MHRRASVGRFIKDIPANVGAWGLDRTIDEDMYKQKYVFEVAWEVVNKVGGIYTVIRTKAATTVEELGDRYVLIGPLNEVCMRTEVDIVEPASEPLKRAIQKLREHDINMVFGRWLIEGYPYVLLFDIGSSAWRIDSWKKELWDSCNIGIPVHDSECNDSLIFGALVAWFLKEFRDELDAESDGVQLPIIAHFHEWLAGSGLIFTRTRHINVATIFTTHATLLGRYLCAASVDLYNNLDKFDLDKEAGDRNIYHRYCLERAAVYCAHAFTTVSKITGLESKYLLQREPDIITPNGLNVVKFAALHEFQNRHAIAKQKLHQFIQGHFYGHYDFDLDKTLYFFIAGRYEFQNKGADIFIEALARLNHRLQEQGSDVTVVAFLIFPAATNSFNVDSFRAQAIVKQLRETVNDIQKDMGTRLFEVCLRGRIPTGEDVLQQEDIVRLKRCIYATQRNNLPPICTHNIVQDSIDLVLCNLRRCRLFNNRYDRVKVIFHPEFLSSTNPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHIEDPASYGIYVVDRRFQSVDASVEQLTRVRCNFVCLHEFCQYSRRQRVVLRNRTERLSELLDWKNLGAYYSRARMVALYRQRPDLFTQPAPKGDSDAEETASAKSFRLCRPFSAPPSPSASRGSSPSRLSGRSTPASTLEEDEVDENTERLELGLQMISIN 723          
BLAST of Glycogen [starch] synthase vs. TrEMBL
Match: A0A4S2LHS0 (Glycogen [starch] synthase OS=Opisthorchis felineus OX=147828 GN=CRM22_007094 PE=3 SV=1)

HSP 1 Score: 1029.24 bits (2660), Expect = 0.000e+0
Identity = 493/714 (69.05%), Postives = 594/714 (83.19%), Query Frame = 3
Query:   36 MQRKNSVGKFLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDK-EHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESG-----RTSPSLXXXXXXXXXXXXXXXLGLADLAISE 2159
            + R+ S  +  +D F   + ++   +I P++Y  +YVFE AWEVVNKVGGIYTVI+TKAATT +ELGD+Y+L+GPLNEICMRTEVD+ E  +  L   I+ MR H IKI+FGRWLI+GYP VVLFDIGSSAWRIDSWKK+LWE+ +IGIPVQDSECND++I G L+ WFLG F   +++ E     P+IAHFHEWL +VGL+F RTR+LD+ATVFTTHATLLGRYL ASS DLYNNL  FD+DKEAGDRNIYHRYCLERAA HC H FTTVS+IT LES+YLL R+ DVITPNGLNV+KFAALHEFQNRHA AKEK++QFIQGHFYGH +FDLDKTLYFFIAGRYEF+NKGAD+FIE+LARLNH+L + +SDVTVVAFLIFPA+TN+FNV+SFR+QAI KQLR TV  IQ +MG R+FE+CL+G +P G D+L QDDI +LKRCIY+AQR +LPPI THNV+ D  D +LCNLRRCQ+FN R+DRVKVIFHPEFLSS NPL+PMDYE+FVRGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFME+HV DPKSYGIY++DRR ++ E+S++QLT Y+++F QYSRRQRI+LRNRTERLSELLDW NL  YY+++R++AL K  P LF   TP ++   D  SE+S+ +SRPYSAP SP+ SG STP   +G     R+SP+  L+EDEVDE  ER+ELGL+ + + +
Sbjct:   18 LARRPSGIRLSRDGFIENDLNALVQSISPDLYRRKYVFETAWEVVNKVGGIYTVIRTKAATTVEELGDHYVLLGPLNEICMRTEVDVTEPTNEALKRTISAMRQHDIKIVFGRWLIEGYPNVVLFDIGSSAWRIDSWKKDLWESCNIGIPVQDSECNDALIFGALIAWFLGEFCAQLERCEPSPRPPVIAHFHEWLTSVGLVFTRTRHLDVATVFTTHATLLGRYLCASSVDLYNNLPNFDLDKEAGDRNIYHRYCLERAAVHCAHVFTTVSKITGLESKYLLRREPDVITPNGLNVVKFAALHEFQNRHALAKEKLNQFIQGHFYGHYDFDLDKTLYFFIAGRYEFQNKGADVFIEALARLNHQLIQAQSDVTVVAFLIFPAQTNSFNVDSFRAQAIVKQLRETVNSIQGDMGHRLFEVCLRGRIPQGSDILTQDDIYRLKRCIYAAQRNNLPPICTHNVVQDNIDLVLCNLRRCQLFNGRNDRVKVIFHPEFLSSTNPLLPMDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHVEDPKSYGIYVIDRRFQNVEDSIQQLTKYLVEFCQYSRRQRIILRNRTERLSELLDWKNLASYYRRARLMALHKHKPELFS-ATPSAMHNGDSISERSFCLSRPYSAPASPSLSGHSTPLPSAGADGSDRSSPTSHLDEDEVDEATERLELGLSAIGLED 730          
BLAST of Glycogen [starch] synthase vs. TrEMBL
Match: A0A3R7CCK2 (Glycogen [starch] synthase OS=Clonorchis sinensis OX=79923 GN=GlyS PE=3 SV=1)

HSP 1 Score: 1028.85 bits (2659), Expect = 0.000e+0
Identity = 493/714 (69.05%), Postives = 593/714 (83.05%), Query Frame = 3
Query:   36 MQRKNSVGKFLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDK-EHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESG-----RTSPSLXXXXXXXXXXXXXXXLGLADLAISE 2159
            + R+ S  +  +D F   + ++   +I+P++Y  +YVFE AWEVVNKVGGIYTVI+TKAATT +ELGD+Y+L+GPLNEICMRTEVD+ E  +  L   I+ MR H IKI+FGRWLI+GYP VVLFDIGSSAWRIDSWKK+LWE+ +IGIPVQDSECND++I G LV WFLG F   +++ E     P+IAHFHEWL +VGL+F RTR+LD+ATVFTTHATLLGRYL ASS DLYNNL  FD+DKEAGDRNIYHRYCLERAA HC H FTTVS+IT LES+YLL R+ DVITPNGLNV+KFAALHEFQNRHA AKEK++QFIQGHFYGH +FDLDKTLYFFIAGRYEF+NKGAD+FIE+LARLNH+L + +SD+TVVAFLIFPA+TN+FNV+SFR+QAI KQLR TV  IQ +MG R+FE+CL+G +P G D+L QDDI +LKRCIY+AQR +LPPI THNV+ D  D +LCNLRRCQ+FN R+DRVKVIFHPEFLSS NPL+PMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFME+HV DPKSYGIY++DRR ++ E+S++QLT Y+++F QYSRRQRI+LRNRTERLSELLDW NL  YY+++R++AL K  P LF    P +    D  SE+S+ +SRPYSAP SP+ SG STP   +G     R+SP+  L+EDEVDE  ER+ELGL+ + + +
Sbjct:   18 LARRPSGVRLSRDGFIENDLNALVQSINPDLYRRKYVFETAWEVVNKVGGIYTVIRTKAATTVEELGDHYVLLGPLNEICMRTEVDVTEPTNEALKRTISAMRQHDIKIVFGRWLIEGYPNVVLFDIGSSAWRIDSWKKDLWESCNIGIPVQDSECNDALIFGALVAWFLGEFCAQLERCEPSPRPPVIAHFHEWLTSVGLVFTRTRHLDVATVFTTHATLLGRYLCASSVDLYNNLPNFDLDKEAGDRNIYHRYCLERAAVHCAHVFTTVSKITGLESKYLLRREPDVITPNGLNVVKFAALHEFQNRHALAKEKLNQFIQGHFYGHYDFDLDKTLYFFIAGRYEFQNKGADVFIEALARLNHQLIQAQSDITVVAFLIFPAQTNSFNVDSFRAQAIVKQLRETVNSIQGDMGHRLFEVCLRGRIPQGSDILTQDDIYRLKRCIYAAQRNNLPPICTHNVVQDNIDLVLCNLRRCQLFNGRNDRVKVIFHPEFLSSTNPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHVEDPKSYGIYVIDRRFQNVEDSIQQLTKYLVEFCQYSRRQRIILRNRTERLSELLDWKNLASYYRRARLMALHKHKPELFSV-PPSATHNGDSISERSFCLSRPYSAPASPSLSGRSTPLPSAGADGSDRSSPTSHLDEDEVDEATERLELGLSAIGLED 730          
BLAST of Glycogen [starch] synthase vs. TrEMBL
Match: G7Y9P6 (Glycogen [starch] synthase OS=Clonorchis sinensis OX=79923 GN=CLF_103419 PE=3 SV=1)

HSP 1 Score: 1028.47 bits (2658), Expect = 0.000e+0
Identity = 493/714 (69.05%), Postives = 593/714 (83.05%), Query Frame = 3
Query:   36 MQRKNSVGKFLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDK-EHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESG-----RTSPSLXXXXXXXXXXXXXXXLGLADLAISE 2159
            + R+ S  +  +D F   + ++   +I+P++Y  +YVFE AWEVVNKVGGIYTVI+TKAATT +ELGD+Y+L+GPLNEICMRTEVD+ E  +  L   I+ MR H IKI+FGRWLI+GYP VVLFDIGSSAWRIDSWKK+LWE+ +IGIPVQDSECND++I G LV WFLG F   +++ E     P+IAHFHEWL +VGL+F RTR+LD+ATVFTTHATLLGRYL ASS DLYNNL  FD+DKEAGDRNIYHRYCLERAA HC H FTTVS+IT LES+YLL R+ DVITPNGLNV+KFAALHEFQNRHA AKEK++QFIQGHFYGH +FDLDKTLYFFIAGRYEF+NKGAD+FIE+LARLNH+L + +SD+TVVAFLIFPA+TN+FNV+SFR+QAI KQLR TV  IQ +MG R+FE+CL+G +P G D+L QDDI +LKRCIY+AQR +LPPI THNV+ D  D +LCNLRRCQ+FN R+DRVKVIFHPEFLSS NPL+PMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFME+HV DPKSYGIY++DRR ++ E+S++QLT Y+++F QYSRRQRI+LRNRTERLSELLDW NL  YY+++R++AL K  P LF    P +    D  SE+S+ +SRPYSAP SP+ SG STP   +G     R+SP+  L+EDEVDE  ER+ELGL+ + + +
Sbjct:   18 LARRPSGVRLSRDGFIENDLNALVQSINPDLYRRKYVFETAWEVVNKVGGIYTVIRTKAATTVEELGDHYVLLGPLNEICMRTEVDVTEPTNEALKRTISAMRQHDIKIVFGRWLIEGYPNVVLFDIGSSAWRIDSWKKDLWESCNIGIPVQDSECNDALIFGALVAWFLGEFCAQLERCEPSPRPPVIAHFHEWLTSVGLVFTRTRHLDVATVFTTHATLLGRYLCASSVDLYNNLPNFDLDKEAGDRNIYHRYCLERAAVHCAHVFTTVSKITGLESKYLLRREPDVITPNGLNVVKFAALHEFQNRHALAKEKLNQFIQGHFYGHYDFDLDKTLYFFIAGRYEFQNKGADVFIEALARLNHQLIQAQSDITVVAFLIFPAQTNSFNVDSFRAQAIVKQLRETVNSIQGDMGHRLFEVCLRGRIPQGSDILTQDDIYRLKRCIYAAQRNNLPPICTHNVVQDNIDLVLCNLRRCQLFNGRNDRVKVIFHPEFLSSTNPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHVEDPKSYGIYVIDRRFQNVEDSIQQLTKYLVEFCQYSRRQRIILRNRTERLSELLDWKNLASYYRRARLMALHKHKPELFSV-PPSATHNGDSISERSFCLSRPYSAPASPSLSGRSTPLPSAGADGSDRSSPTSHLDEDEVDEATERLELGLSAIGLED 730          
BLAST of Glycogen [starch] synthase vs. Ensembl Cavefish
Match: gys1 (glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-GENE-040426-1243])

HSP 1 Score: 784.637 bits (2025), Expect = 0.000e+0
Identity = 382/631 (60.54%), Postives = 475/631 (75.28%), Query Frame = 3
Query:  144 VFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGP-LGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNI-DKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPT 2030
            +FEIAWEV NKVGGIYTVI+TKA  T +E G+NY L+GP  E  +RT+V+++E P+ P L   I++M S G K+ FGRWLI+G P VVL D+G +AW +D WK ELWE   IG+P  D E ND+V+ G L  W LG +     D  H     I+AHFHEWL  +GL+ CR R L +AT+FTTHATLLGRYL A + D YNNL++F+VDKEAGDR IYHRYCLERAAA C H FTTVSQIT +E+++LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +FI+GHFYGHL+F+LDKT++ FIAGRYEF NKGADLF+E+LARLN+ L+   S+ TV+AF I PARTNNFNVE+ + QA+ KQL +T   ++   GK+++E  L G +P    +L ++D   +KR I++ QRQ LPPI THN+L+D++DPIL  +RR  +FNS  DRVKVIFHPEFLSS +PL+PMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFME+H+ DP SYGIYI+DRR+RS +ES  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG YY  +R +ALSK  P  + Y      +  D  S   +   RP S P SP 
Sbjct:   29 LFEIAWEVANKVGGIYTVIQTKARLTCEEWGENYFLVGPYMESNVRTQVELIE-PTNPVLRRTIDKMNSSGCKVYFGRWLIEGSPYVVLLDVGFTAWSLDRWKSELWENCAIGVPWFDREANDAVLFGFLTAWLLGEYAAQCEDPPH-----ILAHFHEWLAGLGLVLCRQRQLPVATIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYHRYCLERAAARCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKSRIQEFIRGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADLFLEALARLNYLLRVNHSETTVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPEVSKMLDKEDFTMMKRAIFATQRQCLPPICTHNMLEDSSDPILTCIRRIGLFNSSQDRVKVIFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPSSYGIYILDRRYRSVDESCNQLTSFLFQFCQQSRRQRIIQRNRTERLSDLLDWRYLGRYYVSARHMALSKAFPDTYVY------EPHDPTSTSGFRYPRPASVPPSPA 647          
BLAST of Glycogen [starch] synthase vs. Ensembl Cavefish
Match: gys1 (glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-GENE-040426-1243])

HSP 1 Score: 764.222 bits (1972), Expect = 0.000e+0
Identity = 375/631 (59.43%), Postives = 468/631 (74.17%), Query Frame = 3
Query:  144 VFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGP-LGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNI-DKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPT 2030
            +FEIAWEV NKVGGIYTVI+TKA  T +E G+NY L+GP  E  +RT+V+++E P+ P L   I++M S G K+ FGRWLI+G P VVL D+G +AW +D WK ELWE   IG+P  D E ND+V+ G L  W LG +     D  H     I+AHFHEWL  +GL+ CR R L +AT+FTTHATLLGRYL A + D YNNL++F+VDKEAGDR IYHRYCLERAAA C H FTTVSQIT +E+++LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +FI+GHFYGHL+F+LDKT++ FIAGRYEF NKGADLF+E+LARLN+ L+   S+ TV+AF I PARTNNFNVE+ + QA+ KQL +T   ++   GK+++E  L G +P    +L ++D   +KR I++ QRQ LPPI THN+L+D++DPIL  +RR  +FNS  DRVKVIFHPEFLSS +PL+PMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSV+TNLSGFGCFME+H+ DP SYGIYI+DRR+RS +ES  QLT+++  F Q SRRQRI+ RNRTERLS+LLDW  LG   K   +I  S    +   +   + L          +   RP S P SP 
Sbjct:   29 LFEIAWEVANKVGGIYTVIQTKARLTCEEWGENYFLVGPYMESNVRTQVELIE-PTNPVLRRTIDKMNSSGCKVYFGRWLIEGSPYVVLLDVGFTAWSLDRWKSELWENCAIGVPWFDREANDAVLFGFLTAWLLGEYAAQCEDPPH-----ILAHFHEWLAGLGLVLCRQRQLPVATIFTTHATLLGRYLCAGNVDFYNNLAEFNVDKEAGDRQIYHRYCLERAAARCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKSRIQEFIRGHFYGHLDFNLDKTVFLFIAGRYEFSNKGADLFLEALARLNYLLRVNHSETTVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAQTVKERFGKKLYESLLVGQLPEVSKMLDKEDFTMMKRAIFATQRQCLPPICTHNMLEDSSDPILTCIRRIGLFNSSQDRVKVIFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEEHIADPSSYGIYILDRRYRSVDESCNQLTSFLFQFCQQSRRQRIIQRNRTERLSDLLDWRYLGRSEKYGSVIFYSGLIIYFCFF---VCLLGFPPLQTSGFRYPRPASVPPSPA 650          
BLAST of Glycogen [starch] synthase vs. Ensembl Cavefish
Match: gys2 (glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-030826-31])

HSP 1 Score: 701.049 bits (1808), Expect = 0.000e+0
Identity = 339/601 (56.41%), Postives = 425/601 (70.72%), Query Frame = 3
Query:  144 VFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHT 1946
            +FEIAWEV NKVGGIYTVI+TKA  T DE G+N+ ++GP  E   +T+V+  + P+  +  A                                   +DS K    + S                     + ++G  R +++K   K   ++AHFHEW   VGL+  R+R + +ATVFTTHATLLGRYL A +AD YNNL KFD+D+EAG+R IYHRYCLERAA HC+H FTTVSQIT +E+ ++L RK DV+TPNGLNV KF+A+HEFQN H+  K KI +F++GHFYGHL+F+L+KTL+FFIAGRYEF NKGAD+F+ESL+RLN+ L+  KSDVTVV F I PA+TNNFNVES + QA+ KQL +T   ++   GKR++E  L+G +P    +L +DD   +KR I++ QR SLPP++THN+LDD+ DPIL N+RR  +FNSR+DRVKV+FHPEFLSS +PL+PMDYEEFVRGCHLGVFPSYYEPWGYTP ECTVMGIPSVTTNLSGFGCFME+H+ DP +YGIYIVDRR RS +ES  QLT +M  F Q SRRQRIV RNRTERLS+LLDW  LG +Y  +R +ALS+  P  F   T
Sbjct:   30 LFEIAWEVTNKVGGIYTVIQTKAKITVDEWGENFFMIGPYYEHNFKTQVEQCDPPNAAIKAA-----------------------------------MDSIKNNGCQVSQ--------------------SAYIGKLRKDLNKLQDKPN-VVAHFHEWQAGVGLVLSRSRKVPMATVFTTHATLLGRYLCAGNADFYNNLDKFDIDREAGERQIYHRYCLERAAVHCSHVFTTVSQITAVEADHMLHRKPDVVTPNGLNVKKFSAMHEFQNLHSMNKLKIQEFVRGHFYGHLDFNLEKTLFFFIAGRYEFSNKGADIFLESLSRLNYLLRVHKSDVTVVVFFIMPAKTNNFNVESLKGQAVRKQLWDTAQTVKEKFGKRLYEALLRGEIPDMNKILDRDDFTIMKRAIFATQRHSLPPVTTHNMLDDSTDPILSNVRRIGLFNSRNDRVKVVFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFMEEHISDPSAYGIYIVDRRFRSADESCNQLTQFMFSFCQQSRRQRIVQRNRTERLSDLLDWRYLGRFYMHARHLALSRAFPERFKIDT 574          
BLAST of Glycogen [starch] synthase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008981.1 (pep scaffold:Pmarinus_7.0:GL476544:387127:395235:1 gene:ENSPMAG00000008122.1 transcript:ENSPMAT00000008981.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 305.834 bits (782), Expect = 1.026e-98
Identity = 145/238 (60.92%), Postives = 182/238 (76.47%), Query Frame = 3
Query:  891 ADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEP 1604
            AD ITPNGL++ KF+A HEFQN H  +K +I +FI+GHFYGH++FD +KTL+ F AGRYEF NKG DLF+ +  RLN+RL+    DVTVVAFLI PA+TNNFNVE+ + QA+ KQL +T   I+    K+++E  L   +P  G  L  +D+  LKR I+SAQR  LPP+ THN+ DD +DPIL  +RR  +FN+RSDRVKVIFHPEFLSS +PL+PMDY+EFVRGCHLGVFPSYYEP
Sbjct:    1 ADFITPNGLSLKKFSATHEFQN-HVLSKLRIQEFIRGHFYGHIDFDFEKTLFLFTAGRYEFTNKGTDLFLXT--RLNYRLQTKNKDVTVVAFLIMPAQTNNFNVETLKGQAVRKQLWDTANTIKEKFAKKLYESLLMSEIPDIGHCLDGEDVTHLKRAIFSAQRHLLPPVCTHNMQDDNSDPILNTVRRIGLFNNRSDRVKVIFHPEFLSSTSPLLPMDYDEFVRGCHLGVFPSYYEP 235          
BLAST of Glycogen [starch] synthase vs. Ensembl Yeast
Match: GSY1 (Glycogen synthase; expression induced by glucose limitation, nitrogen starvation, environmental stress, and entry into stationary phase; GSY1 has a paralog, GSY2, that arose from the whole genome duplication; relocalizes from nucleus to cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000001911])

HSP 1 Score: 691.419 bits (1783), Expect = 0.000e+0
Identity = 352/668 (52.69%), Postives = 459/668 (68.71%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSG--------PLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYL-SASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMC-------LKGNVPAGGD-VLQQDDIIKLKRCIYSAQRQ--SLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVV--DPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFS---EKSWHMSRPYSAPGSPTASGISTPKLESG 2066
            N  +FE+A EV N+VGGIY+V+K+KA  T  + GDNY L+GPLN+    +EV+ L+            P+   +  MR  G+  ++G WLI+G P V+LF++ S    ++ WK +LW    I  P  D E ND+++LG +V WFLG     +D  H     II HFHEWL  V L  CR + +D+ T+FTTHATLLGRYL +A   D YNNL  FDVD+EAG R IYHRYC+ERAAAH    FTTVSQIT LE+++LL RK D I PNGLNV+KF A+HEFQN HA  K+KI+ F++GHF+G  +FDLD T+YFFIAGRYE++NKGAD+FIESLARLN+RLK   S  TVVAFLI PA+TN+F VE+ +SQAI K L NTV ++  ++GKR+FE         L+  +P   D +L+  + + LK+ + + +R    LPP+ THN+ DDANDPIL  +R  ++FN  SDRVKVIFHPEFL++NNP++ +DY+EFVRGCHLGVFPSYYEPWGYTPAECTVMG+PS+TTN+SGFG +MED +     K YGIYIVDRR +S +ESVEQL +YM +F   +RRQRI  RNRTERLS+LLDW  +G  Y K+R + L +  P  F      ++ +++  +    K + ++RP S PGSP     ST  +  G
Sbjct:    7 NHLLFEVATEVTNRVGGIYSVLKSKAPVTVAQYGDNYTLLGPLNKATYESEVEKLDWEDESIFPEELLPIQKTLMSMREKGVNFVYGNWLIEGAPRVILFELDSVRHFLNEWKADLWSLVGIPSPEHDHETNDAILLGYVVVWFLGEV-SKLDSSHA----IIGHFHEWLAGVALPLCRKKRIDVVTIFTTHATLLGRYLCAAGDVDFYNNLQYFDVDQEAGKRGIYHRYCIERAAAHTADVFTTVSQITALEAEHLLKRKPDGILPNGLNVVKFQAVHEFQNLHALKKDKINDFVRGHFHGCFDFDLDNTVYFFIAGRYEYKNKGADMFIESLARLNYRLKVSGSKKTVVAFLIMPAKTNSFTVEALKSQAIVKSLENTVNEVTASIGKRIFEHTMRYPHNGLESELPTNLDELLKSSEKVLLKKRVLALRRPYGELPPVVTHNMCDDANDPILNQIRHVRLFNDSSDRVKVIFHPEFLNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNVSGFGAYMEDLIETDQAKDYGIYIVDRRFKSPDESVEQLADYMEEFVNKTRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLGLRRAYPEQFKQLVGETISDANMNTLAGGKKFKIARPLSVPGSPKVRSNSTVYMTPG 669          
BLAST of Glycogen [starch] synthase vs. Ensembl Yeast
Match: GSY2 (Glycogen synthase; expression induced by glucose limitation, nitrogen starvation, heat shock, and stationary phase; activity regulated by cAMP-dependent, Snf1p and Pho85p kinases as well as by the Gac1p-Glc7p phosphatase; GSY2 has a paralog, GSY1, that arose from the whole genome duplication; relocalizes from cytoplasm to plasma membrane upon DNA replication stress [Source:SGD;Acc:S000004248])

HSP 1 Score: 677.937 bits (1748), Expect = 0.000e+0
Identity = 353/655 (53.89%), Postives = 455/655 (69.47%), Query Frame = 3
Query:  135 NRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILEC--PSG------PLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSAS-SADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLK-------GNVPAG-GDVLQQDDIIKLKRCIYSAQRQ--SLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVV--DPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDR---FSEKSWHMSRPYSAPGSP 2027
            N  +FE A EV N+VGGIY+V+K+KA  T  +  D+Y L+GPLN+   + EVDIL+   P        P+ +A+  M S G+  ++GRWLI+G P V+LFD+ S     + WK +LW    I  P  D E ND+++LG  V WFLG    ++D +H     I+AHFHEWL  V L  CR R +D+ T+FTTHATLLGRYL AS S D YN L   DVD EAG   IYHRYC+ERAAAH    FTTVSQIT  E+++LL RK D I PNGLNVIKF A HEFQN HA  KEKI+ F++GHF+G  +FDLD TLYFFIAGRYE++NKGAD+FIE+LARLN+RLK   S  TVVAF++ PA+ N+F VE+ + QA  + L NTV ++ T++GKR+F+  ++         +P   G++L+  D + LKR I + +R    LPPI THN++DDAND IL  +R+ Q+FNS SDRVK+IFHPEFL++NNP++ +DY+EFVRGCHLGVFPSYYEPWGYTPAECTVMG+PS+TTN+SGFG +MED +     K YGIYIVDRR ++ +ESVEQL +YM +F + +RRQRI  RNRTERLS+LLDW  +G  Y K+R +AL +  P  F       L++S+       K   ++RP S PGSP
Sbjct:    7 NHLLFETATEVANRVGGIYSVLKSKAPITVAQYKDHYHLIGPLNKATYQNEVDILDWKKPEAFSDEMRPVQHALQTMESRGVHFVYGRWLIEGAPKVILFDLDSVRGYSNEWKGDLWSLVGIPSPENDFETNDAILLGYTVAWFLGEV-AHLDSQHA----IVAHFHEWLAGVALPLCRKRRIDVVTIFTTHATLLGRYLCASGSFDFYNCLESVDVDHEAGRFGIYHRYCIERAAAHSADVFTTVSQITAFEAEHLLKRKPDGILPNGLNVIKFQAFHEFQNLHALKKEKINDFVRGHFHGCFDFDLDNTLYFFIAGRYEYKNKGADMFIEALARLNYRLKVSGSKKTVVAFIVMPAKNNSFTVEALKGQAEVRALENTVHEVTTSIGKRIFDHAIRYPHNGLTTELPTDLGELLKSSDKVMLKRRILALRRPEGQLPPIVTHNMVDDANDLILNKIRQVQLFNSPSDRVKMIFHPEFLNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNVSGFGAYMEDLIETNQAKDYGIYIVDRRFKAPDESVEQLVDYMEEFVKKTRRQRINQRNRTERLSDLLDWKRMGLEYVKARQLALRRGYPDQFRELVGEELNDSNMDALAGGKKLKVARPLSVPGSP 656          
BLAST of Glycogen [starch] synthase vs. Ensembl Nematostella
Match: EDO43220 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZD4])

HSP 1 Score: 787.334 bits (2032), Expect = 0.000e+0
Identity = 369/600 (61.50%), Postives = 471/600 (78.50%), Query Frame = 3
Query:  141 YVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDY 1940
            + FE++WEV NKVGGIYTVI++KAAT+ D  GDNY +MG  N+     EV++ E     +  A+  MR+ G+++ FGRWLI+GYP VVLFDIGS   +++ WK +LWE  HIG+P  D+E NDS++LG LV  F+  FR   D E     P++AHFHEW   VG I  RT+ ++++TVFTTHATLLGRYL A++ D YNNL +FDVDKEAGDR IYHRYCLERAAAH  H FTTVS+IT  E+++LL RK D++ PNGLNV+K+ ALHEFQN HA++KEKI+ F++GHFYGH +FDLDKTLYFF AGRYE+ NKGAD+F+ESLARLN++LK   S+ TVVAFLIFP +TNNFNV+S R QA+ KQL+ TV +IQ  +GKR++E C+KGN+P+G  +L+ DDI++LKRC+  AQ   +PP+ THNVL+DA DPILC++RR Q+FN+R DRVK++FHPEFLS+ NPL+ M+Y EFVRGCHLGVFPSYYEPWGYT AECTVMGIPSVTTNLSGFG FM +HV DP SYGIYIVDRR +  EES+++L+ YM  F   +RRQRI+ RNRTERLSELLDW +L  +Y ++R++ L +  P  +++
Sbjct:   18 FTFEVSWEVANKVGGIYTVIRSKAATSVDIHGDNYCMMGIYNKAQCNMEVEMTEPDMKAMKGALKCMRNKGVQVHFGRWLIEGYPKVVLFDIGSVYHKLNKWKADLWENCHIGLPDGDTEANDSLVLGCLVAQFISEFRSRFDPE----IPVVAHFHEWQAGVGEIMLRTKKVNVSTVFTTHATLLGRYLCAANVDFYNNLERFDVDKEAGDRGIYHRYCLERAAAHAAHVFTTVSRITADEAEHLLKRKPDLVVPNGLNVVKYTALHEFQNLHAKSKEKINDFVRGHFYGHFDFDLDKTLYFFAAGRYEYFNKGADVFLESLARLNYQLKTNNSETTVVAFLIFPTKTNNFNVDSLRGQAVTKQLKETVNEIQDKIGKRIYESCVKGNLPSGESLLEPDDIVRLKRCVLGAQHPEMPPVVTHNVLNDATDPILCHIRRIQLFNTRHDRVKIVFHPEFLSNINPLLAMEYSEFVRGCHLGVFPSYYEPWGYTRAECTVMGIPSVTTNLSGFGRFMAEHVCDPTSYGIYIVDRRFKCAEESIQELSGYMFSFCTMTRRQRIIQRNRTERLSELLDWKSLYRFYARARLLGLHRLEPAKYEH 613          
BLAST of Glycogen [starch] synthase vs. Ensembl Medaka
Match: gys1 (glycogen synthase 1 [Source:NCBI gene;Acc:101155437])

HSP 1 Score: 791.571 bits (2043), Expect = 0.000e+0
Identity = 381/638 (59.72%), Postives = 480/638 (75.24%), Query Frame = 3
Query:  144 VFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDY--HTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTP 2051
            +FEIAWEV NKVGGIYTVI+TKA  T +E G+NY L+GP  E  +RT+V+++E  +  L   I++M S G K+ FGRWLI+G P VVL D+G +AW +D WK ELW+   IG+P  D E ND+V+ G L  W LG F    ++       I+AHFHEWL  +GL+ CR R L +AT+FTTHATLLGRYL A S D YNNLSKF+VDKEAGDR IYHRYCLERAAAHC H FTTVSQIT +E+++LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +F++GHFYGHL+F+LDK L+ FIAGRYEF NKGAD+F+E+LARLN+ L+   SDVTV+AF I PARTNNFNVE+ + QA+ KQL +T   ++   GK+++E  L G +P    +L ++D   +KR I++ QRQS PPI THN+LDD++DPIL ++RR  +FNS +DRVK+IFHPEFLSS +PL+PMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFME+H+ DP +YGIYI+DRR++  +ES  QLT+++  F + SRRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  F Y  H P         S   +   RP S P SP+ S  S+P
Sbjct:   29 LFEIAWEVANKVGGIYTVIQTKARLTAEEWGENYFLVGPYVESNVRTQVELIEPTNPVLKRTIDKMNSSGCKVYFGRWLIEGSPYVVLIDVGFTAWSLDRWKSELWDLGAIGVPWFDREANDAVLFGFLTAWLLGEFAAQSEEP----PHIVAHFHEWLAGLGLVLCRKRQLPVATIFTTHATLLGRYLCAGSVDFYNNLSKFNVDKEAGDRQIYHRYCLERAAAHCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKSRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDVTVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAHTVKERFGKKLYESLLVGQLPDVAKMLDKEDFTIMKRAIFATQRQSQPPICTHNMLDDSSDPILNSVRRIGLFNSSADRVKIIFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRYKGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWRYLGRYYIAARHMALAKAFPDTFIYEPHEPS--------SATGFRYPRPASVPPSPSLSRHSSP 654          
BLAST of Glycogen [starch] synthase vs. Ensembl Medaka
Match: gys2 (glycogen synthase 2 [Source:NCBI gene;Acc:101163866])

HSP 1 Score: 787.719 bits (2033), Expect = 0.000e+0
Identity = 376/636 (59.12%), Postives = 482/636 (75.79%), Query Frame = 3
Query:  144 VFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTP 2051
            +FE+AWEV NKVGGIYTVI++KA  T DE G+NY +MGP  E   +T+V+  E P+  + NA++ +  +G ++ FGRWLI+G P VVLFDIGS+AW +D WK +LW+  HIG+P  D E NDS+ILG L+ WFL     +++ +      II HFHEW    GLI  R+R + +AT+FTTHATLLGRYL A + D YNNL KFD+DKEAG+R IYHRYCLERAA HC+H FTTVSQIT +E+ ++L RK D++TPNGLNV KF+A+HEFQN H+  K +I +F++GHFYGHL+F+LDKTL+FFIAGRYEF NKGAD+F+ESL+RLN+ L+  ++D+TVV F I PA+TNNFNVES + QAI KQL +T   ++   GK++++  LKG++P   ++L +DD   +KR I++ QR SLPP++THN+ DD+ DPIL N+RR  +FNSR+DRVK+IFHPEFLSS +PL+PMDY++FVRGC+LGVFPSYYEPWGYTP ECTVMGIPSVTTNLSGFGCFME+H+ DP +YGIYIVDRR +S EES  QLT +M  F Q SRRQRI+ RNRTERLS+LLDW  LG +Y  +R +ALS+  P  F   T +  +         +   RPYS P SP+AS  STP
Sbjct:   31 LFEVAWEVANKVGGIYTVIQSKAKVTVDEWGENYFMMGPYFEHNFKTQVEGCEPPNAAIRNAMDALIHNGCQVHFGRWLIEGNPFVVLFDIGSAAWNLDRWKGDLWDTCHIGLPFHDREANDSLILGSLIAWFLRELTNHLEGKKN----IICHFHEWQAGPGLILSRSRKIPMATIFTTHATLLGRYLCAGNVDFYNNLDKFDIDKEAGERQIYHRYCLERAAVHCSHVFTTVSQITAVEANHILHRKPDIVTPNGLNVKKFSAMHEFQNLHSINKARIQEFVRGHFYGHLDFNLDKTLFFFIAGRYEFTNKGADIFLESLSRLNYLLRVHRNDMTVVVFFIMPAKTNNFNVESLKGQAIRKQLWDTAHTVKEKFGKKLYDALLKGHIPDMNNILDRDDFTIMKRAIFATQRHSLPPVTTHNMEDDSTDPILSNVRRIGLFNSRNDRVKIIFHPEFLSSTSPLLPMDYDDFVRGCNLGVFPSYYEPWGYTPGECTVMGIPSVTTNLSGFGCFMEEHISDPTAYGIYIVDRRFKSPEESCNQLTQFMFSFCQQSRRQRIIQRNRTERLSDLLDWRYLGRFYVHARQLALSRAFPDKFKMDTILKTE--------GFRYPRPYSVPPSPSASLHSTP 654          
BLAST of Glycogen [starch] synthase vs. Ensembl Medaka
Match: gys1 (glycogen synthase 1 [Source:NCBI gene;Acc:101155437])

HSP 1 Score: 643.654 bits (1659), Expect = 0.000e+0
Identity = 307/488 (62.91%), Postives = 382/488 (78.28%), Query Frame = 3
Query:  594 IIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDY--HTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTP 2051
            I+AHFHEWL  +GL+ CR R L +AT+FTTHATLLGRYL A S D YNNLSKF+VDKEAGDR IYHRYCLERAAAHC H FTTVSQIT +E+++LL RK D++TPNGLNV KF+A+HEFQN HAQ+K +I +F++GHFYGHL+F+LDK L+ FIAGRYEF NKGAD+F+E+LARLN+ L+   SDVTV+AF I PARTNNFNVE+ + QA+ KQL +T   ++   GK+++E  L G +P    +L ++D   +KR I++ QRQS PPI THN+LDD++DPIL ++RR  +FNS +DRVK+IFHPEFLSS +PL+PMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPS++TNLSGFGCFME+H+ DP +YGIYI+DRR++  +ES  QLT+++  F + SRRQRI+ RNRTERLS+LLDW  LG YY  +R +AL+K  P  F Y  H P         S   +   RP S P SP+ S  S+P
Sbjct:  111 IVAHFHEWLAGLGLVLCRKRQLPVATIFTTHATLLGRYLCAGSVDFYNNLSKFNVDKEAGDRQIYHRYCLERAAAHCAHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQSKSRIQEFVRGHFYGHLDFNLDKCLFLFIAGRYEFSNKGADIFLEALARLNYLLRVNHSDVTVIAFFIMPARTNNFNVETLKGQAVRKQLWDTAHTVKERFGKKLYESLLVGQLPDVAKMLDKEDFTIMKRAIFATQRQSQPPICTHNMLDDSSDPILNSVRRIGLFNSSADRVKIIFHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEEHIADPSAYGIYILDRRYKGVDESCNQLTSFLFQFCKQSRRQRIIQRNRTERLSDLLDWRYLGRYYIAARHMALAKAFPDTFIYEPHEPS--------SATGFRYPRPASVPPSPSLSRHSSP 590          
BLAST of Glycogen [starch] synthase vs. Planmine SMEST
Match: SMESG000042473.1 (SMESG000042473.1)

HSP 1 Score: 1448.34 bits (3748), Expect = 0.000e+0
Identity = 709/709 (100.00%), Postives = 709/709 (100.00%), Query Frame = 3
Query:   36 MQRKNSVGKFLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSPSLXXXXXXXXXXXXXXXLGLADLAISEQ 2162
            MQRKNSVGKFLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSPSLELEEDEVDENAERIELGLADLAISEQ
Sbjct:    1 MQRKNSVGKFLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEKSWHMSRPYSAPGSPTASGISTPKLESGRTSPSLELEEDEVDENAERIELGLADLAISEQ 709          
BLAST of Glycogen [starch] synthase vs. Planmine SMEST
Match: SMESG000028231.1 (SMESG000028231.1)

HSP 1 Score: 947.192 bits (2447), Expect = 0.000e+0
Identity = 437/678 (64.45%), Postives = 546/678 (80.53%), Query Frame = 3
Query:   36 MQRKNSVGKFLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLF-DYHTPIS-------LDESDRFSEKSWHMSRPYSAPGSPTASGIS 2045
            + +K S  KF+++   N E  +    +DPEIY  R++FEIAWEVVNKVGGIYTVI+TKA +T  EL D YIL+GP+NE C+R+EVD+ +    P+ N+I+ MRS GI+I+ GRWL++G P V+LFD+ S+   +  WK ELW  + IGIP  D E NDSV+ GGL+ WF+G+FR  +++    Y PII+HFHEWL   GLIF RTR +D ATVF+THATLLGRYLSASS DLYNNL+KF++DKEAGDR IYHRYC+ERAA HC+H+FT VS++T LE+Q+LL RK DVITPNGLN+ +FAA+HEFQN H  AK KI++FIQ HFYG+L+FDL+KT+Y F AGRYEF+NKGAD+FIESLARLN+RLK   SDVTVVAFLIFP +TNNFN+E+FR+QAI KQ+R+TV +IQ N+G R+ + CLKG++P  G V   DD++KLKRC+++AQR SLPPI THNV  D  DPILCNLRRC +FN+R+DRVKVIFHPEF++S NPLI MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFME+H+ DPKSYGIY++DRR +SGEES+ QLT+Y+ +F  YSRRQRI+LRNRTERLSELLDW NL FYYKK+R++++++  PHLF D +  ++       + ++D FSE S+H+ RPYSAP SP+ S  S
Sbjct:   19 LLKKPSKAKFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDKEAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINRFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPILCNLRRCNLFNNRTDRVKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYVIDRRFKSGEESILQLTDYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFYYKKARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEAS 696          
BLAST of Glycogen [starch] synthase vs. Planmine SMEST
Match: SMESG000028231.1 (SMESG000028231.1)

HSP 1 Score: 913.679 bits (2360), Expect = 0.000e+0
Identity = 427/678 (62.98%), Postives = 531/678 (78.32%), Query Frame = 3
Query:   36 MQRKNSVGKFLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNIYHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFAALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKGADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQLRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQSLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPLIPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNRTERLSELLDWYNLGFYYKKSRIIALSKQSPHLF-DYHTPIS-------LDESDRFSEKSWHMSRPYSAPGSPTASGIS 2045
            + +K S  KF+++   N E  +    +DPEIY  R++FEIAWEVVNKVGGIYTVI+TKA +T  EL D YIL+GP+NE C+R+EVD+ +    P+ N+I+ MRS GI+I+ GRWL++G P V+LFD+ S+   +  WK ELW  + IGIP  D E NDSV+ GGL+ WF+G+FR  +++    Y PII+HFHEWL   GLIF RTR +D ATVF+THATLLGRYLSASS DLYNNL+KF++DKEAGDR IYHRYC+ERAA HC+H+FT VS++T LE+Q+LL RK DVITPNGLN+ +FAA+HEFQN H  AK KI++FIQ HFYG+L+FDL+KT+Y F AGRYEF+NKGAD+FIESLARLN+RLK   SDVTVVAFLIFP +TNNFN+E+FR+QAI KQ+R+TV +IQ N+G R+ + CLKG++P  G V   DD++KLKRC+++AQR SLPPI THNV  D  DPILCNLRRC +FN+R+DRVKVIFHPEF++S NPLI MDYEEF RGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFME+H+ DPKSYGIYI                 Y+ +F  YSRRQRI+LRNRTERLSELLDW NL FYYKK+R++++++  PHLF D +  ++       + ++D FSE S+H+ RPYSAP SP+ S  S
Sbjct:   19 LLKKPSKAKFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDKEAGDRQIYHRYCIERAATHCSHTFTCVSKVTGLEAQFLLHRKPDVITPNGLNLQRFAAIHEFQNLHGVAKLKINRFIQNHFYGYLDFDLEKTVYLFTAGRYEFQNKGADMFIESLARLNYRLKIANSDVTVVAFLIFPTQTNNFNIETFRAQAIVKQIRDTVEEIQHNIGLRLVDSCLKGSIPMAGSVFDNDDVMKLKRCVFAAQRFSLPPICTHNVTQDHVDPILCNLRRCNLFNNRTDRVKVIFHPEFITSTNPLIGMDYEEFARGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMEEHLEDPKSYGIYI--------------FYKYLFEFCHYSRRQRIILRNRTERLSELLDWNNLTFYYKKARLLSMARHLPHLFQDKNLAMAAAENSKIISDTDIFSEGSFHLERPYSAPNSPSISEAS 682          
BLAST of Glycogen [starch] synthase vs. Planmine SMEST
Match: SMESG000028231.1 (SMESG000028231.1)

HSP 1 Score: 295.049 bits (754), Expect = 1.449e-93
Identity = 138/243 (56.79%), Postives = 180/243 (74.07%), Query Frame = 3
Query:   36 MQRKNSVGKFLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGLIFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDK 764
            + +K S  KF+++   N E  +    +DPEIY  R++FEIAWEVVNKVGGIYTVI+TKA +T  EL D YIL+GP+NE C+R+EVD+ +    P+ N+I+ MRS GI+I+ GRWL++G P V+LFD+ S+   +  WK ELW  + IGIP  D E NDSV+ GGL+ WF+G+FR  +++    Y PII+HFHEWL   GLIF RTR +D ATVF+THATLLGRYLSASS DLYNNL+KF++DK
Sbjct:   19 LLKKPSKAKFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGVFREKMNQYSTFYVPIISHFHEWLTGPGLIFIRTRQIDAATVFSTHATLLGRYLSASSVDLYNNLTKFEIDK 261          
BLAST of Glycogen [starch] synthase vs. Planmine SMEST
Match: SMESG000028231.1 (SMESG000028231.1)

HSP 1 Score: 192.586 bits (488), Expect = 2.262e-56
Identity = 90/172 (52.33%), Postives = 123/172 (71.51%), Query Frame = 3
Query:   36 MQRKNSVGKFLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGGIYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAINEMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIPVQDSECNDSVILGGLVTWFLGL 551
            + +K S  KF+++   N E  +    +DPEIY  R++FEIAWEVVNKVGGIYTVI+TKA +T  EL D YIL+GP+NE C+R+EVD+ +    P+ N+I+ MRS GI+I+ GRWL++G P V+LFD+ S+   +  WK ELW  + IGIP  D E NDSV+ GGL+ WF+G+
Sbjct:   19 LLKKPSKAKFVEEDTINYEGTNIINFVDPEIYNRRFLFEIAWEVVNKVGGIYTVIRTKAKSTCIELVDRYILLGPINETCLRSEVDVCDSDMEPVHNSISAMRSCGIRIVSGRWLVEGNPFVILFDVNSAYGFLGDWKNELWNDTRIGIPNNDQETNDSVVFGGLIAWFIGV 190          
The following BLAST results are available for this feature:
BLAST of Glycogen [starch] synthase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GYS10.000e+059.63glycogen synthase 1 [Source:HGNC Symbol;Acc:HGNC:4... [more]
GYS20.000e+060.94glycogen synthase 2 [Source:HGNC Symbol;Acc:HGNC:4... [more]
GYS11.815e-1861.82glycogen synthase 1 [Source:HGNC Symbol;Acc:HGNC:4... [more]
GYS17.421e-864.15glycogen synthase 1 [Source:HGNC Symbol;Acc:HGNC:4... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gsy-10.000e+060.13Glycogen [starch] synthase [Source:UniProtKB/Swis... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GlyS0.000e+062.42gene:FBgn0266064 transcript:FBtr0083037[more]
GlyS0.000e+062.42gene:FBgn0266064 transcript:FBtr0333276[more]
GlyS0.000e+062.42gene:FBgn0266064 transcript:FBtr0083035[more]
GlyS0.000e+062.42gene:FBgn0266064 transcript:FBtr0083036[more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gys20.000e+062.14glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-0308... [more]
gys20.000e+062.14glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-0308... [more]
gys20.000e+062.14glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-0308... [more]
gys10.000e+058.82glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-... [more]
gys10.000e+058.82glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr900.000e+059.91WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-58... [more]
wdr900.000e+059.94WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-58... [more]
wdr900.000e+059.91WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-58... [more]
wdr900.000e+059.91WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-58... [more]
wdr900.000e+059.81WD repeat domain 90 [Source:Xenbase;Acc:XB-GENE-58... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Gys10.000e+059.21glycogen synthase 1, muscle [Source:MGI Symbol;Acc... [more]
Gys20.000e+060.07glycogen synthase 2 [Source:MGI Symbol;Acc:MGI:238... [more]
Gys10.000e+061.62glycogen synthase 1, muscle [Source:MGI Symbol;Acc... [more]
Gys13.580e-6471.62glycogen synthase 1, muscle [Source:MGI Symbol;Acc... [more]
back to top
BLAST of Glycogen [starch] synthase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VFC8|GYS_DROME0.000e+062.42Glycogen [starch] synthase OS=Drosophila melanogas... [more]
sp|P13807|GYS1_HUMAN0.000e+059.63Glycogen [starch] synthase, muscle OS=Homo sapiens... [more]
sp|Q5R9H0|GYS1_PONAB0.000e+059.26Glycogen [starch] synthase, muscle OS=Pongo abelii... [more]
sp|A2RRU1|GYS1_RAT0.000e+059.21Glycogen [starch] synthase, muscle OS=Rattus norve... [more]
sp|A7MB78|GYS1_BOVIN0.000e+059.63Glycogen [starch] synthase, muscle OS=Bos taurus O... [more]
back to top
BLAST of Glycogen [starch] synthase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3EMN30.000e+070.52Glycogen [starch] synthase OS=Mesocestoides corti ... [more]
A0A158QRZ90.000e+069.93Glycogen [starch] synthase OS=Mesocestoides corti ... [more]
A0A4S2LHS00.000e+069.05Glycogen [starch] synthase OS=Opisthorchis felineu... [more]
A0A3R7CCK20.000e+069.05Glycogen [starch] synthase OS=Clonorchis sinensis ... [more]
G7Y9P60.000e+069.05Glycogen [starch] synthase OS=Clonorchis sinensis ... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gys10.000e+060.54glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-... [more]
gys10.000e+059.43glycogen synthase 1 (muscle) [Source:ZFIN;Acc:ZDB-... [more]
gys20.000e+056.41glycogen synthase 2 [Source:ZFIN;Acc:ZDB-GENE-0308... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008981.11.026e-9860.92pep scaffold:Pmarinus_7.0:GL476544:387127:395235:1... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
GSY10.000e+052.69Glycogen synthase; expression induced by glucose l... [more]
GSY20.000e+053.89Glycogen synthase; expression induced by glucose l... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO432200.000e+061.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
gys10.000e+059.72glycogen synthase 1 [Source:NCBI gene;Acc:10115543... [more]
gys20.000e+059.12glycogen synthase 2 [Source:NCBI gene;Acc:10116386... [more]
gys10.000e+062.91glycogen synthase 1 [Source:NCBI gene;Acc:10115543... [more]
back to top
BLAST of Glycogen [starch] synthase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042473.10.000e+0100.00SMESG000042473.1[more]
SMESG000028231.10.000e+064.45SMESG000028231.1[more]
SMESG000028231.10.000e+062.98SMESG000028231.1[more]
SMESG000028231.11.449e-9356.79SMESG000028231.1[more]
SMESG000028231.12.262e-5652.33SMESG000028231.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031587 ID=SMED30031587|Name=Glycogen [starch] synthase|organism=Schmidtea mediterranea sexual|type=transcript|length=2524bp
ATTAATTATCATTCAAGGTTGTATATGTTTATATTATGCAAAGAAAAAAT
AGCGTTGGAAAATTTTTAAAGGATAAATTCCAAAATGTTGAAGAAGACTC
ATTCAAAGCAAATATTGATCCCGAAATATATGCCAATCGATATGTGTTTG
AAATTGCATGGGAAGTTGTGAATAAAGTTGGTGGCATTTATACTGTGATA
AAAACTAAAGCCGCAACAACAAAAGATGAATTAGGAGATAATTATATTTT
AATGGGTCCGTTGAATGAAATTTGCATGCGTACTGAGGTAGATATCCTTG
AATGCCCATCAGGTCCTCTTGGTAATGCAATTAATGAAATGAGATCTCAT
GGAATAAAGATTATTTTTGGTCGATGGCTAATTGATGGTTATCCTCTCGT
GGTTTTATTTGACATCGGATCGTCTGCATGGAGAATCGATAGTTGGAAAA
AAGAATTATGGGAAGCTAGTCATATTGGAATACCGGTACAAGATAGTGAA
TGCAATGACTCGGTTATTCTTGGTGGCTTGGTTACTTGGTTTTTGGGATT
GTTTAGAGGTAATATCGACAAAGAACATGGAAAATACACACCAATTATTG
CTCATTTTCACGAATGGTTAGTTGCAGTTGGTTTGATTTTTTGCCGAACA
AGAAATTTGGACATTGCAACAGTTTTTACGACACATGCAACCTTGCTTGG
TCGCTATCTTTCAGCGAGTTCTGCAGATCTTTACAATAATCTATCAAAAT
TCGATGTTGATAAAGAGGCGGGAGATCGAAATATATATCATCGATATTGT
TTGGAAAGAGCTGCAGCCCACTGTACACATTCATTTACAACTGTAAGTCA
AATTACGGATTTGGAGAGCCAATATTTGCTCAGTCGAAAAGCGGATGTGA
TAACACCAAACGGCTTGAACGTCATCAAATTTGCTGCTCTTCATGAATTT
CAAAATCGTCACGCTCAAGCCAAAGAGAAAATTCATCAATTTATCCAAGG
TCATTTTTATGGACACCTTAATTTTGACTTGGATAAAACTCTTTATTTCT
TCATTGCTGGTCGTTATGAATTTGAAAATAAAGGAGCAGATTTGTTTATT
GAATCGCTCGCGAGATTAAATCATCGACTTAAGGAATGTAAAAGTGACGT
TACAGTTGTTGCTTTTTTGATTTTTCCAGCCCGAACGAATAATTTTAACG
TTGAATCGTTTCGATCTCAAGCTATAGCTAAACAGCTGAGAAACACTGTA
GTTGATATTCAGACAAACATGGGTAAACGAGTGTTTGAAATGTGTTTGAA
AGGTAATGTACCGGCTGGTGGAGACGTTTTACAACAAGATGATATTATCA
AATTAAAGAGATGTATATATAGCGCTCAGAGACAAAGCTTACCTCCTATT
TCGACTCACAATGTATTAGATGATGCCAATGATCCTATTTTGTGTAATTT
GAGACGTTGTCAAATGTTTAATTCTCGTTCAGATCGTGTTAAAGTTATTT
TTCATCCGGAATTCCTTAGCTCAAATAATCCATTAATTCCAATGGATTAT
GAAGAATTTGTTCGTGGTTGCCATTTAGGGGTTTTCCCATCTTATTACGA
ACCCTGGGGTTACACACCAGCCGAATGTACAGTAATGGGTATTCCATCAG
TTACTACGAATTTGTCTGGGTTCGGTTGCTTCATGGAGGACCATGTAGTT
GATCCGAAATCTTATGGGATTTATATCGTGGATAGAAGACACAGATCAGG
AGAGGAATCAGTTGAACAATTGACTAATTACATGATGGATTTCAGTCAGT
ATTCTCGCCGCCAAAGGATTGTACTGAGAAATCGAACAGAAAGACTCAGT
GAATTACTTGATTGGTATAACCTTGGATTTTATTACAAAAAGAGCAGAAT
TATTGCATTGTCGAAACAATCTCCTCATTTATTCGATTACCATACACCAA
TCTCACTAGATGAAAGTGACAGATTTTCGGAGAAGAGTTGGCATATGAGC
AGGCCATATTCAGCACCTGGTTCTCCAACTGCTTCTGGAATCAGTACACC
AAAATTAGAATCCGGTCGAACATCTCCAAGTCTCGAATTAGAAGAAGACG
AAGTGGACGAAAATGCGGAAAGAATCGAACTGGGTTTAGCTGATTTAGCG
ATATCAGAACAATGATAGGTGTTTGTTCTAGCCAATTAGAAATGAAATAA
AACTAATTTGCAGTGATAAATTATGTGTGTTTCTTGTAGTAATTTCTATT
TCAGTCTGACTAATAGATATGCATGTCATTCGAATCTTTTTCAGATGATG
ACTTTGATGCTATTTTCTGCTACATGACAATGATTTTAGAAATATAAAGT
TTTTTTAGAGTCACATTTGTTAACATTTTTGTAAATTTGTGTTGAAATGT
CTGTGTCAGTGTGTGTGTGGTGATTGCGATAATTGTTGATGATCGTTAAC
CTTTGACTCGTCATTGATAGGTGGCACAGTAAAATACGCTTCATGTACTA
TCAAATGTCATGGATTAAATGAAT
back to top

protein sequence of SMED30031587-orf-1

>SMED30031587-orf-1 ID=SMED30031587-orf-1|Name=SMED30031587-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=710bp
MQRKNSVGKFLKDKFQNVEEDSFKANIDPEIYANRYVFEIAWEVVNKVGG
IYTVIKTKAATTKDELGDNYILMGPLNEICMRTEVDILECPSGPLGNAIN
EMRSHGIKIIFGRWLIDGYPLVVLFDIGSSAWRIDSWKKELWEASHIGIP
VQDSECNDSVILGGLVTWFLGLFRGNIDKEHGKYTPIIAHFHEWLVAVGL
IFCRTRNLDIATVFTTHATLLGRYLSASSADLYNNLSKFDVDKEAGDRNI
YHRYCLERAAAHCTHSFTTVSQITDLESQYLLSRKADVITPNGLNVIKFA
ALHEFQNRHAQAKEKIHQFIQGHFYGHLNFDLDKTLYFFIAGRYEFENKG
ADLFIESLARLNHRLKECKSDVTVVAFLIFPARTNNFNVESFRSQAIAKQ
LRNTVVDIQTNMGKRVFEMCLKGNVPAGGDVLQQDDIIKLKRCIYSAQRQ
SLPPISTHNVLDDANDPILCNLRRCQMFNSRSDRVKVIFHPEFLSSNNPL
IPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFM
EDHVVDPKSYGIYIVDRRHRSGEESVEQLTNYMMDFSQYSRRQRIVLRNR
TERLSELLDWYNLGFYYKKSRIIALSKQSPHLFDYHTPISLDESDRFSEK
SWHMSRPYSAPGSPTASGISTPKLESGRTSPSLELEEDEVDENAERIELG
LADLAISEQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR008631Glycogen_synth
Vocabulary: biological process
TermDefinition
GO:0005978glycogen biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0004373glycogen (starch) synthase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008631Glycogen synthasePFAMPF05693Glycogen_syncoord: 39..673
e-value: 0.0
score: 1055.7
IPR008631Glycogen synthasePANTHERPTHR10176GLYCOGEN SYNTHASEcoord: 25..680
IPR008631Glycogen synthaseCDDcd03793GT3_GSY2-likecoord: 34..627
e-value: 0.0
score: 1107.44
NoneNo IPR availableGENE3DG3DSA:3.40.50.2000coord: 37..625
e-value: 1.7E-258
score: 861.0
NoneNo IPR availableGENE3DG3DSA:3.40.50.2000coord: 295..611
e-value: 1.7E-258
score: 861.0
NoneNo IPR availableGENE3DG3DSA:1.20.20.30coord: 387..467
e-value: 1.7E-258
score: 861.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 658..678
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 652..693
NoneNo IPR availableSUPERFAMILYSSF53756UDP-Glycosyltransferase/glycogen phosphorylasecoord: 505..610
NoneNo IPR availableSUPERFAMILYSSF53756UDP-Glycosyltransferase/glycogen phosphorylasecoord: 179..365