Innexin

Overview
NameInnexin
Smed IDSMED30031582
Length (bp)1641
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Innexin (SMED30031582) t-SNE clustered cells

Violin plots show distribution of expression levels for Innexin (SMED30031582) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Innexin (SMED30031582) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Innexin (SMED30031582) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031582

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30031582SMESG000081749.1 SmedASXL_006305SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30031582SMESG000081749.1 SmedASXL_006307SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031582SMESG000081749.1 dd_Smed_v4_11302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031582SMESG000081749.1 dd_Smed_v4_11302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031582SMESG000081749.1 dd_Smed_v4_11302_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30031582SMESG000081749.1 dd_Smed_v4_10287_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031582SMESG000081749.1 dd_Smed_v4_10287_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031582SMESG000081749.1 dd_Smed_v6_10287_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30031582SMESG000081749.1 dd_Smed_v6_11302_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031582SMESG000081749.1 dd_Smed_v6_10287_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30031582SMESG000081749.1 dd_Smed_v6_11302_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 203.756 bits (517), Expect = 5.221e-60
Identity = 122/379 (32.19%), Postives = 211/379 (55.67%), Query Frame = 1
Query:  391 EDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLED-LFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDF 1524
            +D  DK ++ ++  I+   ++IVS KQY+   I C++P   +    ++Y +NYCWV  T         P    +      +R+I+YYQWVPFVL L+ + FY+P ++W+ +++  SG +++ L   A  A     + R  T+  +A  +ED L +QR V            +S +C  +R   +   LY+ IK+LYL N + Q+ ++ +FL       N  +G+ IL+D+L+G++W  +  FPRV+ C   ++  + + +HH  QC L INM NEKI++FLWFW   V F++ +S+  W+  ++F   +     R     +    D+++ + +FV +FL +DG+F + +IS +AGD++AT+++  LW  +N    KI F
Sbjct:   19 DDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDA-WEQYTENYCWVENTYYLPLTSAFPLEYGD----RRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREV----------TDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFL----GTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDF-EVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWII-ISFLPGQHMKFIRKYLRATDLATDRQS-VKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQF 375          
BLAST of Innexin vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 203.756 bits (517), Expect = 5.221e-60
Identity = 122/379 (32.19%), Postives = 211/379 (55.67%), Query Frame = 1
Query:  391 EDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLED-LFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDF 1524
            +D  DK ++ ++  I+   ++IVS KQY+   I C++P   +    ++Y +NYCWV  T         P    +      +R+I+YYQWVPFVL L+ + FY+P ++W+ +++  SG +++ L   A  A     + R  T+  +A  +ED L +QR V            +S +C  +R   +   LY+ IK+LYL N + Q+ ++ +FL       N  +G+ IL+D+L+G++W  +  FPRV+ C   ++  + + +HH  QC L INM NEKI++FLWFW   V F++ +S+  W+  ++F   +     R     +    D+++ + +FV +FL +DG+F + +IS +AGD++AT+++  LW  +N    KI F
Sbjct:   19 DDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPAQFTDA-WEQYTENYCWVENTYYLPLTSAFPLEYGD----RRARQISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREV----------TDVSGMCVQKRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFL----GTDNLFYGFHILRDLLNGREWEVSGNFPRVTMCDF-EVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWII-ISFLPGQHMKFIRKYLRATDLATDRQS-VKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWHNFNDRVRKIQF 375          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 205.297 bits (521), Expect = 8.598e-60
Identity = 125/387 (32.30%), Postives = 213/387 (55.04%), Query Frame = 1
Query:  358 TAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTK--FPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRM---TXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNK 1503
            +AF+A      +D  DK ++ ++  IL   +++VS KQY+   I C++P   +   +++Y +NYCWV  T      E +P+     I +  +R+I YYQWVPF+L ++ +LFY+P ++W+ ++Y  SG +L+GLV  A  A     EI+  T+  +A+ ++D        GH++  F  L+   +   CGR  G +   LYI IK+LY  N + Q  L+ + L  G + L  A+G+++LKD++   +W    +FPRV+ C   ++  + + + H  QC L INM NEKI++FLWFW +    +T+ +   W+  M   +          R L    A        + +F   FLR DG+F+L +IS +AG+L++++++  LW+ +N 
Sbjct:   69 SAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDELTNIDRQGHSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNN 442          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 205.297 bits (521), Expect = 1.172e-59
Identity = 125/387 (32.30%), Postives = 213/387 (55.04%), Query Frame = 1
Query:  358 TAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTK--FPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRM---TXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNK 1503
            +AF+A      +D  DK ++ ++  IL   +++VS KQY+   I C++P   +   +++Y +NYCWV  T      E +P+     I +  +R+I YYQWVPF+L ++ +LFY+P ++W+ ++Y  SG +L+GLV  A  A     EI+  T+  +A+ ++D        GH++  F  L+   +   CGR  G +   LYI IK+LY  N + Q  L+ + L  G + L  A+G+++LKD++   +W    +FPRV+ C   ++  + + + H  QC L INM NEKI++FLWFW +    +T+ +   W+  M   +          R L    A        + +F   FLR DG+F+L +IS +AG+L++++++  LW+ +N 
Sbjct:   82 SAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDELTNIDRQGHSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNN 455          
BLAST of Innexin vs. Ensembl Celegans
Match: unc-7 (Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q03412])

HSP 1 Score: 204.912 bits (520), Expect = 4.693e-59
Identity = 125/387 (32.30%), Postives = 213/387 (55.04%), Query Frame = 1
Query:  358 TAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTK--FPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRM---TXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNK 1503
            +AF+A      +D  DK ++ ++  IL   +++VS KQY+   I C++P   +   +++Y +NYCWV  T      E +P+     I +  +R+I YYQWVPF+L ++ +LFY+P ++W+ ++Y  SG +L+GLV  A  A     EI+  T+  +A+ ++D        GH++  F  L+   +   CGR  G +   LYI IK+LY  N + Q  L+ + L  G + L  A+G+++LKD++   +W    +FPRV+ C   ++  + + + H  QC L INM NEKI++FLWFW +    +T+ +   W+  M   +          R L    A        + +F   FLR DG+F+L +IS +AG+L++++++  LW+ +N 
Sbjct:  128 SAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDELTNIDRQGHSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNN 501          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 82.4185 bits (202), Expect = 1.033e-16
Identity = 82/294 (27.89%), Postives = 123/294 (41.84%), Query Frame = 1
Query:  463 TKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETL----------PQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVV--SAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILK-DILSGKQWNDNL--LFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMT 1299
            ++QYI   I C +  +  GV     +  YCW++ T  F   E L          P         D  +   YYQWV FVL  Q +LFY+PR +WK+      G  L+ LV+  ++   +++    RK       K L D F+    L    F   R                   + V + L   N I QI  +  FL    S     +G  +LK   L   +  D +  +FP+V+ C             H   C LP+N++NEKIY+FLWFW + +  ++ IS+   +YR+ 
Sbjct:   44 SRQYIGDPIDCIVDEIPLGV-----MDTYCWIYST--FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS----WEGGRLKMLVMDLNSPIVNDECKNDRK-------KILVDYFIGN--LNRHNFYAFR-------------------FFVCEALNFVNVIGQIYFVDFFLDGEFS----TYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIA 291          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 82.4185 bits (202), Expect = 1.033e-16
Identity = 82/294 (27.89%), Postives = 123/294 (41.84%), Query Frame = 1
Query:  463 TKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETL----------PQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVV--SAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILK-DILSGKQWNDNL--LFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMT 1299
            ++QYI   I C +  +  GV     +  YCW++ T  F   E L          P         D  +   YYQWV FVL  Q +LFY+PR +WK+      G  L+ LV+  ++   +++    RK       K L D F+    L    F   R                   + V + L   N I QI  +  FL    S     +G  +LK   L   +  D +  +FP+V+ C             H   C LP+N++NEKIY+FLWFW + +  ++ IS+   +YR+ 
Sbjct:   44 SRQYIGDPIDCIVDEIPLGV-----MDTYCWIYST--FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS----WEGGRLKMLVMDLNSPIVNDECKNDRK-------KILVDYFIGN--LNRHNFYAFR-------------------FFVCEALNFVNVIGQIYFVDFFLDGEFS----TYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIA 291          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 82.4185 bits (202), Expect = 1.033e-16
Identity = 82/294 (27.89%), Postives = 123/294 (41.84%), Query Frame = 1
Query:  463 TKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETL----------PQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVV--SAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILK-DILSGKQWNDNL--LFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMT 1299
            ++QYI   I C +  +  GV     +  YCW++ T  F   E L          P         D  +   YYQWV FVL  Q +LFY+PR +WK+      G  L+ LV+  ++   +++    RK       K L D F+    L    F   R                   + V + L   N I QI  +  FL    S     +G  +LK   L   +  D +  +FP+V+ C             H   C LP+N++NEKIY+FLWFW + +  ++ IS+   +YR+ 
Sbjct:   44 SRQYIGDPIDCIVDEIPLGV-----MDTYCWIYST--FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS----WEGGRLKMLVMDLNSPIVNDECKNDRK-------KILVDYFIGN--LNRHNFYAFR-------------------FFVCEALNFVNVIGQIYFVDFFLDGEFS----TYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIA 291          
BLAST of Innexin vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 82.4185 bits (202), Expect = 1.033e-16
Identity = 82/294 (27.89%), Postives = 123/294 (41.84%), Query Frame = 1
Query:  463 TKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETL----------PQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVV--SAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILK-DILSGKQWNDNL--LFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMT 1299
            ++QYI   I C +  +  GV     +  YCW++ T  F   E L          P         D  +   YYQWV FVL  Q +LFY+PR +WK+      G  L+ LV+  ++   +++    RK       K L D F+    L    F   R                   + V + L   N I QI  +  FL    S     +G  +LK   L   +  D +  +FP+V+ C             H   C LP+N++NEKIY+FLWFW + +  ++ IS+   +YR+ 
Sbjct:   44 SRQYIGDPIDCIVDEIPLGV-----MDTYCWIYST--FTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKS----WEGGRLKMLVMDLNSPIVNDECKNDRK-------KILVDYFIGN--LNRHNFYAFR-------------------FFVCEALNFVNVIGQIYFVDFFLDGEFS----TYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWFIILSIMSGISL---IYRIA 291          
BLAST of Innexin vs. Ensembl Fly
Match: ogre (gene:FBgn0004646 transcript:FBtr0071037)

HSP 1 Score: 79.337 bits (194), Expect = 1.240e-15
Identity = 67/271 (24.72%), Postives = 112/271 (41.33%), Query Frame = 1
Query:  469 QYITADISCYIPVVLSGVDLDKYVKNYCWVHGT--IPFYANETL------PQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQ-----NFLKYGVSKLNAAFGWTILKDILSGKQWNDNL-LFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFW 1239
            QY+   ISC    +++GV     V  +CW+H T  +P      +      P   +++   DA +   YYQWV FVL  Q +  Y P+ +W      L    + GL ++    + +  E +++ +L         +L + V  H  + +       +CC                     N I Q+ LM       FL YG + +        L D+   ++ +  + +FPRV+ C             H + C LP+N++NEK Y+F+WFW
Sbjct:   46 QYVGQPISC----IVNGVP-PHVVNTFCWIHSTFTMPDAFRRQVGREVAHPGVANDFGDEDAKKYYTYYQWVCFVLFFQAMACYTPKFLWNKFEGGLMRMIVMGLNITI--CTREEKEAKRDALLD--------YLIKHVKRHKLYAIRYWACEFLCC--------------------INIIVQMYLMNRFFDGEFLSYGTNIMK-------LSDVPQEQRVDPMVYVFPRVTKCTFHKYGPSGSLQKHDSLCILPLNIVNEKTYVFIWFW 274          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.739e-56
Identity = 125/389 (32.13%), Postives = 214/389 (55.01%), Query Frame = 1
Query:  358 TAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRV--LGHTK--FPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRM---TXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNK 1503
            +AF+A      +D  DK ++ ++  IL   +++VS KQY+   I C++P   +   +++Y +NYCWV  T      E +P+     I +  +R+I YYQWVPF+L ++ +LFY+P ++W+ ++Y  SG +L+GLV  A  A     EI+  T+  +A+ ++D      +   GH++  F  L+   +   CGR  G +   LYI IK+LY  N + Q  L+ + L  G + L  A+G+++LKD++   +W    +FPRV+ C   ++  + + + H  QC L INM NEKI++FLWFW +    +T+ +   W+  M   +          R L    A        + +F   FLR DG+F+L +IS +AG+L++++++  LW+ +N 
Sbjct:  128 SAFRALYPRLDDDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPRE----IYSRRNRQIGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGAN---CGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLL--GSNDL--AYGFSLLKDLMHAIEWEQTGMFPRVTLCDF-EVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRKFTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDFNN 503          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 192.2 bits (487), Expect = 1.611e-54
Identity = 116/370 (31.35%), Postives = 204/370 (55.14%), Query Frame = 1
Query:  391 EDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLED-LFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIY 1497
            +D  DK ++ ++  I+ V +++VS KQY+   I C++P   +   +++Y +NYCWV  T     ++ +P    E      +R+I YYQWVPFVL L+ +LFY+P ++W+ + +  SG  ++ LV  A  +     E R   +  +A  +E+ L ++ +V+   +  +L    +LI C R +G     LYI +K+LY  N + QI L+  FL       +  +G  +L D+++G++W ++  FPRV+ C   ++  + + + H  QC L INM NEKI++FLWFW   +   T+ S+  W+Y      ++ +F+ ++L     Y       + +FV  FLR DG+F+L +++ +AG+L   ++   LW  Y
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPATFTE-PMEQYTENYCWVQNTYFLPLHDYIPHNYAE----RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQ-SGIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMSGNRLKLL----NLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFL----GNRSKWYGLQVLNDLMNGREWEESGHFPRVTLCDF-EVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIEGYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 179.104 bits (453), Expect = 2.332e-49
Identity = 116/373 (31.10%), Postives = 196/373 (52.55%), Query Frame = 1
Query:  391 EDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAF--GWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNK 1503
            +DA D+ S++ +  +L   S++VS KQY+ + I C++P+   G   ++Y ++YC++  T        +P   ++   A+    I YYQWVP VL +Q  +FYLP  IW ++ Y   G D   ++  A+   +Q  E R + + ++   + D+   R    + +F   R        G+  G     LYI IKL+YL N   Q I++  FL       N  F  G+    D+ +G++W D+ +FPRV+ C  S +  + + + +  QC L INM NEKIY+F+WFW V VL  T I+    +YR++F   R ++I+  L       KD+K +I+ F    L+ DG+ ++  I  +AG ++  +I  EL++ + +
Sbjct:   21 DDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKG-GWEQYAEDYCFIQNTFFIPERSEIPGDVEDRQKAE----IGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDILDTRSKNEYGRFYCYR-------FGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLG------NETFLWGFHTFADLYAGREWQDSGVFPRVTLCDFS-VRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDEKAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFKKHGE 373          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23027|INX5_CAEEL (Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx-5 PE=3 SV=2)

HSP 1 Score: 166.777 bits (421), Expect = 1.830e-44
Identity = 104/375 (27.73%), Postives = 199/375 (53.07%), Query Frame = 1
Query:  394 DAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGT--IP-FYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLW--LYRMTXXXXXXXXXXXXXXXXSAYTKDKKNLI-SQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYN 1500
            D AD+ S+ ++  +L   +++++  QY+   I C++P   +    +KY + YC++ GT  +P  +A+E             A+ ++ YYQW+P VL LQ  LFYLP +IW+T  +N S       + +  +AS ++     +  ++  K     F  +++    + PV ++  S++  G+    F  +LY+++K+LYL N + Q  ++  FL+      +  +GW   +D+++G++W    +FPRV+ C  S I  +T  + H  QC + INML EK+Y+F WFW + V  LT+ S+  W  +Y +    +   +       +    +++ + + + FV++ L  DG+FI  ++  N+GDL  + ++ E++ +Y 
Sbjct:   20 DIADRFSYQYTSTLLGFSAIMMAASQYVGRPIQCWVPAQFTRT-WEKYAETYCFIKGTYFLPGAFASEGEMSVTSPDDAVTATPQVGYYQWIPIVLVLQAFLFYLPSIIWRT--FNESCELKIKELAAVSEASRKIKSNMSDDQVKATKFGRYFF--KKLNFRNESPVFKETGSVVASGK----FLPALYLLVKILYLANIVLQFWILTYFLE----TKSWMWGWQTFQDLMAGREWETTGIFPRVTMCDFS-IMDLTSVHDHSIQCVIVINMLAEKVYVFFWFWLLFVGLLTVCSLAYWAVIYMLQSVGRNFIYSYLQQTPEFQTEQERGSFVPANFVDKCLTPDGVFISRLVQQNSGDLFTSIMLGEMFSLYR 380          
BLAST of Innexin vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 157.147 bits (396), Expect = 7.921e-41
Identity = 120/380 (31.58%), Postives = 204/380 (53.68%), Query Frame = 1
Query:  391 EDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQT---KDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFIS-LYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKNL------ISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYN 1500
            +D +D+ ++L +  IL+  SV++S KQ+    I C  P    G   ++Y +NYCW   T  ++   T   +   K+E    D  R+++YYQWVPF L LQ   F  P  +WK    N SG  +  +V  AK ++N   E+R++ IL + + L      +  +   K  V  + ++ +     +G  FIS +Y+  K+LY  N   Q+ LM  FL  G ++ +  +G+ +++DI+ G+ W  +  FPR + C   ++  V +   +  QC L IN+ NEKI++ LWFW V +L  + +S+  W   + F    K F+K+ L + +    +++N       +S+FV Q+L  DG+F+L ++S +AG + ATD+V  L+E Y+
Sbjct:   20 DDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPG-SWEQYAENYCWSQDT--YFVEPTQDVSLLKKEERYTPD--RQLSYYQWVPFFLLLQAAFFRAPSYLWK-YFSNHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKVQV-HKTVTFLNFQYSSG--FISWIYLFTKVLYFLNVFAQLYLMNYFL--GTNR-HHWYGFGVVQDIVQGEPWERSGYFPRAAVCDF-EVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALSTLQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAYD 386          
BLAST of Innexin vs. TrEMBL
Match: Q2L6M5 (Innexin OS=Dugesia japonica OX=6161 GN=inx10 PE=2 SV=1)

HSP 1 Score: 618.231 bits (1593), Expect = 0.000e+0
Identity = 313/415 (75.42%), Postives = 365/415 (87.95%), Query Frame = 1
Query:  334 METFLSQFTAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDK-KNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYISSSNEKSKQTFV 1575
            ME+ L+QF+AF+  KYVGIED ADKASFLFSV IL VCS+I+STKQY+T DISCYIP+V+SG D +K+++NYCWVHGTIPF +NE+LPQTK+EW+ A+ +RKINYYQWVPFVLGLQGVLFYLPRLIW+TIIYNLSGN LEGLVVSA+KA+NQVG+ RKETI Q+AK LEDLFLQRRVLGH KFPVLRQKMSL+CCGRRTG+F +SLY VIK+LYL NAI QI+LMQNFL+ G +KLN AFGWTIL DI+SGKQW +NLLFPR +FCFI DIS V  KNH +AQC LPINMLNEKIYIFLWFWTVGVL LT+ISIPLWL+RMTFF KR+ F+K+FLKIK +Y+K K K L+S FVE+FLRHDGIFILHIISLNAGDLIA D+V+ELW+IY KYY++ DF K  IS  +EK+ Q+FV
Sbjct:    1 MESLLTQFSAFKVEKYVGIEDGADKASFLFSVAILAVCSIIISTKQYVTTDISCYIPIVVSGSDFEKFIRNYCWVHGTIPFRSNESLPQTKEEWMTAEYTRKINYYQWVPFVLGLQGVLFYLPRLIWRTIIYNLSGNHLEGLVVSAQKATNQVGDNRKETIEQIAKSLEDLFLQRRVLGHKKFPVLRQKMSLVCCGRRTGIFLVSLYFVIKILYLINAIGQILLMQNFLRLGTTKLNVAFGWTILHDIISGKQWTENLLFPRTTFCFIGDISLVAVKNHFVAQCTLPINMLNEKIYIFLWFWTVGVLILTLISIPLWLWRMTFFSKRQKFVKKFLKIKCSYSKGKHKELMSHFVERFLRHDGIFILHIISLNAGDLIAADVVTELWQIYTKYYVERDFSKNVISIIDEKTNQSFV 415          
BLAST of Innexin vs. TrEMBL
Match: A0A5J4NXS3 (Innexin OS=Paragonimus westermani OX=34504 GN=inx PE=3 SV=1)

HSP 1 Score: 355.14 bits (910), Expect = 7.625e-114
Identity = 179/389 (46.02%), Postives = 265/389 (68.12%), Query Frame = 1
Query:  343 FLSQFTAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKM----SLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIY 1497
            F+          Y+G+ED ADK SFL+SV++L++C+ +V+ KQY+ + ISCYIP V SG D DK+++N+CWVHGTIPF ++E +PQT DEW   D   +INYYQWVPF+LGLQ +LFY+PR+IW+ I  N +G D+E LV+ A +ASN   + RK+ +  VA  L+++  Q R     K   ++ ++     L+   +R G +    Y ++K+ YL+N++ Q+ LM+ FL +  S  N  FG  +   +++G+ W    +FPR+SFC+++D+  +   N ++AQC LP+NMLNEK+YIFLW+WTV V   T +SIPLW+ R+T F+ R  F+K+FL+I   + K  K+L+ QF EQFLRHDGIF+L +IS+NAGD+I +++VSELW  Y
Sbjct:    6 FIDFLKKLHVPDYIGVEDFADKLSFLYSVLVLMLCTAVVTVKQYLMSAISCYIPTVPSGTDFDKFLENFCWVHGTIPFLSDEPMPQTLDEWAYFDQKYRINYYQWVPFMLGLQCMLFYIPRVIWQVICCNRAGTDIEHLVLVAYQASNSKPDERKQLVSHVASSLKEMLYQHREYRDGKLVEVKNRVFDACGLLVVSKRLGTWLAFTYFIVKVCYLSNSVGQLYLMKRFLGFNASLTN--FGMELAHFMMTGRNWEQTRIFPRISFCYMADLRQLGSTNRYVAQCVLPVNMLNEKLYIFLWYWTVMVSICTALSIPLWMLRLTIFKNRLHFVKKFLRINEQFHKTDKSLLKQFTEQFLRHDGIFLLRMISMNAGDVITSEVVSELWRNY 392          
BLAST of Innexin vs. TrEMBL
Match: H2KV19 (Innexin OS=Clonorchis sinensis OX=79923 GN=inx PE=3 SV=1)

HSP 1 Score: 354.369 bits (908), Expect = 7.901e-114
Identity = 184/387 (47.55%), Postives = 257/387 (66.41%), Query Frame = 1
Query:  343 FLSQFTAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKM----SLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWE 1491
            FL          Y+G+ED ADK SFL+SV++L++C+ IV+ KQY+ + I+CYIP V SG D DK+++N+CWVHGTIP  +NE +PQT DEW   D   +INYYQWVPF+LGLQ +LFY+PR++W+ I  N +G D+E LVV A +ASN     R + +  V   L+ +  Q R   H +    ++++     L+   +R G +    Y VIKLLYLTN++ Q+ LMQ FL +  +  N  FG  +   +LSG+ W    +FPR+SFC+ +D+  +   N ++AQC LP+NMLNEK+YIFLW+WT  V  LT  SIPLWL R+TF + R  FIK+FL+I   + +  K L+  F E FLRHDGIFIL +IS+NAGD+I +++VSELW+
Sbjct:    6 FLDFLNKLHVPDYIGVEDFADKLSFLYSVLVLMLCTTIVTVKQYLMSAIACYIPTVPSGSDFDKFLENFCWVHGTIPLLSNELIPQTMDEWAYFDDKYRINYYQWVPFMLGLQCMLFYIPRIVWQLICCNRTGTDIEHLVVVAHQASNASPTDRSKLVSHVTASLKGMLYQHREYRHGRVLEAKKRLFDACGLLVVSKRLGTWLAFTYFVIKLLYLTNSVGQLYLMQRFLGFNATLTN--FGAKLADYMLSGRNWEQTRIFPRISFCYFADLRQLGSTNRYVAQCVLPVNMLNEKLYIFLWYWTAMVAILTAFSIPLWLMRLTFAKSRVRFIKKFLRINEQFHRSDKQLVKDFTENFLRHDGIFILRMISMNAGDVITSEVVSELWK 390          
BLAST of Innexin vs. TrEMBL
Match: A0A4S2M067 (Innexin OS=Opisthorchis felineus OX=147828 GN=inx PE=3 SV=1)

HSP 1 Score: 352.829 bits (904), Expect = 3.082e-113
Identity = 182/387 (47.03%), Postives = 257/387 (66.41%), Query Frame = 1
Query:  343 FLSQFTAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKM----SLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWE 1491
            F+          Y+G+ED ADK SFL+SV++L++C+ IV+ KQY+ + I+CYIP V SG D DK+++N+CWVHGTIP  +NE +PQT DEW   D   +INYYQWVPF+LGLQ +LFY+PR++W+ I  N +G D+E LVV A +ASN     R + +  V   L+ +  Q R   H +    ++++     L+   +R G +    Y VIKLLYLTN++ Q+ LMQ FL +  +  N  FG  +   +L+G+ W    +FPR+SFC+ +D+  +   N ++AQC LP+NMLNEK+YIFLW+WT  V  LT  SIPLWL R+TF + R  FIK+FL+I   + +  K L+  F E FLRHDGIFIL +IS+NAGD+I +++VSELW+
Sbjct:    6 FIDFLNKLHVPDYIGVEDFADKLSFLYSVLVLMLCTTIVTVKQYLMSAIACYIPTVPSGSDFDKFLENFCWVHGTIPLLSNELIPQTMDEWAYFDDRYRINYYQWVPFMLGLQCMLFYIPRIVWQLICCNRTGTDIEHLVVVAHQASNATTTDRSKLVSHVTASLKGMLYQHREYRHGRVLEAKKRLFDACGLLVVSKRLGTWLAFTYFVIKLLYLTNSVGQLYLMQKFLGFNATLTN--FGAKLADYMLTGRNWEQTRIFPRISFCYFADLRQLGSTNRYVAQCVLPVNMLNEKLYIFLWYWTAMVAILTAFSIPLWLMRLTFAKSRVRFIKKFLRINEQFHRSDKQLVKDFTENFLRHDGIFILRMISMNAGDVITSEVVSELWK 390          
BLAST of Innexin vs. TrEMBL
Match: Q2L6M6 (Innexin OS=Dugesia japonica OX=6161 GN=inx9 PE=2 SV=1)

HSP 1 Score: 352.058 bits (902), Expect = 7.531e-113
Identity = 183/431 (42.46%), Postives = 270/431 (62.65%), Query Frame = 1
Query:  337 ETFLSQFTAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLIC--C--GRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDF-----------------RKKYISSSNEKSKQ 1566
            + FLS    F+   YVG+ED ADK +FLFSV+IL++  ++V+ K Y    ++CYI    SG + D Y++NYCWVHGTI     E +PQT  +W I D +++I YYQWVPF+LGLQ ++FY+PR+IW+ I YN  G +LE L + A  AS+     RK+ I ++ + +ED+  Q R     K   +R+ +  +C  C   +  G + +  YI++K +Y  N I Q+ LM+ FL +  S   ++FG+TIL +I  GK+W+   +FPRV++C+I +I  +   N ++ QCALPINMLNEKIY+FLWFW   V  +T ISIP+W +R+    +R  FIK+FL +  AY +  K LI+ F+ +FLRHDG+F++ +I +NAGD++  DIV+ LWEIY + Y  +DF                 R + ISSS+E  K+
Sbjct:    4 QEFLSLVGQFKLTSYVGVEDFADKLNFLFSVVILIISMMVVTVKSYFFKPLACYIATTPSGSNFDNYLENYCWVHGTISILPGENIPQTDADWAIVDQTKRITYYQWVPFILGLQCIMFYVPRVIWQLICYNKVGTNLESLAIDADAASHSPPSERKDKIERIVRTIEDMLFQHRDYRQGKMADMRRNIYKMCNFCVFSKHMGTWLVLSYILMKFMYGINVIGQLFLMKKFLGFNSSM--SSFGYTILSNIADGKEWHQTGIFPRVTYCYIGEIKHLGASNKYVGQCALPINMLNEKIYVFLWFWVFLVGIITAISIPMWFFRIAILSRRSSFIKKFLMMHQAYNRSDKQLINSFIREFLRHDGVFLIRMICINAGDIVTADIVNRLWEIYKENYKNMDFLNFSAYPKPMDMTTGLRRNQNISSSDESIKK 432          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000081749.1 (SMESG000081749.1)

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 414/414 (100.00%), Postives = 414/414 (100.00%), Query Frame = 1
Query:  334 METFLSQFTAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYISSSNEKSKQTFV 1575
            METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYISSSNEKSKQTFV
Sbjct:    1 METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYISSSNEKSKQTFV 414          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000081749.1 (SMESG000081749.1)

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 373/414 (90.10%), Postives = 393/414 (94.93%), Query Frame = 1
Query:  334 METFLSQFTAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYISSSNEKSKQTFV 1575
            ME+ + +F+ F   KYVG+ED ADKASFLFSV+ILVVC+VIVSTKQYI  +I+CYIP++ +G  L+ Y++NYCW HGTIPF  NETLPQ + +W+ AD  R++NYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYISSSNEKSKQTFV
Sbjct:    1 MESLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDWMQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYISSSNEKSKQTFV 414          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000061679.1 (SMESG000061679.1)

HSP 1 Score: 364.77 bits (935), Expect = 1.542e-121
Identity = 192/403 (47.64%), Postives = 273/403 (67.74%), Query Frame = 1
Query:  334 METFLSQFTAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDL-FLQRRVLGHTKFPVLRQ---KMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 1530
            +  F+   T ++   +VG+ED ADK SF  S  IL++ +++++ K Y+   I+CYIP+  SG D D ++K+YCWVHGTIP   N  LP   + W   D   +INYYQWVPFVL LQG+LFYLPR+IW+ I YNLSG DLEGLV  A  ASNQ G+ + ET+ Q+A  LE+L F  R++  H+K P++ +     S +C  +R+G    + Y+ IK+LY+ NA  Q+ LMQ FL +G      +FG+ +LK+IL G++WND ++FPRV++C++ +I  V  KN+++AQC LPINMLNEKIYIFLWFWTV V+F T IS+  W+YR+T    +  F+K+FL+I+  YT +  +++  F   FLR DG+FIL + S+NAGDLI  DIV+ LW IY + + + +F K
Sbjct:    3 LSEFIDYATKYKWADFVGMEDFADKLSFSISTSILLLLTLVITVKSYLLTSIACYIPIHPSGKDFDDFLKSYCWVHGTIPIKGN--LPPDIESWEKMDEFNRINYYQWVPFVLALQGILFYLPRIIWQMITYNLSGTDLEGLVEMANSASNQTGKAKSETVDQIAMNLENLLFSHRKINLHSK-PIMSKLSTAKSWLCSDKRSGRQLAAQYMFIKVLYVINAFGQLFLMQYFLDFGHK--GTSFGYVVLKNILEGREWNDTMIFPRVTYCYLKNIQHVAIKNNYLAQCVLPINMLNEKIYIFLWFWTVIVVFFTFISLFQWIYRLTQSSSQVHFLKKFLRIREQYTDEDCSVLKSFFRGFLRKDGVFILRMFSINAGDLITADIVTGLWNIYKEKHKEENFSK 400          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000080788.1 (SMESG000080788.1)

HSP 1 Score: 355.91 bits (912), Expect = 6.060e-118
Identity = 185/402 (46.02%), Postives = 265/402 (65.92%), Query Frame = 1
Query:  337 ETFLSQFTAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLIC--C--GRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRK 1530
            E FL+    F+   YVGIED ADK SFLFSV +L++  ++V+ K Y+   ++CY      G + + Y++NYCWVHGTI F   E +PQ   +W  AD +R+INYYQWVPF+LGLQ  +FY+P++IW+ I YN SG +LE +V  A  A+N     RK+ I ++A+ +ED+  Q R      F  LR+K+   C  C   +  G + I  YI+IK LY  N I Q+ +M+ FL  G +   ++FG+T+L +++SGK+W+   +FPRV++C++ +I  V   N ++AQCALP+NMLNEKIY+FLWFW V V  +T ISIPLW YRM F  +R  FIKRFL +   Y +  K +I+ F+E+FLRHDG+F++ ++ +NAGD+I  DIV+ L EIY + Y  +DFR 
Sbjct:    4 EEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCFMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKIYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFL--GFNNSTSSFGYTVLSNMISGKEWHQTGIFPRVTYCYVRNIKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQNYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYKENYKHLDFRN 403          
BLAST of Innexin vs. Planmine SMEST
Match: SMESG000065083.1 (SMESG000065083.1)

HSP 1 Score: 310.457 bits (794), Expect = 3.840e-100
Identity = 182/417 (43.65%), Postives = 258/417 (61.87%), Query Frame = 1
Query:  343 FLSQFTAFQAGKYVGIEDAADKASFLFXXXXXXXXXXXXXTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKM----SLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLN-AAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHK---NHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTXXXXXXXXXXXXXXXXSAYTKDKKN--LISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKKYISSSNEKSK 1563
            FL   +  Q    VG+ED  D+ +F FSVI+L+VC +IV+ KQY+   ISCY+P  + G +L  YV+N CWV GTI        P T +EW   +   K+ YYQWVPF+LGLQ ++FY+P+L+W+ I YN +G D++ LVVSA +A +   E R + +  ++K LE L  Q R     K    R+K+      + C +R G + +S Y+++KL Y+ N   Q+I+MQ FL  G S  N   FG  +  +I SG  W   L+FPRVS+CF+     VTH    N  +AQC LP+NMLNE+IY FLW W + VL LTI+SIP+W+ R+   + R+ FI++FL I    TKD+K   L+++F  QFLRHDGIF+L +ISLNAGD+I ++IV +LW IY   Y+  +F        ++KS+
Sbjct:    6 FLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLE-KHKMLYYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFL--GFSDFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFVK----VTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYRRHFIRQFLIISEEITKDQKENYLLAKFESQFLRHDGIFLLKMISLNAGDIITSEIVCQLWNIYKTNYVNRNFLNDGSDEDDDKSR 415          
The following BLAST results are available for this feature:
BLAST of Innexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-15.221e-6032.19Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-15.221e-6032.19Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
unc-78.598e-6032.30Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
unc-71.172e-5932.30Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
unc-74.693e-5932.30Innexin unc-7 [Source:UniProtKB/Swiss-Prot;Acc:Q0... [more]
back to top
BLAST of Innexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx21.033e-1627.89gene:FBgn0027108 transcript:FBtr0301860[more]
Inx21.033e-1627.89gene:FBgn0027108 transcript:FBtr0071005[more]
Inx21.033e-1627.89gene:FBgn0027108 transcript:FBtr0332314[more]
Inx21.033e-1627.89gene:FBgn0027108 transcript:FBtr0071006[more]
ogre1.240e-1524.72gene:FBgn0004646 transcript:FBtr0071037[more]
back to top
BLAST of Innexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q03412|UNC7_CAEEL1.739e-5632.13Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|O01393|UNC9_CAEEL1.611e-5431.35Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q19746|INX3_CAEEL2.332e-4931.10Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|Q23027|INX5_CAEEL1.830e-4427.73Innexin-5 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
sp|Q23157|INX11_CAEEL7.921e-4131.58Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
back to top
BLAST of Innexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q2L6M50.000e+075.42Innexin OS=Dugesia japonica OX=6161 GN=inx10 PE=2 ... [more]
A0A5J4NXS37.625e-11446.02Innexin OS=Paragonimus westermani OX=34504 GN=inx ... [more]
H2KV197.901e-11447.55Innexin OS=Clonorchis sinensis OX=79923 GN=inx PE=... [more]
A0A4S2M0673.082e-11347.03Innexin OS=Opisthorchis felineus OX=147828 GN=inx ... [more]
Q2L6M67.531e-11342.46Innexin OS=Dugesia japonica OX=6161 GN=inx9 PE=2 S... [more]
back to top
BLAST of Innexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Innexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081749.10.000e+0100.00SMESG000081749.1[more]
SMESG000081749.10.000e+090.10SMESG000081749.1[more]
SMESG000061679.11.542e-12147.64SMESG000061679.1[more]
SMESG000080788.16.060e-11846.02SMESG000080788.1[more]
SMESG000065083.13.840e-10043.65SMESG000065083.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031582 ID=SMED30031582|Name=Innexin|organism=Schmidtea mediterranea sexual|type=transcript|length=1641bp
TCTTAAACATTAAAACACATTAAATAAAATCTAATAACGACAGCACTGGC
ACAAAATCGATATCTAGATGCAGAGTCAAGGTAACCGAAGTAATTAATAC
AATTTCAATAAAATCTCACAATGCGAAAATCGCTTTAATGGATACAATCG
ATTTTTGATCTTTCTATGAATTTTCATTAGCATTCAAAGAACGAATAATT
AAATGTAATTTGATAATCATTGGCACTGTTTACTAGTAAACTAATTATTG
AATTTGCAAATGATTATTTAGAATTTGGAAATTAGTTATCATTTTTAAAA
TCTCTCCGAAATTTTATTGAAAAAAATTATTACATGGAAACATTCCTGTC
TCAGTTTACGGCATTTCAAGCTGGTAAATATGTAGGGATTGAAGATGCTG
CTGATAAAGCCAGCTTTCTTTTTAGTGTAATAATATTAGTTGTTTGCAGT
GTGATTGTTTCTACAAAACAATACATAACAGCTGATATATCTTGCTACAT
ACCCGTTGTTCTTTCCGGGGTTGATTTGGATAAATATGTCAAGAATTACT
GTTGGGTTCATGGAACTATACCTTTCTATGCTAATGAAACTTTGCCTCAG
ACAAAAGATGAATGGATCATTGCAGATGCTTCAAGAAAAATAAATTACTA
TCAGTGGGTTCCTTTCGTTCTTGGCCTTCAAGGAGTCTTATTCTATTTAC
CTCGACTCATATGGAAAACAATTATTTATAACTTAAGTGGAAACGATTTA
GAAGGTCTAGTAGTAAGTGCAAAAAAAGCTTCGAATCAAGTAGGAGAAAT
AAGGAAAGAAACAATATTACAGGTAGCTAAGTGTCTAGAAGACTTATTTT
TACAGAGAAGAGTTTTGGGCCATACTAAATTTCCGGTATTAAGACAAAAA
ATGTCCTTGATATGCTGTGGTCGCCGAACTGGTGTATTTTTCATTTCACT
TTATATTGTTATAAAATTGCTATATTTAACAAATGCAATATGTCAAATTA
TTTTAATGCAGAATTTCCTGAAATATGGAGTGTCAAAATTAAATGCAGCT
TTTGGGTGGACAATTTTAAAAGACATCCTATCAGGAAAACAGTGGAATGA
TAATTTATTATTTCCAAGAGTTTCGTTTTGTTTTATTAGTGATATTTCAA
CGGTTACTCACAAAAATCACCACATTGCTCAATGTGCTCTACCGATAAAT
ATGCTTAATGAAAAGATTTATATCTTTCTATGGTTTTGGACAGTTGGAGT
TTTATTTCTGACAATAATCAGCATACCGCTATGGCTCTATAGAATGACAT
TTTTTAGAAAACGAAAAGATTTTATTAAGAGATTTTTAAAAATTAAAAGT
GCTTACACAAAAGACAAAAAAAATTTAATTTCGCAATTTGTGGAGCAATT
TTTGCGACATGATGGAATATTTATTTTGCATATAATTTCACTCAATGCTG
GCGACCTAATTGCAACAGATATTGTGTCGGAATTATGGGAAATATATAAT
AAGTATTATTTAAAAATAGATTTTAGGAAAAAATATATATCTTCTTCCAA
TGAAAAGTCGAAACAAACTTTTGTTTAGTATATATATTTGAACCAAATTA
TTCATATTTTACATTAAAATTTACTTGTTATTATTCATTGC
back to top

protein sequence of SMED30031582-orf-1

>SMED30031582-orf-1 ID=SMED30031582-orf-1|Name=SMED30031582-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=415bp
METFLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITA
DISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADAS
RKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKAS
NQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQKMSLICCGRRTG
VFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILS
GKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLW
FWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIKSAYTKDKKNLIS
QFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYNKYYLKIDFRKK
YISSSNEKSKQTFV*
back to top
Aliases
The feature 'Innexin' has the following synonyms
Synonym
Dj-inx10
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0005921gap junction
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000990InnexinPRINTSPR01262INNEXINcoord: 72..81
score: 40.8
coord: 259..268
score: 49.6
coord: 43..54
score: 38.67
coord: 207..221
score: 47.47
coord: 105..127
score: 58.43
coord: 284..300
score: 63.29
IPR000990InnexinPFAMPF00876Innexincoord: 20..388
e-value: 6.1E-102
score: 341.5
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 6..406
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 15..394
score: 30.685
NoneNo IPR availableTMHMMTMhelixcoord: 26..43
NoneNo IPR availableTMHMMTMhelixcoord: 297..319
NoneNo IPR availableTMHMMTMhelixcoord: 203..225