Pre-mRNA-processing ATP-dependent RNA helicase PRP5

Overview
NamePre-mRNA-processing ATP-dependent RNA helicase PRP5
Smed IDSMED30031576
Length (bp)3007
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 (SMED30031576) t-SNE clustered cells

Violin plots show distribution of expression levels for Pre-mRNA-processing ATP-dependent RNA helicase PRP5 (SMED30031576) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 (SMED30031576) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Pre-mRNA-processing ATP-dependent RNA helicase PRP5 (SMED30031576) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Human
Match: DDX46 (DEAD-box helicase 46 [Source:HGNC Symbol;Acc:HGNC:18681])

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 427/864 (49.42%), Postives = 582/864 (67.36%), Query Frame = 1
Query:  340 HECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX-----XYMKQLNKEFGSETTTVSQKGRSQIIKT---------------VVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXXXMSV---IAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDGLN--LVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            ++ EE +++R+ERVE+WR+ Q++K  + I E K +     E   GKKW+LEDDDD++++         E +  E      YM+++ +E         + G     K+                V  S  +KGE+ME++ DA+EYS+EEEE  L++        ++  L  VDH KI Y+    NFY+EV EL KM+  EV+ +R  + GI VKGK CPKPIK+W  CG+S KI+  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q  ++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N GRVTN+RR T++VLDEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEALAR++L+ PIE++VGG+S+VC DV Q  ++++E +KF KLLELLG YQE G VI+FV+KQE+AD L+  L+   Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LVVNY CPNHYEDYVHR GRTGRAGNKG AYTF+T DQ +Y GD+IKA +LSG   P DL   +  FK++ K EGK +  SSGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   V++D++I  MF  K+ + ++       +AP  ++V +  A +   ++LE A++ A++I+ Q+ LG  ++D  Q    A+  GG I+        +  VS K +A Q AE+I+ KL Y   +  E+E +DG      ++YEEELEINDF    R+++TSKE +  +SEY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  154 NKLEEEMRKRKERVEKWREEQRKKAMENIGELKKEI---EEMKQGKKWSLEDDDDDEDDPAEAEKEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAMEYSSEEEEVDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDM-------AAPGTSSVPAPTAGNA--EKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTIL--------APTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 994          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Human
Match: DDX46 (DEAD-box helicase 46 [Source:HGNC Symbol;Acc:HGNC:18681])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 427/865 (49.36%), Postives = 582/865 (67.28%), Query Frame = 1
Query:  340 HECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX-----XYMKQLNKEFGSETTTVSQKGRSQIIKT---------------VVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXXXMSV---IAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTK-DQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDGLN--LVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            ++ EE +++R+ERVE+WR+ Q++K  + I E K +     E   GKKW+LEDDDD++++         E +  E      YM+++ +E         + G     K+                V  S  +KGE+ME++ DA+EYS+EEEE  L++        ++  L  VDH KI Y+    NFY+EV EL KM+  EV+ +R  + GI VKGK CPKPIK+W  CG+S KI+  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q  ++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N GRVTN+RR T++VLDEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEALAR++L+ PIE++VGG+S+VC DV Q  ++++E +KF KLLELLG YQE G VI+FV+KQE+AD L+  L+   Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LVVNY CPNHYEDYVHR GRTGRAGNKG AYTF+T DQ +Y GD+IKA +LSG   P DL   +  FK++ K EGK +  SSGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   V++D++I  MF  K+ + ++       +AP  ++V +  A +   ++LE A++ A++I+ Q+ LG  ++ D  Q    A+  GG I+        +  VS K +A Q AE+I+ KL Y   +  E+E +DG      ++YEEELEINDF    R+++TSKE +  +SEY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  154 NKLEEEMRKRKERVEKWREEQRKKAMENIGELKKEI---EEMKQGKKWSLEDDDDDEDDPAEAEKEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAMEYSSEEEEVDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDM-------AAPGTSSVPAPTAGNA--EKLEIAKRLALRINAQKNLGIESQVDVMQQATNAILRGGTIL--------APTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 995          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Human
Match: DDX42 (DEAD-box helicase 42 [Source:HGNC Symbol;Acc:HGNC:18676])

HSP 1 Score: 375.941 bits (964), Expect = 1.533e-116
Identity = 188/429 (43.82%), Postives = 274/429 (63.87%), Query Frame = 1
Query:  766 DKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDE-TEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGA 2049
            D LP +DH++I Y     NFY E +E+  +TP ++   R+ L  ++V G   P+P  ++AH G   ++M  ++  ++  PTPIQCQ +P  +SGRD+IG+AKTGSGKT A++ P++ H+  Q  ++ G+GPI++++ PTREL  QI+ E  +      +R V +YGG  + EQ   L+ GAEI+VCTPGR+ID +     + TN++R ++LV DEADRMFDMGFE QV +I  H+RPDRQT++FSATF +K+E LAR +L +PI +  G      +DV+Q   IL     K+N L   L  +   G V++FV K+ NA+ L   L + G+    +HG +DQ +R+  IS+FK    P+L+AT VAARGLD+  +  V+NYD     + + HR GRTGRAG KGVAYT +TP    + GD+++   L GA
Sbjct:   79 DPLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLN-LRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK---KATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANEDVTQIVEILHSGPSKWNWLTRRLVEFTSSGSVLLFVTKKANAEELANNLKQEGHNLGLLHGDMDQSERNKVISDFKKKDIPVLVATDVAARGLDIPSIKTVINYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTPKDSNFAGDLVR--NLEGA 501          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Human
Match: DDX42 (DEAD-box helicase 42 [Source:HGNC Symbol;Acc:HGNC:18676])

HSP 1 Score: 377.096 bits (967), Expect = 9.535e-116
Identity = 188/429 (43.82%), Postives = 274/429 (63.87%), Query Frame = 1
Query:  766 DKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDE-TEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGA 2049
            D LP +DH++I Y     NFY E +E+  +TP ++   R+ L  ++V G   P+P  ++AH G   ++M  ++  ++  PTPIQCQ +P  +SGRD+IG+AKTGSGKT A++ P++ H+  Q  ++ G+GPI++++ PTREL  QI+ E  +      +R V +YGG  + EQ   L+ GAEI+VCTPGR+ID +     + TN++R ++LV DEADRMFDMGFE QV +I  H+RPDRQT++FSATF +K+E LAR +L +PI +  G      +DV+Q   IL     K+N L   L  +   G V++FV K+ NA+ L   L + G+    +HG +DQ +R+  IS+FK    P+L+AT VAARGLD+  +  V+NYD     + + HR GRTGRAG KGVAYT +TP    + GD+++   L GA
Sbjct:   79 DPLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLN-LRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK---KATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANEDVTQIVEILHSGPSKWNWLTRRLVEFTSSGSVLLFVTKKANAEELANNLKQEGHNLGLLHGDMDQSERNKVISDFKKKDIPVLVATDVAARGLDIPSIKTVINYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTPKDSNFAGDLVR--NLEGA 501          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Human
Match: DDX42 (DEAD-box helicase 42 [Source:HGNC Symbol;Acc:HGNC:18676])

HSP 1 Score: 377.096 bits (967), Expect = 1.238e-114
Identity = 188/429 (43.82%), Postives = 274/429 (63.87%), Query Frame = 1
Query:  766 DKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDE-TEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGA 2049
            D LP +DH++I Y     NFY E +E+  +TP ++   R+ L  ++V G   P+P  ++AH G   ++M  ++  ++  PTPIQCQ +P  +SGRD+IG+AKTGSGKT A++ P++ H+  Q  ++ G+GPI++++ PTREL  QI+ E  +      +R V +YGG  + EQ   L+ GAEI+VCTPGR+ID +     + TN++R ++LV DEADRMFDMGFE QV +I  H+RPDRQT++FSATF +K+E LAR +L +PI +  G      +DV+Q   IL     K+N L   L  +   G V++FV K+ NA+ L   L + G+    +HG +DQ +R+  IS+FK    P+L+AT VAARGLD+  +  V+NYD     + + HR GRTGRAG KGVAYT +TP    + GD+++   L GA
Sbjct:  198 DPLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLN-LRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK---KATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANEDVTQIVEILHSGPSKWNWLTRRLVEFTSSGSVLLFVTKKANAEELANNLKQEGHNLGLLHGDMDQSERNKVISDFKKKDIPVLVATDVAARGLDIPSIKTVINYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTPKDSNFAGDLVR--NLEGA 620          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Celegans
Match: F53H1.1 (pep chromosome:WBcel235:IV:1297222:1309652:-1 gene:WBGene00018776.1 transcript:F53H1.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53H1.1)

HSP 1 Score: 642.114 bits (1655), Expect = 0.000e+0
Identity = 365/772 (47.28%), Postives = 509/772 (65.93%), Query Frame = 1
Query:  565 YMKQLNKEFGSETTTVSQKGRSQIIKTVVKKSKTEKGEIME--DNIDAIXXXXXXXXXXXXXMSVIAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGY-ICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPD-QEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXX-XXXXXXXDEAESQLAYERRKFERETLGLE-DSDEEVNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRK-----LGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            +MK++  +   +T   +QK    +     +K + EKG+++E  DN+D +    + E       S+  K   L   DH+K+YY+K   NFYIE +E+++MT  EV  YR  L  I VKG DCPKPIKTWA CGV+ K+M +LK  ++  PT IQ QAIP+IMSGRDVIG+AKTGSGKT+A+L+P+ RH+  QP ++ G+GPI+++++PTRELA Q Y+E  K      ++  C YGG  ISEQIA LK GAEI+VCTPGRMID++A N G+VTN+RR T+LVLDEADRMFD GFEPQ++ ++ +IRPD+QTV+FSATFPR MEALARKVL+ P+EI VGGKS+VC D++QNA+I  E +KF KLLELLG+Y E G  IVFV+KQE AD ++  L+  GY   A +HGGIDQ DRDS I++FKTG   +L+ATSVAARGLDV +L LVVNYDCPNHYEDYVHR GRTGRAG KG AYTFV P+ QEK  G++ +AF+ +G  PP DL   +++FK  M  EGK+V       +G G+++DE E++    +++  R   G+E   D++ +L++++  M   KR + +    S  K + S+    +D+      KR + A+ +A ++  + K     +  V K   Q+TA+AV  G          V    +S   LA +KA  ++ KL Y   +A   + +        +EEE +INDF   VRY++ S+E++ +++E  +VG+SVRG+++P     K  +NGER L+L LE+ S
Sbjct:  182 FMKEIATKNAKKTGNSTQKASGIVTIVQEEKPEPEKGQVLENEDNMDMVIDDFDIETAAA---SLCHKGRMLAQTDHSKVYYRKFKKNFYIETEEIRRMTKAEVKAYREELDSITVKGIDCPKPIKTWAQCGVNLKMMNVLKKFEYSKPTSIQAQAIPSIMSGRDVIGIAKTGSGKTLAFLLPMFRHILDQPELEEGDGPIAVILAPTRELAMQTYKEANKFAKPLGLKVACTYGGVGISEQIADLKRGAEIVVCTPGRMIDVLAANSGKVTNLRRVTYLVLDEADRMFDKGFEPQIMKVVNNIRPDKQTVLFSATFPRHMEALARKVLDKPVEILVGGKSVVCSDITQNAVICAEHQKFLKLLELLGMYYEEGSSIVFVDKQEKADDIVDQLMRTGYNSVAPLHGGIDQHDRDSSIADFKTGVIKVLVATSVAARGLDVKNLILVVNYDCPNHYEDYVHRVGRTGRAGRKGYAYTFVLPEHQEKMAGEICRAFETAGCKPPADLKAMFERFKSEMAAEGKEVKLGGKGFEGSGYKYDEGEAEADANKKRMTRLVHGMEAGGDDDDDLEEQLSSMIKTKRRVVHGKPQS-EKPSSSSGNAKNDREA---GKRADQAKLKAEELSTRLKGASQVVQPVEKTAAQLTAEAVLRGAE--------VAPAQMSAAMLAKEKANRLNEKLNYLGGEAAPTQQQ--EEAWEYFEEEWDINDFPQQVRYKICSRESVGHVAELAEVGISVRGVHVPP---GKEPKNGERRLHLLLEARS 933          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Celegans
Match: F53H1.1 (pep chromosome:WBcel235:IV:1297400:1309644:-1 gene:WBGene00018776.1 transcript:F53H1.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53H1.1)

HSP 1 Score: 584.334 bits (1505), Expect = 0.000e+0
Identity = 292/519 (56.26%), Postives = 378/519 (72.83%), Query Frame = 1
Query:  565 YMKQLNKEFGSETTTVSQKGRSQIIKTVVKKSKTEKGEIME--DNIDAIXXXXXXXXXXXXXMSVIAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGY-ICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPD-QEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQE 2109
            +MK++  +   +T   +QK    +     +K + EKG+++E  DN+D +    + E       S+  K   L   DH+K+YY+K   NFYIE +E+++MT  EV  YR  L  I VKG DCPKPIKTWA CGV+ K+M +LK  ++  PT IQ QAIP+IMSGRDVIG+AKTGSGKT+A+L+P+ RH+  QP ++ G+GPI+++++PTRELA Q Y+E  K      ++  C YGG  ISEQIA LK GAEI+VCTPGRMID++A N G+VTN+RR T+LVLDEADRMFD GFEPQ++ ++ +IRPD+QTV+FSATFPR MEALARKVL+ P+EI VGGKS+VC D++QNA+I  E +KF KLLELLG+Y E G  IVFV+KQE AD ++  L+  GY   A +HGGIDQ DRDS I++FKTG   +L+ATSVAARGLDV +L LVVNYDCPNHYEDYVHR GRTGRAG KG AYTFV P+ QEK  G++ +AF+ +G  PP DL   +++FK  M  E
Sbjct:  182 FMKEIATKNAKKTGNSTQKASGIVTIVQEEKPEPEKGQVLENEDNMDMVIDDFDIETAAA---SLCHKGRMLAQTDHSKVYYRKFKKNFYIETEEIRRMTKAEVKAYREELDSITVKGIDCPKPIKTWAQCGVNLKMMNVLKKFEYSKPTSIQAQAIPSIMSGRDVIGIAKTGSGKTLAFLLPMFRHILDQPELEEGDGPIAVILAPTRELAMQTYKEANKFAKPLGLKVACTYGGVGISEQIADLKRGAEIVVCTPGRMIDVLAANSGKVTNLRRVTYLVLDEADRMFDKGFEPQIMKVVNNIRPDKQTVLFSATFPRHMEALARKVLDKPVEILVGGKSVVCSDITQNAVICAEHQKFLKLLELLGMYYEEGSSIVFVDKQEKADDIVDQLMRTGYNSVAPLHGGIDQHDRDSSIADFKTGVIKVLVATSVAARGLDVKNLILVVNYDCPNHYEDYVHRVGRTGRAGRKGYAYTFVLPEHQEKMAGEICRAFETAGCKPPADLKAMFERFKSEMAAE 697          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Celegans
Match: F53H1.1 (pep chromosome:WBcel235:IV:1297283:1309644:-1 gene:WBGene00018776.1 transcript:F53H1.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53H1.1)

HSP 1 Score: 435.647 bits (1119), Expect = 3.719e-138
Identity = 263/545 (48.26%), Postives = 361/545 (66.24%), Query Frame = 1
Query: 1240 IRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGY-ICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPD-QEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXX-XXXXXXXDEAESQLAYERRKFERETLGLE-DSDEEVNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRK-----LGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            I   C YGG  ISEQIA LK GAEI+VCTPGRMID++A N G+VTN+RR T+LVLDEADRMFD GFEPQ++ ++ +IRPD+QTV+FSATFPR MEALARKVL+ P+EI VGGKS+VC D++QNA+I  E +KF KLLELLG+Y E G  IVFV+KQE AD ++  L+  GY   A +HGGIDQ DRDS I++FKTG   +L+ATSVAARGLDV +L LVVNYDCPNHYEDYVHR GRTGRAG KG AYTFV P+ QEK  G++ +AF+ +G  PP DL   +++FK  M  EGK+V       +G G+++DE E++    +++  R   G+E   D++ +L++++  M   KR + +    S  K + S+    +D+      KR + A+ +A ++  + K     +  V K   Q+TA+AV  G          V    +S   LA +KA  ++ KL Y   +A   + +        +EEE +INDF   VRY++ S+E++ +++E  +VG+SVRG+++P     K  +NGER L+L LE+ S
Sbjct:  269 IEVACTYGGVGISEQIADLKRGAEIVVCTPGRMIDVLAANSGKVTNLRRVTYLVLDEADRMFDKGFEPQIMKVVNNIRPDKQTVLFSATFPRHMEALARKVLDKPVEILVGGKSVVCSDITQNAVICAEHQKFLKLLELLGMYYEEGSSIVFVDKQEKADDIVDQLMRTGYNSVAPLHGGIDQHDRDSSIADFKTGVIKVLVATSVAARGLDVKNLILVVNYDCPNHYEDYVHRVGRTGRAGRKGYAYTFVLPEHQEKMAGEICRAFETAGCKPPADLKAMFERFKSEMAAEGKEVKLGGKGFEGSGYKYDEGEAEADANKKRMTRLVHGMEAGGDDDDDLEEQLSSMIKTKRRVVHGKPQS-EKPSSSSGNAKNDREA---GKRADQAKLKAEELSTRLKGASQVVQPVEKTAAQLTAEAVLRGAE--------VAPAQMSAAMLAKEKANRLNEKLNYLGGEAAPTQQQ--EEAWEYFEEEWDINDFPQQVRYKICSRESVGHVAELAEVGISVRGVHVPP---GKEPKNGERRLHLLLEARS 796          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Celegans
Match: F53H1.1 (pep chromosome:WBcel235:IV:1297400:1309644:-1 gene:WBGene00018776.1 transcript:F53H1.1d.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F53H1.1)

HSP 1 Score: 377.481 bits (968), Expect = 7.263e-119
Identity = 190/292 (65.07%), Postives = 230/292 (78.77%), Query Frame = 1
Query: 1240 IRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGY-ICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPD-QEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQE 2109
            I   C YGG  ISEQIA LK GAEI+VCTPGRMID++A N G+VTN+RR T+LVLDEADRMFD GFEPQ++ ++ +IRPD+QTV+FSATFPR MEALARKVL+ P+EI VGGKS+VC D++QNA+I  E +KF KLLELLG+Y E G  IVFV+KQE AD ++  L+  GY   A +HGGIDQ DRDS I++FKTG   +L+ATSVAARGLDV +L LVVNYDCPNHYEDYVHR GRTGRAG KG AYTFV P+ QEK  G++ +AF+ +G  PP DL   +++FK  M  E
Sbjct:  269 IEVACTYGGVGISEQIADLKRGAEIVVCTPGRMIDVLAANSGKVTNLRRVTYLVLDEADRMFDKGFEPQIMKVVNNIRPDKQTVLFSATFPRHMEALARKVLDKPVEILVGGKSVVCSDITQNAVICAEHQKFLKLLELLGMYYEEGSSIVFVDKQEKADDIVDQLMRTGYNSVAPLHGGIDQHDRDSSIADFKTGVIKVLVATSVAARGLDVKNLILVVNYDCPNHYEDYVHRVGRTGRAGRKGYAYTFVLPEHQEKMAGEICRAFETAGCKPPADLKAMFERFKSEMAAE 560          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Celegans
Match: C46F11.4 (pep chromosome:WBcel235:III:3657716:3664494:-1 gene:WBGene00008119.1 transcript:C46F11.4.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C46F11.4)

HSP 1 Score: 343.584 bits (880), Expect = 6.795e-104
Identity = 178/437 (40.73%), Postives = 278/437 (63.62%), Query Frame = 1
Query:  766 DKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKY-GAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETE-KFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLV 2070
            D LP +DH++I YQK + NFY E +++K++   +V + +N++  ++V G   P+P+ ++AH      +M  ++  ++  PTPIQ  AIP+ +SGRDV+G+AKTGSGKT AYL P + H+  QP +++GEGP+++++ PTRELA Q+++E  K      I  +C YGG    EQ  +L+  GAE++VCTPGR+ID++ +     TN  R TFLV DEADRMFDMGFE QV +I  H+RPDRQ +MFSATF +K+E LAR  L +P+ I  G       D+ Q   ++   + K + L+  L  +   GKV++FV K+ +++ +   L  + +    +HG + Q +R+  +  F+  ++ +L+AT VAARGLD++++  V+N+D     + +VHR GRTGRAG+KG AYT VT    + +G ++K  +      P+ L+
Sbjct:  210 DPLPDIDHSQIQYQKFNKNFYEEHEDIKRLHYMDVIRLQNTMN-LRVGGLKPPRPVCSFAHFSFDKLLMEAIRKSEYEQPTPIQAMAIPSALSGRDVLGIAKTGSGKTAAYLWPAIVHIMDQPDLKAGEGPVAVIVVPTRELAIQVFQEAKKFCKVYNINPICAYGGGSKWEQSNELQNEGAEMVVCTPGRIIDLVKMG---ATNFLRTTFLVFDEADRMFDMGFEAQVKSISDHVRPDRQCLMFSATFKQKVERLARDALVDPVRIVQGEVGEANADIEQKVFVMQNQDVKLHWLIRNLVEFASLGKVLIFVTKKLDSEDVAKKLKMKDFDIVLLHGDMLQAERNENLLKFRK-KSQILVATDVAARGLDISEIRTVINFDMARDIDTHVHRIGRTGRAGHKGTAYTLVTEKDIEMVGHLVKNLESVSQEVPKPLM 641          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Fly
Match: CG6227 (gene:FBgn0030631 transcript:FBtr0074011)

HSP 1 Score: 624.394 bits (1609), Expect = 0.000e+0
Identity = 335/591 (56.68%), Postives = 439/591 (74.28%), Query Frame = 1
Query:  565 YMKQLNKEFGSETTTVSQKGRSQ--IIKTVV---KKSKTEKGEIMEDNIDAIXXXXXXXXXXXXXMSV---IAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDE----EVNLDDKIIDMFAVKRNITNV 2301
            YM+++N E       V+   +SQ  +I T V   K +  +KGE++E N+D++EYS+E+E E +   +V   +  + +L  +DH+ + Y     NFY+EV EL +MT  +V KYR+ L GI+VKGK CPKPIKTWA CGVS K M +L+   F  PTPIQCQAIPAIMSGRD+IG+AKTGSGKT+A+++P+ RH+  QP ++ G+G I+I+M+PTREL  QI ++I K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N GRVTN+RR T++VLDEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR+MEALAR++L  PIE+ VGG+S+VC++V Q+ +IL++  KF KLLELLG+YQE G +IVFV+KQENAD L+  L++  Y C ++HGGIDQ DRDS I +FK+G+  LLIATSVAARGLDV DL LVVNYD PNHYEDYVHRCGRTGRAG KG AYTF+TP+Q +Y GD+I+A  LSG   P +L   + ++K   + EGK V +  GF GKGF+FDE E   A E +K ++  LGL DSD+    E ++D +I  +FA KR + + 
Sbjct:  379 YMQEVNNEMRRVNNFVNPPAKSQGVVILTGVAKKKTTTLKKGEVIEQNMDSLEYSSEDELEDIRDTAVNLAMKHRKELAKIDHSSVTYAPFRKNFYVEVPELTRMTAADVEKYRSDLEGIQVKGKGCPKPIKTWAQCGVSKKEMEVLRRLGFEKPTPIQCQAIPAIMSGRDLIGIAKTGSGKTLAFILPMFRHILDQPSMEDGDGAIAIIMAPTRELCMQIGKDIRKFSKSLGLRPVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNVRPDRQTVMFSATFPRQMEALARRILKKPIEVIVGGRSVVCKEVEQHVVILNDDAKFFKLLELLGIYQEAGSIIVFVDKQENADILLRDLMKASYPCMSLHGGIDQFDRDSTIIDFKSGKVRLLIATSVAARGLDVKDLILVVNYDVPNHYEDYVHRCGRTGRAGKKGSAYTFITPEQSRYAGDIIRAMDLSGTLIPAELQALWTEYKALQEAEGKTVHTGGGFSGKGFKFDEQEFNAAKESKKLQKAALGLADSDDEEDIEQDIDQQIEQIFAAKRTVKDT 969          

HSP 2 Score: 91.2781 bits (225), Expect = 3.235e-18
Identity = 85/205 (41.46%), Postives = 118/205 (57.56%), Query Frame = 1
Query: 2368 LLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDGL--------NLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVSXXXXXXXXXXXXXXXXXXXXXXXXVGHTVVQGRYKVV 2958
            L + +LE A++ A KI+  + L   TK    VT + +  G  +      L+ +  V     A Q A +++NKL Y      EDE  +GL        N   KYEEELEINDF    R+++TSKE +  +SEY + G++VRG Y+P   + K   +GER LYL++ES SE+ +Q AK+EI R+IKEELLKL    H   +GRYKVV
Sbjct: 1036 LSSDKLELAKRLASKINSSKNLD--TKGSV-VTVEPMIKGPHVTGAAATLLTARTV-----AEQMAAKLNNKLNYQPK---EDE--EGLGPLVGGTTNPFTKYEEELEINDFPQQARWKVTSKEALAQISEYSEAGLTVRGTYVP---QGKNPPDGERKLYLAIESCSELAVQKAKREITRLIKEELLKLSSAHHVFNKGRYKVV 1224          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Fly
Match: CG6418 (gene:FBgn0036104 transcript:FBtr0076274)

HSP 1 Score: 378.637 bits (971), Expect = 6.043e-117
Identity = 191/436 (43.81%), Postives = 281/436 (64.45%), Query Frame = 1
Query:  766 DKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALIL-DETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLV 2070
            D LP + H++I Y+    NFY + D++  +   +V + R +LG +KV G   PKP+ ++ H G   +++  ++  ++  PTPIQ QA+P  +SGRD+IG+AKTGSGKT A++ P++ HV  Q  ++ G+GPI ++++PTREL+ QIY E  K      +  VC YGG    EQ   L+ GAEI+V TPGRMIDM+ +   + TN+RR TFLVLDEADRMF MGFEPQV +I  H+RPDRQ +MFSATF +++E LAR VL++P+ I  G  +   QD++Q+  +  +  +K+N LL  L  +   G V++FV K+ +A+ +   L+ + Y C  +HG +DQ DR+  I+ FK     +L+AT VAARGLD+  +  VVNYD     E + HR GRTGRAG KG AYT VT   +++ G +++  + +    P+DL+
Sbjct:  214 DPLPPIYHSEIEYEPFEKNFYTQHDDIAALDDEQVRELRRTLG-VKVTGPSPPKPVTSFGHFGFDEQLIKAVRKAEYTQPTPIQAQAVPTALSGRDIIGIAKTGSGKTAAFIWPMLMHVMDQKQLKPGDGPIGLILAPTRELSLQIYNEAKKFGKVYNLNVVCCYGGGSKWEQSKALEQGAEIIVATPGRMIDMVKM---KATNLRRVTFLVLDEADRMFHMGFEPQVRSICNHVRPDRQCLMFSATFKKRIERLARDVLSDPVRIVQGDLNEANQDITQSVYVFPNPLQKWNWLLCHLVKFLSEGSVLIFVTKKVDAETVSNNLLIKEYNCLLLHGDMDQADRNKVITQFKRKECDILVATDVAARGLDIPHIRNVVNYDTARDIETHTHRIGRTGRAGEKGNAYTLVTDKDKEFAGHLVRNLEGADQLVPDDLM 645          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Fly
Match: mahe (gene:FBgn0029979 transcript:FBtr0071132)

HSP 1 Score: 341.658 bits (875), Expect = 9.926e-102
Identity = 174/405 (42.96%), Postives = 253/405 (62.47%), Query Frame = 1
Query:  898 IKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQI------YREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVC-QDVSQNALILDETEK-------FNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLV 2070
            I V G + P P+ ++    + + ++  +K   F  PT IQ Q  P  +SGRD++G+A+TGSGKT+AY++P + H+  QPP+  GEGPI++V++PTRELA QI      Y  + K     EIR  CI+GG+    Q   L  G E+++ TPGR+ID +     R TN++RCT+LVLDEADRM DMGFEPQ+  I+  IRPDRQ VM+SAT+P++++ALA   LN+ I+I +G  ++    ++ Q   I  E EK        N++  +      G K+IVFVE +   + ++ ++   GY   ++HG   Q++RDS + +F+ G++ +LIAT VA+RGLDV DL  V+NYD PN  E+YVHR GRTGR    G AYTF TPD  K   ++I   + +G TP + L+
Sbjct:  225 ITVSGNELPHPVVSFEESSLPAHVIEEMKRQGFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQPPIIRGEGPIALVLAPTRELAQQIQSVVRDYGHLCK----PEIRHTCIFGGSSKVPQARDLDRGVEVIIATPGRLIDFLE---NRNTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGSMNLSANHNIRQIVEICTEIEKPQRLVCLLNEISPIKNSGNNGNKIIVFVETKIKVEDILQIIRAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVEDLQYVINYDYPNSSENYVHRIGRTGRCQQLGTAYTFFTPDNAKQARELISVLEEAGQTPSQALL 622          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Fly
Match: mahe (gene:FBgn0029979 transcript:FBtr0344137)

HSP 1 Score: 341.658 bits (875), Expect = 9.926e-102
Identity = 174/405 (42.96%), Postives = 253/405 (62.47%), Query Frame = 1
Query:  898 IKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQI------YREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVC-QDVSQNALILDETEK-------FNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLV 2070
            I V G + P P+ ++    + + ++  +K   F  PT IQ Q  P  +SGRD++G+A+TGSGKT+AY++P + H+  QPP+  GEGPI++V++PTRELA QI      Y  + K     EIR  CI+GG+    Q   L  G E+++ TPGR+ID +     R TN++RCT+LVLDEADRM DMGFEPQ+  I+  IRPDRQ VM+SAT+P++++ALA   LN+ I+I +G  ++    ++ Q   I  E EK        N++  +      G K+IVFVE +   + ++ ++   GY   ++HG   Q++RDS + +F+ G++ +LIAT VA+RGLDV DL  V+NYD PN  E+YVHR GRTGR    G AYTF TPD  K   ++I   + +G TP + L+
Sbjct:  225 ITVSGNELPHPVVSFEESSLPAHVIEEMKRQGFTKPTAIQSQGWPIALSGRDLVGIAQTGSGKTLAYMLPAIVHIGNQPPIIRGEGPIALVLAPTRELAQQIQSVVRDYGHLCK----PEIRHTCIFGGSSKVPQARDLDRGVEVIIATPGRLIDFLE---NRNTNLQRCTYLVLDEADRMLDMGFEPQIRKIIEQIRPDRQVVMWSATWPKEVQALAGDFLNDYIQINIGSMNLSANHNIRQIVEICTEIEKPQRLVCLLNEISPIKNSGNNGNKIIVFVETKIKVEDILQIIRAEGYNATSIHGDKTQNERDSVLKDFRNGKSNILIATDVASRGLDVEDLQYVINYDYPNSSENYVHRIGRTGRCQQLGTAYTFFTPDNAKQARELISVLEEAGQTPSQALL 622          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Fly
Match: CG10077 (gene:FBgn0035720 transcript:FBtr0333083)

HSP 1 Score: 337.035 bits (863), Expect = 3.149e-101
Identity = 175/430 (40.70%), Postives = 260/430 (60.47%), Query Frame = 1
Query:  772 LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVC-QDVSQNALILDETEKFNKXXXXXX--XXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGAT 2052
            LP +  +++       NFY   D +   T  E   +  S   I +KG   P P   +   G    +M  ++   F  PT IQ Q  P  MSGRD++GVA+TGSGKT+AY++P + H+  QP ++ G+GPI++V++PTRELA QI +  ++  +   +R  CI+GG    +Q   L+ G EI++ TPGR+ID +       T+++RCT+LVLDEADRM DMGFEPQ+  I+  IRPDRQ +M+SAT+P+++  LA + LNN I++ +G  S+    ++ Q   + DE EK  KL++LL     +   K I+FVE ++  D +   +  +G+   A+HG   Q +RD  +S+F+ GR+ +L+AT VAARGLDV D+  V+NYD P++ EDYVHR GRTGR+ N G AYT  T        D+I+  + +  T
Sbjct:  104 LPKIVWSEVNLTPFRKNFYKPCDSVLARTVGETETFLTS-NEITIKGDQVPTPSIEFEEGGFPDYVMNEIRKQGFAKPTAIQAQGWPIAMSGRDLVGVAQTGSGKTLAYVLPAVVHINNQPRLERGDGPIALVLAPTRELAQQIQQVAIEFGSNTHVRNTCIFGGAPKGQQARDLERGVEIVIATPGRLIDFLERG---TTSLKRCTYLVLDEADRMLDMGFEPQIRKIMQQIRPDRQVLMWSATWPKEVRQLAEEFLNNYIQVNIGSLSLSANHNILQIVDVCDENEKLMKLIKLLTDISAENETKTIIFVETKKRVDEITRNISRQGWRACAIHGDKSQQERDFVLSSFRNGRHSILVATDVAARGLDVDDVKFVINYDYPSNSEDYVHRIGRTGRSNNTGTAYTLFTHSNANKANDLIQVLREANQT 529          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Zebrafish
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 725.702 bits (1872), Expect = 0.000e+0
Identity = 419/871 (48.11%), Postives = 576/871 (66.13%), Query Frame = 1
Query:  349 EEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX--------XYMKQLNKE-----FGSETTTVSQKG-------RSQIIKTVVKKSKTEKGEIMEDNIDAIX-XXXXXXXXXXXXMSVIAKKDK--LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLN----------KRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSD--AGEDEMKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            EE +++R+ERVE+WR+ Q++K  + I E K +     E   GKKW+LEDDD+E + A      E  E+            YM+++ +E      G+      +KG        + +    +  +  +KGE+ME++ DA+E  S EEE +   +++    K +  L  VDH KI Y+    NFY+EV EL +M+P EVS+YR  L GI VKGK CPKPIKTW  CG+S K++  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q PV   EGP++++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+  N GRVTN+RR T++V+DEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEALAR++L+ P+E++VGG+S+VC DV Q+ ++++E +KF KLLE+LG YQE G VI+FV+KQE+AD L+  L++  Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LVVNY CPNHYEDYVHR GRTGRAGNKG AYTF+T  Q +Y GD++KA +LSG++ P +L   +  FKE+ K EGK + SSSGF GKGF+FDE E  LA ER+K ++  LGL DSD+E   +++D++I  MF  K+ + +      V +  +     S  A   L           ++LE A++ A++I  Q+ LG   +D  Q    A+  GG I+        +  VS K +A Q+AE+I+ KL Y+  +    E +  +    V++YEEELEINDF    R+++TSKE +  + EY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  125 EEEMRKRKERVEKWREEQRKKAMENIGEIKKEL---EEMKQGKKWSLEDDDEEQDKAAEAEESERMEEEEVGEEVDPLDAYMEEVKEEVKKFNMGTMKGANDKKGGMSVTKVVTVVKTKKMPHATKKKGELMENDQDAMEYSSEEEEVDLQTALTGFQTKQRKVLEPVDHQKIQYEPFRKNFYVEVPELARMSPEEVSEYRLELEGISVKGKGCPKPIKTWVQCGISMKVLNALKKHNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHILDQRPVGEAEGPLAVIMTPTRELALQITKECKKFSKSLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLGANNGRVTNLRRVTYVVIDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRTMEALARRILSKPVEVQVGGRSVVCSDVEQHVIVIEEEKKFLKLLEILGHYQEKGSVIIFVDKQEHADGLLKDLMKASYPCMSLHGGIDQYDRDSIINDFKNGACRLLVATSVAARGLDVKQLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEGQARYSGDILKALELSGSSVPAELEQLWTNFKEQQKAEGKIIKSSSGFSGKGFKFDETEHALANERKKLQKAALGLHDSDDEDTALDIDEQIESMFNSKKRVKDFSAPGSVSAGSAGGVSGSVSAVSGLGSLSTPSAGNIQKLEIAKKLALRIQAQKNLGAEAQDVMQQATNAILRGGTII--------APSVSAKTIAEQQAEKINAKLNYTPVEKLEEERQAAEAAETVKRYEEELEINDFPQTARWKVTSKEALQRIGEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 981          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Zebrafish
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 375.941 bits (964), Expect = 1.216e-114
Identity = 189/434 (43.55%), Postives = 274/434 (63.13%), Query Frame = 1
Query:  772 LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDE-TEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLV 2070
            LP +DH++I Y     NFY E +E+  +T  EV + R  L  +KV G   PKP  ++AH G   ++M  ++  ++  PTPIQCQ +P  +SGRD IG+AKTGSGKT A++ P++ H+  Q  ++ GEGPI++++ PTREL  QI+ E  +      +R V +YGG  + EQ   L+ GAEI+VCTPGR+ID +     + T+++R TFLV DEADRMFDMGFE QV +I  H+RPDRQT++FSATF +K+E LAR +L +PI +  G      +D++Q   +L    +K+  L   L  +   G V+VFV K+ N + L   LI+ GY    +HG +DQ +R+  I++FK    P+L+AT VAARGLD+  +  VVNYD     + + HR GRTGRAG KGVAYT +T     + GD+++  + +  +  +DL+
Sbjct:  202 LPPIDHSEIDYSPFEKNFYNEHEEISSLTGAEVVELRRKLN-LKVSGAAPPKPATSFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPIALSGRDAIGIAKTGSGKTAAFIWPILVHIMDQKELEPGEGPIAVIVCPTRELCQQIHAECKRFGKAYGLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK---KATSLQRVTFLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIEKLARDILVDPIRVVQGDIGEANEDITQIVEVLQSGQDKWGWLTRRLVEFTSAGSVLVFVTKKANCEELATNLIQEGYSLGLLHGDMDQSERNKVIADFKKKNLPVLVATDVAARGLDIPSIRTVVNYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTTKDTSFAGDLVRNLEGANQSVSKDLL 631          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Zebrafish
Match: DDX17 (si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-18])

HSP 1 Score: 350.903 bits (899), Expect = 8.723e-108
Identity = 176/413 (42.62%), Postives = 251/413 (60.77%), Query Frame = 1
Query:  808 KVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVC-QDVSQNALILDETEKFNK--XXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFK 2037
            K   NFY E  E+  M+  +V +YR     I V+G  CPKP+  +        +M +L    F  PT IQ Q  P  +SGRD++G+A+TGSGKT+AYL+P + H+  QP ++ G+GPI +V++PTRELA Q+ +          I+  C+YGG     QI  L+ G EI + TPGR+ID + V     TN+RRCT+LVLDEADRM DMGFEPQ+  I+  IRPDRQT+M+SAT+P+++  LA   L + ++I +G   +    ++ Q   +  E EK NK   L    + ++  K I+FVE ++  D L   +   G+    +HG   Q +RD  ++ F++G+ P+LIAT VA+RGLDV D+  V+NYD PN  EDYVHR GRT R+ NKG AYTF TP   +   D+++  +
Sbjct:   54 KFEKNFYNENPEVHHMSQYDVEEYRRKRE-ITVRGSGCPKPVTNFHQAQFPQYVMDVLLQQNFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVAFDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEVG---KTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINIGALELSANHNILQIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLRQARDLVRVLE 462          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 344.739 bits (883), Expect = 1.021e-107
Identity = 177/430 (41.16%), Postives = 261/430 (60.70%), Query Frame = 1
Query:  808 KVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVC-QDVSQNALILDETEKFNK--XXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSG-ATPPEDLVVAYDK 2085
            K   NFY E  ++ + +  EV  YR S   I VKG+D PKPI  +        +M ++    + +PTPIQ Q  P  +SG+D++G+A+TGSGKT++YL+P + H+  QP ++ G+GPI +V++PTRELA Q+ +   +      I+  CIYGG     QI  L+ G EI + TPGR+ID +       TN+RRCT+LVLDEADRM DMGFEPQ+  I+  IRPDRQT+M+SAT+P+++  LA   L   I+I VG   +    ++ Q   + ++ EK +K   L    + ++  K I+FVE +   D L   +   G+    +HG  +Q +RD  ++ FK G+ P+LIAT VA+RGLDV D+  V+N+D PN+ EDY+HR GRT R+   G AYTF TP+  K   D++   + +  A  P+ + +A D+
Sbjct:   55 KFEKNFYQENPDVARRSAQEVEHYRRS-KEITVKGRDGPKPIVKFHEANFPKYVMDVITKQNWTDPTPIQAQGWPVALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGKASRIKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGK---TNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYIQINVGALQLSANHNILQIVDVCNDGEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAHDLVSVLREANQAINPKLIQMAEDR 480          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 343.969 bits (881), Expect = 6.368e-106
Identity = 173/413 (41.89%), Postives = 252/413 (61.02%), Query Frame = 1
Query:  808 KVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVC-QDVSQNALILDETEKFNK--XXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFK 2037
            K   NFY E  ++ + +  EV  YR S   I VKG+D PKPI  +        +M ++    + +PTPIQ Q  P  +SG+D++G+A+TGSGKT++YL+P + H+  QP ++ G+GPI +V++PTRELA Q+ +   +      I+  CIYGG     QI  L+ G EI + TPGR+ID +       TN+RRCT+LVLDEADRM DMGFEPQ+  I+  IRPDRQT+M+SAT+P+++  LA   L   I+I VG   +    ++ Q   + ++ EK +K   L    + ++  K I+FVE +   D L   +   G+    +HG  +Q +RD  ++ FK G+ P+LIAT VA+RGLDV D+  V+N+D PN+ EDY+HR GRT R+   G AYTF TP+  K   D++   +
Sbjct:   55 KFEKNFYQENPDVARRSAQEVEHYRRS-KEITVKGRDGPKPIVKFHEANFPKYVMDVITKQNWTDPTPIQAQGWPVALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGKASRIKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAG---KTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYIQINVGALQLSANHNILQIVDVCNDGEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAHDLVSVLR 463          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Xenopus
Match: DDX46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:100145307])

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 434/869 (49.94%), Postives = 586/869 (67.43%), Query Frame = 1
Query:  340 HECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX----XYMKQLNKEF----------GSETTT----VSQKGRSQIIKTVVKKSKTEKGEIMEDNIDAIXXXXXXXXX-XXXXMSVIAKKDK--LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLG---QVT----KDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKD-GLN-LVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            ++ EE +++R+ERVE+WR+ Q+++  + I E K +     E   GKKW+LEDDDD+DE         EE +        YM+++ +E           GSE  T              K  V+ +K +KGE+ME++ DA+EYS+EEEE     +++    K +  L  VDH KI Y+    NFY+EV EL KMT  EV+ YR  L GI VKGK+CPKPIK+W  CG+S KI+  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q P++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N GRVTN+RR T++VLDEADRMFDMGFEPQV+ I+ +IRPDRQTVMFSATFPR MEALAR++L+ PIE++VGG+S+VC DV Q+ ++++E +KF KLLELLG YQE G VI+FV+KQE+AD L+  L+   Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LV+NY CPNHYEDYVHR GRTGRAGNKG A+TF+T DQ +Y GD+IKA +LSG   P +L   +++FKE+ K EGK +  +SGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   +++D++I  MF  K+ + ++       + P  ++  +   T    ++LE A++ A K+ V + LG   QV     +D  Q    A+  GG I+        +  VS K +A Q AE+I+ KL Y   +  E+E +D G N   ++YEEELEINDF    R+++TSKE +  +SEY +  +++RG Y P     K  + GER +YL++ES S
Sbjct:   38 NKLEEEMRKRKERVEKWREEQRKRVVESIGELKKEI---EEMRQGKKWSLEDDDDDDEEPTEGEKEGEEVEDELDPLDAYMEEVKEEVKKFNMGSVKGGSEKKTGPTVTKVVTVMTTKKVAVETTK-KKGELMENDQDAMEYSSEEEEVDLQTALTGFQTKQRKLLEPVDHGKIEYESYRKNFYVEVPELAKMTTEEVNSYRLELEGITVKGKNCPKPIKSWVQCGISMKILNSLKKHAYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRPLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANNGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNIRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQHVIVIEEEKKFLKLLELLGHYQEKGAVIIFVDKQEHADGLLKDLMRASYPCLSLHGGIDQYDRDSIINDFKNGVCKLLVATSVAARGLDVKQLILVINYACPNHYEDYVHRAGRTGRAGNKGYAFTFITEDQARYAGDIIKALELSGTAVPAELEQLWNEFKEQQKAEGKIIKKTSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDTALDIDEQIESMFNSKKRVKDM-------AGPGGSSANATLPTAGNAEKLEIAKRLAKKLSVNKNLGAEAQVCSLFWQDVMQQATNAILRGGTIL--------APTVSAKTIAEQLAEKINAKLNYVPVEKLEEEKQDAGANESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP---GKDPKEGERKIYLAIESAS 884          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Xenopus
Match: DDX46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:100145307])

HSP 1 Score: 718.383 bits (1853), Expect = 0.000e+0
Identity = 434/874 (49.66%), Postives = 584/874 (66.82%), Query Frame = 1
Query:  340 HECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX----XYMKQLNKEF----------GSETTT----VSQKGRSQIIKTVVKKSKTEKGEIMEDNIDAIXXXXXXXXX-XXXXMSVIAKKDK--LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNV------------DRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKD-GLN-LVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            ++ EE +++R+ERVE+WR+ Q+++  + I E K +     E   GKKW+LEDDDD+DE         EE +        YM+++ +E           GSE  T              K  V+ +K +KGE+ME++ DA+EYS+EEEE     +++    K +  L  VDH KI Y+    NFY+EV EL KMT  EV+ YR  L GI VKGK+CPKPIK+W  CG+S KI+  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q P++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N GRVTN+RR T++VLDEADRMFDMGFEPQV+ I+ +IRPDRQTVMFSATFPR MEALAR++L+ PIE++VGG+S+VC DV Q+ ++++E +KF KLLELLG YQE G VI+FV+KQE+AD L+  L+   Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LV+NY CPNHYEDYVHR GRTGRAGNKG A+TF+T DQ +Y GD+IKA +LSG   P +L   +++FKE+ K EGK +  +SGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   +++D++I  MF  K+ + ++                    A S+A      A +   ++LE A++ A K+ V + LG   +D  Q    A+  GG I+        +  VS K +A Q AE+I+ KL Y   +  E+E +D G N   ++YEEELEINDF    R+++TSKE +  +SEY +  +++RG Y P     K  + GER +YL++ES S
Sbjct:   38 NKLEEEMRKRKERVEKWREEQRKRVVESIGELKKEI---EEMRQGKKWSLEDDDDDDEEPTEGEKEGEEVEDELDPLDAYMEEVKEEVKKFNMGSVKGGSEKKTGPTVTKVVTVMTTKKVAVETTK-KKGELMENDQDAMEYSSEEEEVDLQTALTGFQTKQRKLLEPVDHGKIEYESYRKNFYVEVPELAKMTTEEVNSYRLELEGITVKGKNCPKPIKSWVQCGISMKILNSLKKHAYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRPLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANNGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIIDNIRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQHVIVIEEEKKFLKLLELLGHYQEKGAVIIFVDKQEHADGLLKDLMRASYPCLSLHGGIDQYDRDSIINDFKNGVCKLLVATSVAARGLDVKQLILVINYACPNHYEDYVHRAGRTGRAGNKGYAFTFITEDQARYAGDIIKALELSGTAVPAELEQLWNEFKEQQKAEGKIIKKTSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDTALDIDEQIESMFNSKKRVKDMAGPGGAAATGAPGMVGGAVGAGSSANATLPTAGNA--EKLEIAKRLAKKLSVNKNLGAEAQDVMQQATNAILRGGTIL--------APTVSAKTIAEQLAEKINAKLNYVPVEKLEEEKQDAGANESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP---GKDPKEGERKIYLAIESAS 894          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Xenopus
Match: DDX46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:100145307])

HSP 1 Score: 658.292 bits (1697), Expect = 0.000e+0
Identity = 407/862 (47.22%), Postives = 558/862 (64.73%), Query Frame = 1
Query:  340 HECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX----XYMKQLNKEF----------GSETTT----VSQKGRSQIIKTVVKKSKTEKGEIMEDNIDAIX-XXXXXXXXXXXXMSVIAKKDK--LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKD-GLN-LVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            ++ EE +++R+ERVE+WR+ Q+++  + I E K +     E   GKKW+LEDDDD+DE         EE +        YM+++ +E           GSE  T              K  V+ +K +KGE+ME++ DA+E  S EEE +   +++    K +  L  VDH KI Y+    NFY+EV EL KMT  EV+ YR  L GI VKGK+CPKPIK+W  CG+S KI+  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q P++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N G+         ++         M        I+ +IRPDRQTVMFSATFPR MEALAR++L+ PIE++VGG+S+VC DV Q+ ++++E +KF KLLELLG YQE G VI+FV+KQE+AD L+  L+   Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LV+NY CPNHYEDYVHR GRTGRAGNKG A+TF+T DQ +Y GD+IKA +LSG   P +L   +++FKE+ K EGK +  +SGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   +++D++I  MF  K+ + ++       + P  ++  +   T    ++LE A++ A K+ V + LG   +D  Q    A+  GG I+        +  VS K +A Q AE+I+ KL Y   +  E+E +D G N   ++YEEELEINDF    R+++TSKE +  +SEY +  +++RG Y P     K  + GER +YL++ES S
Sbjct:   38 NKLEEEMRKRKERVEKWREEQRKRVVESIGELKKEI---EEMRQGKKWSLEDDDDDDEEPTEGEKEGEEVEDELDPLDAYMEEVKEEVKKFNMGSVKGGSEKKTGPTVTKVVTVMTTKKVAVETTK-KKGELMENDQDAMEYSSEEEEVDLQTALTGFQTKQRKLLEPVDHGKIEYESYRKNFYVEVPELAKMTTEEVNSYRLELEGITVKGKNCPKPIKSWVQCGISMKILNSLKKHAYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRPLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANNGKQRAGFFLFQILELLLLPFTKM-------IIIDNIRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQHVIVIEEEKKFLKLLELLGHYQEKGAVIIFVDKQEHADGLLKDLMRASYPCLSLHGGIDQYDRDSIINDFKNGVCKLLVATSVAARGLDVKQLILVINYACPNHYEDYVHRAGRTGRAGNKGYAFTFITEDQARYAGDIIKALELSGTAVPAELEQLWNEFKEQQKAEGKIIKKTSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDTALDIDEQIESMFNSKKRVKDM-------AGPGGSSANATLPTAGNAEKLEIAKRLAKKLSVNKNLGAEAQDVMQQATNAILRGGTIL--------APTVSAKTIAEQLAEKINAKLNYVPVEKLEEEKQDAGANESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP---GKDPKEGERKIYLAIESAS 870          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Xenopus
Match: cul2 (cullin 2 [Source:Xenbase;Acc:XB-GENE-960931])

HSP 1 Score: 372.089 bits (954), Expect = 3.819e-114
Identity = 186/429 (43.36%), Postives = 272/429 (63.40%), Query Frame = 1
Query:  766 DKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDE-TEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGA 2049
            D LP +DH +I Y     NFY E +E+   TP ++++ R+ L  ++V G   P+   ++AH G   ++M  ++  ++  PTPIQCQ +P  +SGRD+IG+AKTGSGKT A++ P++ H+  Q  +Q G+GPI++++ PTREL  QI+ E  +      +R V +YGG  + EQ   L+ GAEI+VCTPGR+ID +     + TN++R T+LV DEADRMFDMGFE QV +I  H+RPDRQT++FSATF +K+E LAR +L +PI +  G      +D++Q   IL    EK+  L   L  +   G V++FV K+ NA+ L   L +  +    +HG +DQ +R+  IS+FK    P+L+AT VAARGLD+  +  V+NYD     + + HR GRTGRAG KGVA+T +TP    + GD+++   L GA
Sbjct:   63 DPLPPIDHTEIEYTPFEKNFYEEHEEITSQTPQQITELRHKLN-LRVSGAAPPRLCSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGKTAAFIWPILVHIMDQKELQPGDGPIAVIVCPTRELCQQIHSECKRFGKAYNLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK---KATNLQRVTYLVFDEADRMFDMGFEYQVRSIANHVRPDRQTLLFSATFRKKIEKLARDILVDPIRVVQGDIGEANEDITQVVEILPSGPEKWTWLTRRLVEFTSTGSVLIFVTKKANAEELANNLRQDDHPLGLLHGDMDQSERNKVISDFKKKSIPVLVATDVAARGLDIPSIKTVINYDVARDIDTHTHRIGRTGRAGEKGVAHTLLTPKDSNFAGDLVR--NLEGA 485          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Xenopus
Match: cul2 (cullin 2 [Source:Xenbase;Acc:XB-GENE-960931])

HSP 1 Score: 373.244 bits (957), Expect = 2.295e-113
Identity = 186/429 (43.36%), Postives = 272/429 (63.40%), Query Frame = 1
Query:  766 DKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDE-TEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGA 2049
            D LP +DH +I Y     NFY E +E+   TP ++++ R+ L  ++V G   P+   ++AH G   ++M  ++  ++  PTPIQCQ +P  +SGRD+IG+AKTGSGKT A++ P++ H+  Q  +Q G+GPI++++ PTREL  QI+ E  +      +R V +YGG  + EQ   L+ GAEI+VCTPGR+ID +     + TN++R T+LV DEADRMFDMGFE QV +I  H+RPDRQT++FSATF +K+E LAR +L +PI +  G      +D++Q   IL    EK+  L   L  +   G V++FV K+ NA+ L   L +  +    +HG +DQ +R+  IS+FK    P+L+AT VAARGLD+  +  V+NYD     + + HR GRTGRAG KGVA+T +TP    + GD+++   L GA
Sbjct:  196 DPLPPIDHTEIEYTPFEKNFYEEHEEITSQTPQQITELRHKLN-LRVSGAAPPRLCSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGKTAAFIWPILVHIMDQKELQPGDGPIAVIVCPTRELCQQIHSECKRFGKAYNLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK---KATNLQRVTYLVFDEADRMFDMGFEYQVRSIANHVRPDRQTLLFSATFRKKIEKLARDILVDPIRVVQGDIGEANEDITQVVEILPSGPEKWTWLTRRLVEFTSTGSVLIFVTKKANAEELANNLRQDDHPLGLLHGDMDQSERNKVISDFKKKSIPVLVATDVAARGLDIPSIKTVINYDVARDIDTHTHRIGRTGRAGEKGVAHTLLTPKDSNFAGDLVR--NLEGA 618          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Mouse
Match: Ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:MGI Symbol;Acc:MGI:1920895])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 425/865 (49.13%), Postives = 582/865 (67.28%), Query Frame = 1
Query:  340 HECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX-----XYMKQLNKEFGSETTTVSQKGRSQIIKT---------------VVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXXXMSV---IAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTK-DQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDG--LNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            ++ EE +++R+ERVE+WR+ Q++K  + I E K +     E   GKKW+LEDDDD++++         E +  E      YM+++ +E         + G     K+                V  +  +KGE+ME++ DA+EYS+EEEE  L++        ++  L  VDH KI Y+    NFY+EV EL KM+  EV+ +R  + GI VKGK CPKPIK+W  CG+S KI+  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q  ++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N GRVTN+RR T++VLDEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEALAR++L+ PIE++VGG+S+VC DV Q  ++++E +KF KLLELLG YQE G VI+FV+KQE+AD L+  L+   Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LVVNY CPNHYEDYVHR GRTGRAGNKG AYTF+T DQ +Y GD+IKA +LSG   P DL   +  FK++ K EGK +  SSGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   V++D++I  MF  K+ + ++       +AP  ++V +  A +   ++LE A++ A++I+ Q+ LG  ++ D  Q    A+  GG I+        +  VS K +A Q AE+I+ KL Y   +  E+E ++G      ++YEEELEINDF    R+++TSKE +  +SEY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  154 NKLEEEMRKRKERVEKWREEQRKKAMENIGELKKEI---EEMKQGKKWSLEDDDDDEDDPAEAEKEGTEMEDEELDPLDAYMEEVKEEVKKFNMRSVKGGAGNEKKSGPTVTKVVTVVTTKKAVVDADKKKGELMENDQDAMEYSSEEEEVDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDM-------AAPGTSSVPAPTAGNA--EKLEIAKRLALRINAQKNLGIESQVDVMQQATNAILRGGTIL--------APTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQEGGQSESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 995          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Mouse
Match: Ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:MGI Symbol;Acc:MGI:1920895])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 425/865 (49.13%), Postives = 582/865 (67.28%), Query Frame = 1
Query:  340 HECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX-----XYMKQLNKEFGSETTTVSQKGRSQIIKT---------------VVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXXXMSV---IAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTK-DQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDG--LNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            ++ EE +++R+ERVE+WR+ Q++K  + I E K +     E   GKKW+LEDDDD++++         E +  E      YM+++ +E         + G     K+                V  +  +KGE+ME++ DA+EYS+EEEE  L++        ++  L  VDH KI Y+    NFY+EV EL KM+  EV+ +R  + GI VKGK CPKPIK+W  CG+S KI+  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q  ++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N GRVTN+RR T++VLDEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEALAR++L+ PIE++VGG+S+VC DV Q  ++++E +KF KLLELLG YQE G VI+FV+KQE+AD L+  L+   Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LVVNY CPNHYEDYVHR GRTGRAGNKG AYTF+T DQ +Y GD+IKA +LSG   P DL   +  FK++ K EGK +  SSGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   V++D++I  MF  K+ + ++       +AP  ++V +  A +   ++LE A++ A++I+ Q+ LG  ++ D  Q    A+  GG I+        +  VS K +A Q AE+I+ KL Y   +  E+E ++G      ++YEEELEINDF    R+++TSKE +  +SEY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  154 NKLEEEMRKRKERVEKWREEQRKKAMENIGELKKEI---EEMKQGKKWSLEDDDDDEDDPAEAEKEGTEMEDEELDPLDAYMEEVKEEVKKFNMRSVKGGAGNEKKSGPTVTKVVTVVTTKKAVVDADKKKGELMENDQDAMEYSSEEEEVDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDM-------AAPGTSSVPAPTAGNA--EKLEIAKRLALRINAQKNLGIESQVDVMQQATNAILRGGTIL--------APTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQEGGQSESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 995          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Mouse
Match: Ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:MGI Symbol;Acc:MGI:1920895])

HSP 1 Score: 659.448 bits (1700), Expect = 0.000e+0
Identity = 408/866 (47.11%), Postives = 564/866 (65.13%), Query Frame = 1
Query:  340 HECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX-----XYMKQLNKEFGSETTTVSQKGRSQIIKT---------------VVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXXXMSV---IAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGF-EPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTK-DQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDG--LNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            ++ EE +++R+ERVE+WR+ Q++K  + I E K +     E   GKKW+LEDDDD++++         E +  E      YM+++ +E         + G     K+                V  +  +KGE+ME++ DA+EYS+EEEE  L++        ++  L  VDH KI Y+    NFY+EV EL KM+  EV+ +R  + GI VKGK CPKPIK+W  CG+S KI+  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q  ++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N G+        F  L     + DM F E  V+ I+ ++RPDRQTVMFSATFPR MEALAR++L+ PIE++VGG+S+VC DV Q  ++++E +KF KLLELLG YQE G VI+FV+KQE+AD L+  L+   Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LVVNY CPNHYEDYVHR GRTGRAGNKG AYTF+T DQ +Y GD+IKA +LSG   P DL   +  FK++ K EGK +  SSGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   V++D++I  MF  K+ + ++       +AP  ++V +  A +   ++LE A++ A++I+ Q+ LG  ++ D  Q    A+  GG I+        +  VS K +A Q AE+I+ KL Y   +  E+E ++G      ++YEEELEINDF    R+++TSKE +  +SEY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  154 NKLEEEMRKRKERVEKWREEQRKKAMENIGELKKEI---EEMKQGKKWSLEDDDDDEDDPAEAEKEGTEMEDEELDPLDAYMEEVKEEVKKFNMRSVKGGAGNEKKSGPTVTKVVTVVTTKKAVVDADKKKGELMENDQDAMEYSSEEEEVDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGKSR-----VFYYLFSLLFVLDMIFVEADVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDM-------AAPGTSSVPAPTAGNA--EKLEIAKRLALRINAQKNLGIESQVDVMQQATNAILRGGTIL--------APTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQEGGQSESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 991          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Mouse
Match: Ddx42 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 42 [Source:MGI Symbol;Acc:MGI:1919297])

HSP 1 Score: 377.096 bits (967), Expect = 8.239e-115
Identity = 188/429 (43.82%), Postives = 274/429 (63.87%), Query Frame = 1
Query:  766 DKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDE-TEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGA 2049
            D LP +DH++I Y     NFY E +E+  +TP ++   R+ L  ++V G   P+P  ++AH G   ++M  ++  ++  PTPIQCQ +P  +SGRD+IG+AKTGSGKT A++ P++ H+  Q  ++ G+GPI++++ PTREL  QI+ E  +      +R V +YGG  + EQ   L+ GAEI+VCTPGR+ID +     + TN++R ++LV DEADRMFDMGFE QV +I  H+RPDRQT++FSATF +K+E LAR +L +PI +  G      +DV+Q   IL     K+N L   L  +   G V++FV K+ NA+ L   L + G+    +HG +DQ +R+  IS+FK    P+L+AT VAARGLD+  +  V+NYD     + + HR GRTGRAG KGVAYT +TP    + GD+++   L GA
Sbjct:  198 DPLPPIDHSEIDYPPFEKNFYNEHEEITNLTPQQLIDLRHKLN-LRVSGAAPPRPGSSFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPVALSGRDMIGIAKTGSGKTAAFIWPMLIHIMDQKELEPGDGPIAVIVCPTRELCQQIHAECKRFGKAYNLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK---KATNLQRVSYLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANEDVTQIVEILHSGPSKWNWLTRRLVEFTSSGSVLLFVTKKANAEELASNLKQEGHNLGLLHGDMDQSERNKVISDFKKKDIPVLVATDVAARGLDIPSIKTVINYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTPKDSNFAGDLVR--NLEGA 620          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 355.525 bits (911), Expect = 9.464e-110
Identity = 183/414 (44.20%), Postives = 257/414 (62.08%), Query Frame = 1
Query:  808 KVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKD-CPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVC-QDVSQNALILDETEKFNK--XXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFK 2037
            K   NFY+E  E+ ++TP EV + R     I V+G D CPKP+  + H      +M +L    F  PTPIQCQ  P  +SGRD++G+A+TGSGKT+AYL+P + H+  QP ++ G+GPI +V++PTRELA Q+ +          ++  CIYGG     QI  L+ G EI + TPGR+ID +    G+ TN+RRCT+LVLDEADRM DMGFEPQ+  I+  IRPDRQT+M+SAT+P+++  LA   L +  +I VG   +    ++ Q   +  E+EK +K   L    + ++  K I+FVE +   D L   +   G+    +HG   Q +RD  ++ F++G+ P+LIAT VA+RGLDV D+  V+NYD PN  EDYVHR GRT R+ NKG AYTF TP   K   ++IK  +
Sbjct:   50 KFEKNFYVEHPEVARLTPYEVDELRRK-KEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFL--ESGK-TNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLE 459          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. UniProt/SwissProt
Match: sp|Q7L014|DDX46_HUMAN (Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2)

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 427/864 (49.42%), Postives = 582/864 (67.36%), Query Frame = 1
Query:  340 HECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX-----XYMKQLNKEFGSETTTVSQKGRSQIIKT---------------VVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXXXMSV---IAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDGLN--LVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            ++ EE +++R+ERVE+WR+ Q++K  + I E K +     E   GKKW+LEDDDD++++         E +  E      YM+++ +E         + G     K+                V  S  +KGE+ME++ DA+EYS+EEEE  L++        ++  L  VDH KI Y+    NFY+EV EL KM+  EV+ +R  + GI VKGK CPKPIK+W  CG+S KI+  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q  ++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N GRVTN+RR T++VLDEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEALAR++L+ PIE++VGG+S+VC DV Q  ++++E +KF KLLELLG YQE G VI+FV+KQE+AD L+  L+   Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LVVNY CPNHYEDYVHR GRTGRAGNKG AYTF+T DQ +Y GD+IKA +LSG   P DL   +  FK++ K EGK +  SSGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   V++D++I  MF  K+ + ++       +AP  ++V +  A +   ++LE A++ A++I+ Q+ LG  ++D  Q    A+  GG I+        +  VS K +A Q AE+I+ KL Y   +  E+E +DG      ++YEEELEINDF    R+++TSKE +  +SEY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  154 NKLEEEMRKRKERVEKWREEQRKKAMENIGELKKEI---EEMKQGKKWSLEDDDDDEDDPAEAEKEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAMEYSSEEEEVDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDM-------AAPGTSSVPAPTAGNA--EKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTIL--------APTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 994          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. UniProt/SwissProt
Match: sp|Q4TVV3|DDX46_DANRE (Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio OX=7955 GN=ddx46 PE=2 SV=1)

HSP 1 Score: 723.005 bits (1865), Expect = 0.000e+0
Identity = 418/871 (47.99%), Postives = 575/871 (66.02%), Query Frame = 1
Query:  349 EEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX--------XYMKQLNKE-----FGSETTTVSQKG-------RSQIIKTVVKKSKTEKGEIMEDNIDAIX-XXXXXXXXXXXXMSVIAKKDK--LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLN----------KRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSD--AGEDEMKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            EE +++R+ERVE+WR+ Q++   + I E K +     E   GKKW+LEDDD+E + A      E  E+            YM+++ +E      G+      +KG        + +    +  +  +KGE+ME++ DA+E  S EEE +   +++    K +  L  VDH KI Y+    NFY+EV EL +M+P EVS+YR  L GI VKGK CPKPIKTW  CG+S K++  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q PV   EGP++++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+  N GRVTN+RR T++V+DEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEALAR++L+ P+E++VGG+S+VC DV Q+ ++++E +KF KLLE+LG YQE G VI+FV+KQE+AD L+  L++  Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LVVNY CPNHYEDYVHR GRTGRAGNKG AYTF+T  Q +Y GD++KA +LSG++ P +L   +  FKE+ K EGK + SSSGF GKGF+FDE E  LA ER+K ++  LGL DSD+E   +++D++I  MF  K+ + +      V +  +     S  A   L           ++LE A++ A++I  Q+ LG   +D  Q    A+  GG I+        +  VS K +A Q+AE+I+ KL Y+  +    E +  +    V++YEEELEINDF    R+++TSKE +  + EY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  125 EEEMRKRKERVEKWREEQRKTAMENIGEIKKEL---EEMKQGKKWSLEDDDEEQDKAAEAEESERMEEEEVGEEVDPLDAYMEEVKEEVKKFNMGTMKGANDKKGGMSVTKVVTVVKTKKMPHATKKKGELMENDQDAMEYSSEEEEVDLQTALTGFQTKQRKVLEPVDHQKIQYEPFRKNFYVEVPELARMSPEEVSEYRLELEGISVKGKGCPKPIKTWVQCGISMKVLNALKKHNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHILDQRPVGEAEGPLAVIMTPTRELALQITKECKKFSKSLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLGANNGRVTNLRRVTYVVIDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRTMEALARRILSKPVEVQVGGRSVVCSDVEQHVIVIEEEKKFLKLLEILGHYQEKGSVIIFVDKQEHADGLLKDLMKASYPCMSLHGGIDQYDRDSIINDFKNGACRLLVATSVAARGLDVKQLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEGQARYSGDILKALELSGSSVPAELEQLWTNFKEQQKAEGKIIKSSSGFSGKGFKFDETEHALANERKKLQKWALGLHDSDDEDTALDIDEQIESMFNSKKRVKDFSAPGSVSAGSAGGVSGSVSAVSGLGSLSTPSAGNIQKLEIAKKLALRIQAQKNLGAEAQDVMQQATNAILRGGTII--------APSVSAKTIAEQQAEKINAKLNYTPVEKLEEERQAAEAAETVKRYEEELEINDFPQTARWKVTSKEALQRIGEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 981          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. UniProt/SwissProt
Match: sp|Q569Z5|DDX46_MOUSE (Probable ATP-dependent RNA helicase DDX46 OS=Mus musculus OX=10090 GN=Ddx46 PE=1 SV=2)

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 425/865 (49.13%), Postives = 582/865 (67.28%), Query Frame = 1
Query:  340 HECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX-----XYMKQLNKEFGSETTTVSQKGRSQIIKT---------------VVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXXXMSV---IAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTK-DQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDG--LNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            ++ EE +++R+ERVE+WR+ Q++K  + I E K +     E   GKKW+LEDDDD++++         E +  E      YM+++ +E         + G     K+                V  +  +KGE+ME++ DA+EYS+EEEE  L++        ++  L  VDH KI Y+    NFY+EV EL KM+  EV+ +R  + GI VKGK CPKPIK+W  CG+S KI+  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q  ++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N GRVTN+RR T++VLDEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEALAR++L+ PIE++VGG+S+VC DV Q  ++++E +KF KLLELLG YQE G VI+FV+KQE+AD L+  L+   Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LVVNY CPNHYEDYVHR GRTGRAGNKG AYTF+T DQ +Y GD+IKA +LSG   P DL   +  FK++ K EGK +  SSGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   V++D++I  MF  K+ + ++       +AP  ++V +  A +   ++LE A++ A++I+ Q+ LG  ++ D  Q    A+  GG I+        +  VS K +A Q AE+I+ KL Y   +  E+E ++G      ++YEEELEINDF    R+++TSKE +  +SEY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  154 NKLEEEMRKRKERVEKWREEQRKKAMENIGELKKEI---EEMKQGKKWSLEDDDDDEDDPAEAEKEGTEMEDEELDPLDAYMEEVKEEVKKFNMRSVKGGAGNEKKSGPTVTKVVTVVTTKKAVVDADKKKGELMENDQDAMEYSSEEEEVDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDM-------AAPGTSSVPAPTAGNA--EKLEIAKRLALRINAQKNLGIESQVDVMQQATNAILRGGTIL--------APTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQEGGQSESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 995          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. UniProt/SwissProt
Match: sp|Q5R6D8|DDX46_PONAB (Probable ATP-dependent RNA helicase DDX46 OS=Pongo abelii OX=9601 GN=DDX46 PE=2 SV=1)

HSP 1 Score: 715.301 bits (1845), Expect = 0.000e+0
Identity = 425/865 (49.13%), Postives = 580/865 (67.05%), Query Frame = 1
Query:  340 HECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX-----XYMKQLNKEFGSETTTVSQKGRSQIIKT---------------VVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXXXMSV---IAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTK-DQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDGLN--LVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            ++ EE +++R+ERVE+WR+ Q++K  + I E K +     E   GKKW+LEDDDD++++         E +  E      YM+++ +E         + G     K+                V  S  +KGE+ME++ DA+EYS+EEEE  L++        ++  L  VDH KI Y+    NFY+EV EL KM+  EV+ +R  + GI VKGK CPKPIK+W  CG+S KI+  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q  ++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N GRVTN+RR T++VLDEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEAL R++L+ PIE++VGG+S+VC DV Q  ++++E +KF KLLELLG YQE G VI+FV+KQE+AD L+  L+   Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LVVNY CPNHYEDYVHR GRTGRAGNKG AYTF+T DQ +Y GD+IKA +LSG   P DL   +  FK++ K EGK +  SSGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   V++D++I  MF  K+ + ++       +AP  ++  +  A +   ++LE A++ A++I+ Q+ LG  ++ D  Q    A+  GG I+        +  VS K +A Q AE+I+ KL Y   +  E+E +DG      ++YEEELEINDF    R+++TSKE +  +SEY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  154 NKLEEEMRKRKERVEKWREEQRKKAMENIGELKKEI---EEMKQGKKWSLEDDDDDEDDPAEAEKEGNEMEGEELDPLDAYMEEVKEEVKKFNMRSVKGGGGNEKKSGPTVTKVVTVVTTKKAVVDSDKKKGELMENDQDAMEYSSEEEEVDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRAMEALVRRILSKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDM-------AAPGTSSAPAPTAGNA--EKLEIAKRLALRINAQKNLGIESQVDVMQQATNAILRGGTIL--------APTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 995          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. UniProt/SwissProt
Match: sp|Q62780|DDX46_RAT (Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus OX=10116 GN=Ddx46 PE=1 SV=1)

HSP 1 Score: 712.99 bits (1839), Expect = 0.000e+0
Identity = 423/865 (48.90%), Postives = 581/865 (67.17%), Query Frame = 1
Query:  340 HECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX-----XYMKQLNKEFGSETTTVSQKGRSQIIKT---------------VVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXXXMSV---IAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTK-DQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDG--LNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            ++ EE +++R+ERVE+WR+ Q++K  + I E K +     E   GKKW+LEDDDD++++         E +  E      YM+++ +E         + G     K+                V  +  +KGE+ME++ DA+EYS+EEEE  L++        ++  L  VDH KI Y+    NFY+EV EL KM+  EV+ +R  + GI VKGK CPKPIK+W  CG+S KI+  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q  ++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N GRVTN+RR T++VLDEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEALAR++L+ PIE++VGG+S+VC DV Q  ++++E +KF KLLELLG YQE G VI+FV+KQE+AD L+  L+   Y C ++HGGIDQ DRDS I++FK G   LL+ATSVAARGLDV  L LVVNY CPNHYEDYVHR GRTGRAGNKG AYTF+T DQ +Y GD+IKA +LSG   P DL   +  FK++ K EGK +  SSGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   V++D++I  MF  K+ + ++       +AP  ++  +  A +   ++LE A++ A++I+ Q+ LG  ++ D  Q    A+  GG ++        +  VS K +A Q AE+I+ KL Y   +  E+E ++G      ++YEEELEINDF    R+++TSKE +  +SEY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  154 NKLEEEMRKRKERVEKWREEQRKKAMENIGELKKEI---EEMKQGKKWSLEDDDDDEDDPAEAEKEGNEMEDEELDPLDAYMEEVKEEVKKFNMRSVKGGAGNEKKSGPTVTKVVTVVTTKKAVVDADKKKGELMENDQDAMEYSSEEEEVDLQTALTGYQTKQRKLLEPVDHGKIEYEPFRKNFYVEVPELAKMSQEEVNVFRLEMEGITVKGKGCPKPIKSWVQCGISMKILNSLKKHGYEKPTPIQTQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRSLEEGEGPIAVIMTPTRELALQITKECKKFSKTLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNLRRVTYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQQVIVIEEEKKFLKLLELLGHYQESGSVIIFVDKQEHADGLLKDLMRASYPCMSLHGGIDQYDRDSIINDFKNGTCKLLVATSVAARGLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDM-------AAPGTSSAPAPTAGNA--EKLEIAKRLALRINAQKNLGIESQVDVMQQATNAILRGGPLL--------APTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQEGGQSESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 995          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. TrEMBL
Match: A0A4V3SDC1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008741 PE=4 SV=1)

HSP 1 Score: 781.556 bits (2017), Expect = 0.000e+0
Identity = 427/770 (55.45%), Postives = 568/770 (73.77%), Query Frame = 1
Query:  640 KTVVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXX-XMSVIAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE------VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQ---VTK-DQTQVTAQAVFSGGV-------------IMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSK---SDAGEDE--MKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMP-----THIKHKMEQNGERPLYLSLESVS 2847
            K  +KK    KGE+ME NID +EYS+EEEEETLE +++ + KK+KL  VDH+KI+Y+    NFYIEV EL KM+  +V  YR SL  I+V+G+DCPKP+K W   G+SS+++  LK + F  PTPIQCQA+P +MSGRD+IG+AKTGSGKT+A+L+PLMRH++ Q P++ G+GPI+++++PTRELA QI++E  KL    + R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A NGGRVTN+RRCT++VLDEADRMFD+GFEPQV+ I+ + RPDRQT MFSATFPR+ME LARK L  PIEI+VGG+S+VC DV Q+AL+L E EKF K+LELLG+YQE G V++FVEKQE+AD L+ +L++ GY C ++HGGIDQ DRDS +++FK G   LLIATSVAARGLDV+DL +V+NYDCPNHYEDYVHRCGRTGRAGNKG AYTF+TPDQE+  GD+++AFK SG  PPEDL+  ++ +K RM  EGKKVF SSGF+GKGF FDEAE+QL  E+R+ ++  LGL+DSDEE      ++ + KI DM A KR +T+V ++S+ +     A   +  A+  L+  L  ARQ+A ++ + + LG    VT+ D TQ TA AV SG                       V +   S + LA Q AE+++ KLGYSK   + +GE+E     G ++VR++EEEL INDF  +VR+R+T ++ + +L+++ +VGVSVRG+YMP     TH+    E + +RPLYL +E+V+
Sbjct:  252 KPPLKKRIIGKGELMESNIDEMEYSSEEEEETLEDALAHLQKKEKLLPVDHSKIHYRPFRKNFYIEVPELAKMSKEDVKAYRASLENIRVRGQDCPKPLKNWVQAGISSRLLNCLKRNNFDKPTPIQCQALPVLMSGRDMIGIAKTGSGKTLAFLVPLMRHLEHQDPLEPGDGPIALLLAPTRELALQIFKEAKKLAQAVDARVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANGGRVTNLRRCTYIVLDEADRMFDLGFEPQVMRIVENCRPDRQTAMFSATFPRQMELLARKALTLPIEIQVGGRSVVCSDVEQHALVLTEDEKFYKVLELLGIYQEAGSVLIFVEKQESADELMRVLLKYGYPCLSLHGGIDQYDRDSVMTDFKRGNIRLLIATSVAARGLDVSDLMVVINYDCPNHYEDYVHRCGRTGRAGNKGFAYTFLTPDQERNAGDIVRAFKQSGQKPPEDLLAMWNSYKTRMAAEGKKVFGSSGFRGKGFMFDEAEAQLNSEKRRAQKAALGLQDSDEEEADPSSLDWESKIEDMLASKRKVTDVAKSSVGELTTDTAAAGAQTASTPLSAALALARQKAAQLGINKNLGTTAPVTRADATQATAIAVLSGTTPPPTVGPASASVAAAAAAAAAVTTGITSSRTLAEQAAEKLNAKLGYSKQTLAGSGEEEPNAPSGSDVVRRFEEELVINDFPQSVRWRITGRDMLNHLNDFCNVGVSVRGVYMPPAKAKTHVP---EGSDDRPLYLCIEAVT 1018          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. TrEMBL
Match: A0A4S2LAF8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008741 PE=4 SV=1)

HSP 1 Score: 780.785 bits (2015), Expect = 0.000e+0
Identity = 427/770 (55.45%), Postives = 568/770 (73.77%), Query Frame = 1
Query:  640 KTVVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXX-XMSVIAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE------VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQ---VTK-DQTQVTAQAVFSGGV-------------IMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSK---SDAGEDE--MKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMP-----THIKHKMEQNGERPLYLSLESVS 2847
            K  +KK    KGE+ME NID +EYS+EEEEETLE +++ + KK+KL  VDH+KI+Y+    NFYIEV EL KM+  +V  YR SL  I+V+G+DCPKP+K W   G+SS+++  LK + F  PTPIQCQA+P +MSGRD+IG+AKTGSGKT+A+L+PLMRH++ Q P++ G+GPI+++++PTRELA QI++E  KL    + R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A NGGRVTN+RRCT++VLDEADRMFD+GFEPQV+ I+ + RPDRQT MFSATFPR+ME LARK L  PIEI+VGG+S+VC DV Q+AL+L E EKF K+LELLG+YQE G V++FVEKQE+AD L+ +L++ GY C ++HGGIDQ DRDS +++FK G   LLIATSVAARGLDV+DL +V+NYDCPNHYEDYVHRCGRTGRAGNKG AYTF+TPDQE+  GD+++AFK SG  PPEDL+  ++ +K RM  EGKKVF SSGF+GKGF FDEAE+QL  E+R+ ++  LGL+DSDEE      ++ + KI DM A KR +T+V ++S+ +     A   +  A+  L+  L  ARQ+A ++ + + LG    VT+ D TQ TA AV SG                       V +   S + LA Q AE+++ KLGYSK   + +GE+E     G ++VR++EEEL INDF  +VR+R+T ++ + +L+++ +VGVSVRG+YMP     TH+    E + +RPLYL +E+V+
Sbjct:  252 KPPLKKRIIGKGELMESNIDEMEYSSEEEEETLEDALAHLQKKEKLLPVDHSKIHYRPFRKNFYIEVPELAKMSKEDVKAYRASLENIRVRGQDCPKPLKNWVQAGISSRLLNCLKRNNFDKPTPIQCQALPVLMSGRDMIGIAKTGSGKTLAFLVPLMRHLEHQDPLEPGDGPIALLLAPTRELALQIFKEAKKLAQAVDARVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANGGRVTNLRRCTYIVLDEADRMFDLGFEPQVMRIVENCRPDRQTAMFSATFPRQMELLARKALTLPIEIQVGGRSVVCSDVEQHALVLTEDEKFYKVLELLGIYQEAGSVLIFVEKQESADELMRVLLKYGYPCLSLHGGIDQYDRDSVMTDFKRGNIRLLIATSVAARGLDVSDLMVVINYDCPNHYEDYVHRCGRTGRAGNKGFAYTFLTPDQERNAGDIVRAFKQSGQKPPEDLLAMWNSYKTRMAAEGKKVFGSSGFRGKGFMFDEAEAQLNSEKRRAQKAALGLQDSDEEEADPSSLDWESKIEDMLASKRKVTDVAKSSVGELTTDTAAAGAQTASTPLSAALALARQKAAQLGINKNLGTTAPVTRADATQATAIAVLSGTTPPPTVGPASASVAAAAAAAAAVTTGITSSRTLAEQAAEKLNAKLGYSKQTLAGSGEEEPNAPSGSDVVRRFEEELVINDFPQSVRWRITGRDMLNHLNDFCNVGVSVRGVYMPPAKAKTHVP---EGSDDRPLYLCIEAVT 1018          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. TrEMBL
Match: A0A4S2L9X7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_008741 PE=4 SV=1)

HSP 1 Score: 779.63 bits (2012), Expect = 0.000e+0
Identity = 427/770 (55.45%), Postives = 568/770 (73.77%), Query Frame = 1
Query:  640 KTVVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXX-XMSVIAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE------VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQ---VTK-DQTQVTAQAVFSGGV-------------IMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSK---SDAGEDE--MKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMP-----THIKHKMEQNGERPLYLSLESVS 2847
            K  +KK    KGE+ME NID +EYS+EEEEETLE +++ + KK+KL  VDH+KI+Y+    NFYIEV EL KM+  +V  YR SL  I+V+G+DCPKP+K W   G+SS+++  LK + F  PTPIQCQA+P +MSGRD+IG+AKTGSGKT+A+L+PLMRH++ Q P++ G+GPI+++++PTRELA QI++E  KL    + R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A NGGRVTN+RRCT++VLDEADRMFD+GFEPQV+ I+ + RPDRQT MFSATFPR+ME LARK L  PIEI+VGG+S+VC DV Q+AL+L E EKF K+LELLG+YQE G V++FVEKQE+AD L+ +L++ GY C ++HGGIDQ DRDS +++FK G   LLIATSVAARGLDV+DL +V+NYDCPNHYEDYVHRCGRTGRAGNKG AYTF+TPDQE+  GD+++AFK SG  PPEDL+  ++ +K RM  EGKKVF SSGF+GKGF FDEAE+QL  E+R+ ++  LGL+DSDEE      ++ + KI DM A KR +T+V ++S+ +     A   +  A+  L+  L  ARQ+A ++ + + LG    VT+ D TQ TA AV SG                       V +   S + LA Q AE+++ KLGYSK   + +GE+E     G ++VR++EEEL INDF  +VR+R+T ++ + +L+++ +VGVSVRG+YMP     TH+    E + +RPLYL +E+V+
Sbjct:  265 KPPLKKRIIGKGELMESNIDEMEYSSEEEEETLEDALAHLQKKEKLLPVDHSKIHYRPFRKNFYIEVPELAKMSKEDVKAYRASLENIRVRGQDCPKPLKNWVQAGISSRLLNCLKRNNFDKPTPIQCQALPVLMSGRDMIGIAKTGSGKTLAFLVPLMRHLEHQDPLEPGDGPIALLLAPTRELALQIFKEAKKLAQAVDARVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANGGRVTNLRRCTYIVLDEADRMFDLGFEPQVMRIVENCRPDRQTAMFSATFPRQMELLARKALTLPIEIQVGGRSVVCSDVEQHALVLTEDEKFYKVLELLGIYQEAGSVLIFVEKQESADELMRVLLKYGYPCLSLHGGIDQYDRDSVMTDFKRGNIRLLIATSVAARGLDVSDLMVVINYDCPNHYEDYVHRCGRTGRAGNKGFAYTFLTPDQERNAGDIVRAFKQSGQKPPEDLLAMWNSYKTRMAAEGKKVFGSSGFRGKGFMFDEAEAQLNSEKRRAQKAALGLQDSDEEEADPSSLDWESKIEDMLASKRKVTDVAKSSVGELTTDTAAAGAQTASTPLSAALALARQKAAQLGINKNLGTTAPVTRADATQATAIAVLSGTTPPPTVGPASASVAAAAAAAAAVTTGITSSRTLAEQAAEKLNAKLGYSKQTLAGSGEEEPNAPSGSDVVRRFEEELVINDFPQSVRWRITGRDMLNHLNDFCNVGVSVRGVYMPPAKAKTHVP---EGSDDRPLYLCIEAVT 1031          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. TrEMBL
Match: A0A074ZFK3 (Uncharacterized protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_14961 PE=4 SV=1)

HSP 1 Score: 776.933 bits (2005), Expect = 0.000e+0
Identity = 430/770 (55.84%), Postives = 571/770 (74.16%), Query Frame = 1
Query:  640 KTVVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXX-XMSVIAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE------VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQ---VTK-DQTQVTAQAVFSGGV-------------IMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSK---SDAGEDE--MKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMP-----THIKHKMEQNGERPLYLSLESVS 2847
            K  +KK    KGE+ME NID +EYS+EEEEETLE +++ + KK+KL  VDH+KI+Y+    NFYIEV EL KM+  +V  YR SL  I+V+G+DCPKP+K W   G+SS++++ LK + F  PTPIQCQA+P +MSGRD+IG+AKTGSGKT+A+L+PLMRH++ Q P++ G+GPI+++++PTRELA QI++E  KL    + R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A NGGRVTN+RRCT++VLDEADRMFD+GFEPQV+ I+ + RPDRQT MFSATFPR+ME LARK L  PIEI+VGG+S+VC DV Q+AL+L E EKF K+LELLG+YQE G V++FVEKQE+AD L+ +L++ GY C ++HGGIDQ DRDS +++FK G   LLIATSVAARGLDV+DL +V+NYDCPNHYEDYVHRCGRTGRAGNKG AYTF+TPDQE+  GDV++AFK SG  PPEDL+V ++ +K RM  EGKKVF SSGF+GKGF FDEAE+QL  E+R+ ++  LGL+DSDEE      ++ + KI DM A KR +T+V ++SI +     A  ++  A+  L+  L  ARQ+A ++ + + LG    VT+ D TQ TA AV SG                       V +   S + LA Q AE+++ KLGYSK   + +GE+E     G ++VR++EEEL INDF  +VR+R+T ++ + +L+++ +VGVSVRG+YMP     TH+    E + +RPLYL +E+V+
Sbjct:  266 KPPLKKRVIGKGELMESNIDEMEYSSEEEEETLEDALAHLQKKEKLLPVDHSKIHYRPFRKNFYIEVPELAKMSKEDVKAYRASLENIRVRGQDCPKPLKNWVQAGISSRLLSCLKRNNFDKPTPIQCQALPVLMSGRDMIGIAKTGSGKTLAFLVPLMRHLEHQDPLEPGDGPIALLLAPTRELALQIFKEAKKLAQAVDARVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANGGRVTNLRRCTYIVLDEADRMFDLGFEPQVMRIVENCRPDRQTAMFSATFPRQMELLARKALTLPIEIQVGGRSVVCSDVEQHALVLTEDEKFYKVLELLGIYQEAGSVLIFVEKQESADELMRVLLKYGYPCLSLHGGIDQYDRDSVMTDFKRGNIRLLIATSVAARGLDVSDLMVVINYDCPNHYEDYVHRCGRTGRAGNKGFAYTFLTPDQERNAGDVVRAFKQSGQKPPEDLLVMWNSYKTRMAAEGKKVFGSSGFRGKGFMFDEAEAQLNSEKRRAQKAALGLQDSDEEEADPSSLDWESKIEDMLASKRKVTDVAKSSIGELTTDTAAASAQTASTPLSAALALARQKAAQLGINKNLGTTAPVTRADATQATAIAVLSGTTPPPTVGPASASVAAAAAAAAAVTTGITSSRTLAEQAAEKLNAKLGYSKQTVAGSGEEEPNAPAGSDVVRRFEEELVINDFPQSVRWRITGRDMLNHLNDFCNVGVSVRGVYMPPAKAKTHVP---EGSDDRPLYLCIEAVT 1032          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. TrEMBL
Match: A0A1S8WPA1 (DEAD/DEAH box helicase (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_07954 PE=4 SV=1)

HSP 1 Score: 775.007 bits (2000), Expect = 0.000e+0
Identity = 429/770 (55.71%), Postives = 570/770 (74.03%), Query Frame = 1
Query:  640 KTVVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXX-XMSVIAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE------VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQ---VTK-DQTQVTAQAVFSGGV-------------IMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSK---SDAGEDE--MKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMP-----THIKHKMEQNGERPLYLSLESVS 2847
            K  +KK    KGE+ME NID +EYS+EEEEETLE +++ + KK+KL  VDH+KI+Y+    NFYIEV EL KM+  +V  YR SL  I+V+G+DCPKP+K W   G+SS++++ LK + F  PTPIQCQA+P +MSGRD+IG+AKTGSGKT+A+L+PLMRH++ Q P++ G+GPI+++++PTRELA QI++E  KL    + R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A NGGRVTN+RRCT++VLDEADRMFD+GFEPQV+ I+ + RPDRQT MFSATFPR+ME LARK L  PIEI+VGG+S+VC DV Q+AL+L E EKF K+LELLG+YQE G V++FVEKQE+AD L+ +L++ GY C ++HGGIDQ DRDS +++FK G   LLIATSVAARGLDV+DL +V+NYDCPNHYEDYVHRCGRTGRAGNKG AYTF+TPDQE+  GDV++AFK SG  PPEDL+  ++ +K RM  EGKKVF SSGF+GKGF FDEAE+QL  E+R+ ++  LGL+DSDEE      ++ + KI DM A KR +T+V ++SI +     A  ++  A+  L+  L  ARQ+A ++ + + LG    VT+ D TQ TA AV SG                       V +   S + LA Q AE+++ KLGYSK   + +GE+E     G ++VR++EEEL INDF  +VR+R+T ++ + +L+++ +VGVSVRG+YMP     TH+    E + +RPLYL +E+V+
Sbjct:  251 KPPLKKRVIGKGELMESNIDEMEYSSEEEEETLEDALAHLQKKEKLLPVDHSKIHYRPFRKNFYIEVPELAKMSKEDVKAYRASLENIRVRGQDCPKPLKNWVQAGISSRLLSCLKRNNFDKPTPIQCQALPVLMSGRDMIGIAKTGSGKTLAFLVPLMRHLEHQDPLEPGDGPIALLLAPTRELALQIFKEAKKLAQAVDARVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANGGRVTNLRRCTYIVLDEADRMFDLGFEPQVMRIVENCRPDRQTAMFSATFPRQMELLARKALTLPIEIQVGGRSVVCSDVEQHALVLTEDEKFYKVLELLGIYQEAGSVLIFVEKQESADELMRVLLKYGYPCLSLHGGIDQYDRDSVMTDFKRGNIRLLIATSVAARGLDVSDLMVVINYDCPNHYEDYVHRCGRTGRAGNKGFAYTFLTPDQERNAGDVVRAFKQSGQKPPEDLLAMWNSYKTRMAAEGKKVFGSSGFRGKGFMFDEAEAQLNSEKRRAQKAALGLQDSDEEEADPSSLDWESKIEDMLASKRKVTDVAKSSIGELTTDTAAASAQTASTPLSAALALARQKAAQLGINKNLGTTAPVTRADATQATAIAVLSGTTPPPTVGPASASVAAAAAAAAAVTTGITSSRTLAEQAAEKLNAKLGYSKQTVAGSGEEEPNAPAGSDVVRRFEEELVINDFPQSVRWRITGRDMLNHLNDFCNVGVSVRGVYMPPAKAKTHVP---EGSDDRPLYLCIEAVT 1017          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Cavefish
Match: ddx46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:103041720])

HSP 1 Score: 721.465 bits (1861), Expect = 0.000e+0
Identity = 386/742 (52.02%), Postives = 520/742 (70.08%), Query Frame = 1
Query:  673 GEIMEDNIDAIX-XXXXXXXXXXXXMSVIAKKDK--LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLN---------KRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMK--DGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            GE+ME++ DA+E  S EEE +   +++    K +  L  VDH KI Y+    NFY+EV EL +MTP EV++YR  L GI VKGK CPKPIKTW  CG S K++  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q P++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+  N GRVTN+RR T++V+DEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEALAR++LN P+E++VGG+S+VC DV Q+ ++++E +KF KLLE+LG YQE G VI+FV+KQE+AD L+  L++  Y C ++HGGIDQ DRDS I++FK G   L++ATSVAARGLDV  L LVVNY+CPNHYEDYVHR GRTGRAGNKG AYTF+T +Q +Y GD+IKA +LSG+  P +L   +  FKE+ K EGK + SSSGF GKGF+FDE E  LA ER+K ++  LGL DSD+E   +++D++I  MF  K+ + ++          +     +  AT L           ++LE A++ A+KI+ Q+ LG   +D  Q    A+  GG I+        +  VS K +A Q AE+I+ KL Y+  +  E+E +  +    +++YEEELEINDF    R+++TSKE +  + EY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  284 GELMENDQDAMEYSSEEEEVDLQTALTGYQTKQRKILEPVDHQKIQYESYRKNFYVEVPELARMTPEEVNEYRLELEGITVKGKGCPKPIKTWVQCGTSMKVLNALKKHNYEKPTPIQSQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHILDQRPLEEGEGPIAVIMTPTRELALQITKECKKFSKPLGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLGANSGRVTNLRRVTYVVVDEADRMFDMGFEPQVMRIMDNVRPDRQTVMFSATFPRAMEALARRILNKPVEVQVGGRSVVCSDVEQHVIVIEEDKKFLKLLEILGHYQEKGSVIIFVDKQEHADGLLKDLMKASYPCMSLHGGIDQYDRDSIINDFKNGACRLMVATSVAARGLDVKQLILVVNYNCPNHYEDYVHRAGRTGRAGNKGFAYTFITDEQARYAGDIIKALELSGSAVPSELEQLWATFKEQQKAEGKIIKSSSGFSGKGFKFDETEHALANERKKLQKAALGLHDSDDEDTALDIDEQIESMFNSKKRVKDLTAPGSSAGVAAPGFTGATAATGLTGLAAPSAGNIQKLEIAKKLALKINAQKNLGAEAQDVMQQATNAIMRGGTII--------APSVSAKTIAEQLAEKINAKLNYTPVEKLEEERQAAEQAESIKRYEEELEINDFPQTARWKVTSKEALQRIGEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 1014          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Cavefish
Match: ddx46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:103041720])

HSP 1 Score: 665.996 bits (1717), Expect = 0.000e+0
Identity = 372/743 (50.07%), Postives = 504/743 (67.83%), Query Frame = 1
Query:  673 GEIMEDNIDAIXXXXXXXXXXXXXMSV---IAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYG-AEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLN---------KRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMK--DGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            GE+ME++ DA+EYS+EEEE  L++        ++  L  VDH KI Y+    NFY+EV EL +MTP EV++YR  L GI VKGK CPKPIKTW  CG S K++  LK H +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q P++ GEGPI+++M+PTRELA QI +E  K +    +R VC+YGGT ISEQ   L      +L C             GRVTN+RR T++V+DEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEALAR++LN P+E++VGG+S+VC DV Q+ ++++E +KF KLLE+LG YQE G VI+FV+KQE+AD L+  L++  Y C ++HGGIDQ DRDS I++FK G   L++ATSVAARGLDV  L LVVNY+CPNHYEDYVHR GRTGRAGNKG AYTF+T +Q +Y GD+IKA +LSG+  P +L   +  FKE+ K EGK + SSSGF GKGF+FDE E  LA ER+K ++  LGL DSD+E   +++D++I  MF  K+ + ++          +     +  AT L           ++LE A++ A+KI+ Q+ LG   +D  Q    A+  GG I+        +  VS K +A Q AE+I+ KL Y+  +  E+E +  +    +++YEEELEINDF    R+++TSKE +  + EY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  243 GELMENDQDAMEYSSEEEEVDLQTALTGYQTKQRKILEPVDHQKIQYESYRKNFYVEVPELARMTPEEVNEYRLELEGITVKGKGCPKPIKTWVQCGTSMKVLNALKKHNYEKPTPIQSQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHILDQRPLEEGEGPIAVIMTPTRELALQITKECKKFSKPLGLRVVCVYGGTGISEQNVFLTLCLCFVLGCL------------GRVTNLRRVTYVVVDEADRMFDMGFEPQVMRIMDNVRPDRQTVMFSATFPRAMEALARRILNKPVEVQVGGRSVVCSDVEQHVIVIEEDKKFLKLLEILGHYQEKGSVIIFVDKQEHADGLLKDLMKASYPCMSLHGGIDQYDRDSIINDFKNGACRLMVATSVAARGLDVKQLILVVNYNCPNHYEDYVHRAGRTGRAGNKGFAYTFITDEQARYAGDIIKALELSGSAVPSELEQLWATFKEQQKAEGKIIKSSSGFSGKGFKFDETEHALANERKKLQKAALGLHDSDDEDTALDIDEQIESMFNSKKRVKDLTAPGSSAGVAAPGFTGATAATGLTGLAAPSAGNIQKLEIAKKLALKINAQKNLGAEAQDVMQQATNAIMRGGTII--------APSVSAKTIAEQLAEKINAKLNYTPVEKLEEERQAAEQAESIKRYEEELEINDFPQTARWKVTSKEALQRIGEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 962          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Cavefish
Match: ddx42 (DEAD-box helicase 42 [Source:NCBI gene;Acc:103044432])

HSP 1 Score: 370.933 bits (951), Expect = 1.524e-112
Identity = 188/434 (43.32%), Postives = 275/434 (63.36%), Query Frame = 1
Query:  772 LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALIL-DETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLV 2070
            LP +DH++I Y     NFYIE +EL  +T  +V + R  L  ++V G   PKP  ++AH     ++M  ++  ++  PTPIQCQ +P  + GRD+IG+AKTGSGKT A++ P++ H+  Q  ++ G+GPI++++ PTREL  QI+ E  +      +R V +YGG  + EQ   L+ GAEI+VCTPGR+ID +     + T+++R T+LV DEADRMFDMGFE QV +I  HIRPDRQT++FSATF +K+E LAR +L +PI +  G      +DV+Q   +L + T+K+  L   L  +   G V++FV K+ N D L   L + GY    +HG +DQ +R+  IS+FK    P+L+AT VAARGLD+  +  VVNYD     + + HR GRTGRAG KGVAYT +T     + GD+++  + +  +  +DL+
Sbjct:  204 LPPIDHSEIDYPPFEKNFYIEHEELNSLTGTQVVELRQKLN-LRVSGAAPPKPCTSFAHFNFDEQLMNQIRKSEYTKPTPIQCQGVPIALGGRDMIGIAKTGSGKTAAFIWPMLVHIMDQKELEQGDGPIAVIVCPTRELCQQIHTECKRFGKVYGLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK---KATSLQRVTYLVFDEADRMFDMGFEYQVRSIASHIRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANEDVTQLVEVLPNGTDKWVWLTRRLVEFTSSGSVLIFVTKKANCDELATNLQQEGYSLGLLHGDMDQSERNKVISDFKKKSLPVLVATDVAARGLDIPSIRTVVNYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTQKDTTFAGDLVRNLEGANQSVSKDLL 633          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Cavefish
Match: ddx42 (DEAD-box helicase 42 [Source:NCBI gene;Acc:103044432])

HSP 1 Score: 370.933 bits (951), Expect = 1.534e-112
Identity = 188/434 (43.32%), Postives = 275/434 (63.36%), Query Frame = 1
Query:  772 LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALIL-DETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLV 2070
            LP +DH++I Y     NFYIE +EL  +T  +V + R  L  ++V G   PKP  ++AH     ++M  ++  ++  PTPIQCQ +P  + GRD+IG+AKTGSGKT A++ P++ H+  Q  ++ G+GPI++++ PTREL  QI+ E  +      +R V +YGG  + EQ   L+ GAEI+VCTPGR+ID +     + T+++R T+LV DEADRMFDMGFE QV +I  HIRPDRQT++FSATF +K+E LAR +L +PI +  G      +DV+Q   +L + T+K+  L   L  +   G V++FV K+ N D L   L + GY    +HG +DQ +R+  IS+FK    P+L+AT VAARGLD+  +  VVNYD     + + HR GRTGRAG KGVAYT +T     + GD+++  + +  +  +DL+
Sbjct:  198 LPPIDHSEIDYPPFEKNFYIEHEELNSLTGTQVVELRQKLN-LRVSGAAPPKPCTSFAHFNFDEQLMNQIRKSEYTKPTPIQCQGVPIALGGRDMIGIAKTGSGKTAAFIWPMLVHIMDQKELEQGDGPIAVIVCPTRELCQQIHTECKRFGKVYGLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK---KATSLQRVTYLVFDEADRMFDMGFEYQVRSIASHIRPDRQTLLFSATFRKKIEKLARDILIDPIRVVQGDIGEANEDVTQLVEVLPNGTDKWVWLTRRLVEFTSSGSVLIFVTKKANCDELATNLQQEGYSLGLLHGDMDQSERNKVISDFKKKSLPVLVATDVAARGLDIPSIRTVVNYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTQKDTTFAGDLVRNLEGANQSVSKDLL 627          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Cavefish
Match: ddx5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:103024726])

HSP 1 Score: 349.362 bits (895), Expect = 6.280e-108
Identity = 173/413 (41.89%), Postives = 255/413 (61.74%), Query Frame = 1
Query:  808 KVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVC-QDVSQNALILDETEKFNK--XXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFK 2037
            K   NFY E  ++ + TP EV +YR S   I VKG++CPKP+  +      S +M ++    + +PTPIQ Q  P  +SG+D++G+A+TGSGKT++YL+P + H+  QP ++ G+GPI +V++PTRELA Q+ +   +      ++  CIYGG     QI  L+ G EI + TPGR+ID +       TN+RRCT+LVLDEADRM DMGFEPQ+  I+  IRPDRQT+M+SAT+P+++  LA   L   ++I VG   +    ++ Q   + ++ EK +K   L    + ++  K I+FVE +   D L   +   G+    +HG   Q +RD  ++ FK G+ P+LIAT VA+RGLDV D+  V+N+D PN+ EDY+HR GRT R+   G AYTF TP+  K   D++   +
Sbjct:   55 KFEKNFYQEHPDVGRRTPQEVEQYRRSKE-ITVKGRECPKPVMRFHESNFPSYVMDVISKQNWTDPTPIQAQGWPLALSGQDMVGIAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAG---KTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINVGALQLSANHNILQIVDVCNDGEKEDKLLRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKSQQERDWVLNEFKFGKAPILIATDVASRGLDVEDVKFVINFDYPNNSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAHDLVSVLR 463          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Sea Lamprey
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 715.687 bits (1846), Expect = 0.000e+0
Identity = 423/860 (49.19%), Postives = 570/860 (66.28%), Query Frame = 1
Query:  358 IKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXX---------XYMKQLNKE-----FGSETTTVSQKGRSQIIKTVVK---KSKTEK--GEIMEDNIDAIXXXXXXXXXXXXXMSVIAKKDK----LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEEV---NLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGED----EMKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            +++R+ER+E+WR+ QK+K    I + K +    ++    KKW+LEDD  ++++    G  E+     +          +M+ + +E      G   T   + G S      V    +S+ EK  GE+ME++ DA+EYS+EEE+  L +      ++K    + VVDH+KI Y+    NFY+EV EL KMT  EVS YR  + G+ VKGK CPKPIKTW  CG+S KI+  LK   +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+ +L+P+ RHV  Q P++ GEGPI ++M+PTRELA QI +E  K T    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+A N GRVTN RR T++VLDEADRMFDMGFEPQV+ I+   RPDRQTVMFSATFPR MEALAR++LN P+E++VGG+S+VC DV Q+ ++++E  KF KLLELLGLYQE G VIVFV+KQE+AD L+  L++  Y C ++HGGIDQ DRDS I++FK+G   L++ATSVAARGLDV  L +VVNYDCPNHYEDYVHR GRTGRAGNKG +YTF+T +QE+Y GD+IKA +LSG   P DL   + +F+E+ K EGK +  SSGF GKGF+FDE E  L  ER+K ++  LG+ DSDEE    ++D +I +MF  K+ + +V+       A  A++      +    ++LE A++ A KI+ QR LG    D  Q    ++  GG +        N   VS K +A Q AE+I+ KL Y  ++   +    E +   + VR+YEEELEINDF    R+++TSKE +  +SEY +  +++RG Y       K   +GER +YL++ES S
Sbjct:  156 MRKRKERIEKWREEQKKKAHINIGDIKTQVELMSKQR--KKWSLEDDGTDEDDDEGEGEDEDGVVDDDDDDGVDPLDAFMEGIKEEVKKFNMGDAKTGEKKAGSSVTKVVTVVTKKQSEVEKPKGELMENDQDAMEYSSEEEDSDLATALTGYNQNKQRKMVEVVDHSKIAYEPFRRNFYVEVPELAKMTAEEVSAYRLEMEGVMVKGKGCPKPIKTWVQCGISMKILNTLKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIGFLLPMFRHVMDQRPLEEGEGPIGVIMTPTRELALQIAKECRKFTKQLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNFRRATYMVLDEADRMFDMGFEPQVMRIIETSRPDRQTVMFSATFPRAMEALARRILNKPVEVQVGGRSVVCSDVEQHVIVIEEDTKFYKLLELLGLYQEKGAVIVFVDKQEHADTLLKDLMKASYPCLSLHGGIDQYDRDSIINDFKSGVCRLMVATSVAARGLDVKHLIMVVNYDCPNHYEDYVHRVGRTGRAGNKGYSYTFITSEQERYSGDIIKALELSGTPLPPDLERLWTEFREKQKAEGKTMRKSSGFSGKGFKFDETEHSLVNERKKLQKVALGMHDSDEEEGSGDIDQQIENMFRSKKIVKDVN-------AHGASSTGIMMPSGSNAQKLEIAKRLASKINSQRNLGTEAMDVIQQATNSIMRGGTM--------NVPLVSAKSIAEQLAEKINAKLNYVPAEKLLEEERVEQEKQADKVRRYEEELEINDFPQTARWKVTSKEALAQISEYSEAAITIRGSYFAP---GKEPTDGERKIYLAIESTS 995          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Sea Lamprey
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 356.681 bits (914), Expect = 8.369e-110
Identity = 178/429 (41.49%), Postives = 267/429 (62.24%), Query Frame = 1
Query:  766 DKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALIL-DETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGA 2049
            D LP +DH++I Y+    NFY+E +E+  +  +E  + +      +V G   PKP  ++ H G   +++ +++  +F  PTPIQCQ IP  +SGRD+IG+AKTGSGKT +++ P++ H+ AQ  ++ G+GPI ++  PTREL  QI  E  +      +  V +YGG  + EQ   L+ GAEI+VCTPGR+ID +     + TN++R T+LV DEADRMFDMGFE QV +I  H+RPDRQT+++SATF  ++E LAR +L +PI +  G      +DV+Q   I  +   K+N L   L  +   G V++FV +++N++ L   L + G+    +HG +DQ +R+  IS+FK    P+++AT VAARGLD+  +  VVNYD     + + HR GRTGRAG KG A+T +T     + GD+++   L GA
Sbjct:  198 DPLPSIDHSEIEYEPFDKNFYVEHEEISSLGASEAHELK-----AQVSGAAPPKPCSSFGHFGFDEQLLNLIRKSEFTQPTPIQCQGIPIALSGRDIIGIAKTGSGKTASFIWPMLVHIMAQKELKPGDGPIGLICVPTRELCQQINVECKRFGKAYNLHSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVK---KKATNLQRVTYLVFDEADRMFDMGFEYQVRSIANHVRPDRQTMLYSATFRMRVEKLARDILIDPIRVVQGDIGEANEDVTQRVEIFSNGAAKWNWLCSHLVEFTSSGSVLIFVTRKDNSEELSNDLEQEGFQVGLLHGDMDQSERNKVISDFKKKVIPIMVATDVAARGLDIPSIKTVVNYDVARDIDTHTHRVGRTGRAGEKGTAFTLMTHKDMNFAGDLVR--NLEGA 616          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 289.271 bits (739), Expect = 3.774e-87
Identity = 157/389 (40.36%), Postives = 234/389 (60.15%), Query Frame = 1
Query:  898 IKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPV----------------QSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGH----IRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQE 2004
            ++  G DCP  I+++    +   IM+ + + ++  PTP+Q  AIP I + RD++  A+TGSGKT A+L+P++  + +  P                 Q  + P+S+V++PTRELA QIY E  K      +R   +YGG  I  Q+ +L+ G  +LV TPGR++DMM    G+V  +  C +LVLDEADRM DMGFEPQ+  I+       + DRQT+MFSATFP++++ LAR  L + I + VG      ++++Q  + ++E +K + LL+LL         +VFVE ++ AD L   L   GY C ++HG   Q DR+  +S F+TGR P+L+AT+VAARGLD+ ++  V+N+D P+  E+YVHR GRTGR GN G A +F     E
Sbjct:   47 VEATGNDCPPHIESFHELELGEIIMSSVTLCRYERPTPVQKYAIPIIKAKRDLMACAQTGSGKTAAFLLPILSQIYSGGPGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEARKFAYRSCVRPCVVYGGADIGNQVRELQKGCHLLVATPGRLVDMM--ERGKV-GLDHCRYLVLDEADRMLDMGFEPQIRRIVEQDVMPTKGDRQTLMFSATFPKEIQILARDFLEDYIFLAVGRVGSASENITQKVVWVEEMDKRSFLLDLLNATGRDSLTLVFVETKKGADALQGFLCSEGYSCTSIHGDRSQRDREEALSLFRTGRRPILVATAVAARGLDIPNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGQATSFYNEKNE 432          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Sea Lamprey
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 290.426 bits (742), Expect = 1.967e-85
Identity = 163/420 (38.81%), Postives = 234/420 (55.71%), Query Frame = 1
Query:  898 IKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQ----SGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHI-----RPD---------------------RQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGAT--PPE 2061
            I  KG   P PI+ W    + S I  +++   + +PTPIQ QAIP  +  RD+IG+A+TGSGKT A+LIPL+  +   P +     + +GP +++++PTRELA QI  E +K      IR V + GG    +Q  +L+ G +I++ TPGR+ID++     R   + RCT++VLDEADRM DMGFEP V  IL H+     +PD                     RQTVMF+AT P  +E LAR  L  P  + +G      + V Q   I+ E+EK  K L  L        +I+FV +++  D L   L + G+    +HGG  Q+ R+  +SN K G   +L+AT VA RG+D+ D+++V+NYD   + EDY HR GRTGRAG  GV+ TF+T +      D+ +A   S  +  PPE
Sbjct:  308 ITTKGGKIPNPIRLWKESILPSHIREVIEKCGYKDPTPIQRQAIPIGLQNRDIIGIAETGSGKTAAFLIPLLVWITTLPKIDRIEDTDQGPYAVILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCKIVIATPGRLIDVLE---NRYLVLSRCTYVVLDEADRMIDMGFEPDVQRILEHMPVSNQKPDTDDAEDPDKMTANFESGRHKYRQTVMFTATMPAAVERLARSYLRRPAVVYIGSVGKPIERVEQRVFIMGESEK-RKKLLELLSRGFEPPIIIFVNQKKGCDVLAKSLEKMGFNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVSMVLNYDMAKNIEDYTHRIGRTGRAGKSGVSVTFLTKEDAAVFYDLKQAMLGSPVSQCPPE 723          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000216.1 (pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-1 gene:ENSPMAG00000000186.1 transcript:ENSPMAT00000000216.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 211.075 bits (536), Expect = 3.108e-60
Identity = 116/331 (35.05%), Postives = 185/331 (55.89%), Query Frame = 1
Query: 1000 NPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVT 1992
             PT IQ +AIP  + G+D+IG+A+TGSGKT A+ +P+++ +   P     +   ++V++PTRELA QI  +   L +   I+   + GG  +  Q   L     +++ TPGR++D +    G   N+R   +LV+DEADR+ +M FE +V  IL  I  +R+T +FSAT  +K++ L R  L  P++  V  K    + + Q  + +    K +  L  +     G   I+F     N  R+  LL   G+    +HG + Q+ R   ++ FK     +L+AT VA+RGLD+  +++V+N+D P H +DY+HR GRT RAG  G + TFV+
Sbjct:   17 QPTKIQVEAIPVALQGKDIIGLAETGSGKTGAFALPILQALLDAP-----QRLFALVLTPTRELAFQISEQFEALGSSIGIKSAVVVGGIDMMSQSLALAKKPHVIIATPGRLVDHLENTKG--FNIRALKYLVMDEADRILNMDFETEVDKILKVIPKERKTYLFSATMTKKVQKLQRAALKEPVKCSVSTKYQTVEKLQQYYVFIPAKFK-DSYLVYILNELAGNSFIIFCSTCNNTQRIALLLRNLGFTAIPLHGQMSQNKRLGSLNKFKGKARSILLATDVASRGLDIPHVDVVINFDIPTHSKDYIHRVGRTARAGRSGKSITFVS 339          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Yeast
Match: DBP2 (ATP-dependent RNA helicase of the DEAD-box protein family; has strong preference for dsRNA; interacts with YRA1; required for assembly of Yra1p, Nab2p and Mex67p onto mRNA and formation of nuclear mRNP; involved in mRNA decay and rRNA processing; may be involved in suppression of transcription from cryptic initiation sites [Source:SGD;Acc:S000005056])

HSP 1 Score: 355.91 bits (912), Expect = 3.308e-112
Identity = 178/427 (41.69%), Postives = 270/427 (63.23%), Query Frame = 1
Query:  820 NFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSI-VCQDVSQNALILDETEKFNKXXX--XXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAF--KLSGATPPEDLVVAYDK 2085
            NFY+E + ++  + +E++++R     + + G D PKPI T+   G    ++  +K   F  PT IQCQ  P  +SGRD++G+A TGSGKT++Y +P + H+ AQP +  G+GPI +V++PTRELA QI  E  K  +   IR  C+YGG   S+QI  L  G+EI++ TPGR+IDM+ +     TN++R T+LVLDEADRM DMGFEPQ+  I+  IRPDRQT+M+SAT+P++++ LA   LN+PI+++VG   +    +++Q   ++ + EK ++L +           K ++F   +   D +   L E G+   A+HG  DQ +RD  +  F+ GR+P+++AT VAARG+DV  +N V+NYD P + EDYVHR GRTGRAG  G A +F T +Q K +G  + +   + +   PPE  ++ YD+
Sbjct:   76 NFYVEHESVRDRSDSEIAQFRKE-NEMTISGHDIPKPITTFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIATPGRLIDMLEIGK---TNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLETASQDNEYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFT-EQNKGLGAKLISIMREANQNIPPE--LLKYDR 495          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Yeast
Match: PRP5 (RNA helicase in the DEAD-box family; necessary for prespliceosome formation, bridges U1 and U2 snRNPs and enables stable U2 snRNP association with intron RNA [Source:SGD;Acc:S000000441])

HSP 1 Score: 351.288 bits (900), Expect = 5.166e-107
Identity = 189/468 (40.38%), Postives = 279/468 (59.62%), Query Frame = 1
Query:  793 KIYY-----QKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTIL--KMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGE-GPISIVMSPTRELACQIYREILKLTNG-KEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALIL-DETEKFNKXXX-------------------XXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQE 2109
            +IYY     +    NFYIE + +  M+  EV + R SL  IK+KG  CPKP+  W+  G+S+  M ++  K+H F + TPIQ QA+PAIMSGRDVIG++KTGSGKT++YL+PL+R VKAQ P+   E GP+ ++++PTRELA QI+ E+ K T     IR VC  GG+ + +QI  LK G EI+V TPGR ID++ +N G++ + +R TF+V+DEADR+FD+GFEPQ+  I+  +RPD+Q V+FSATFP K+ + A +VL++PI I +  K +V ++V Q   I   E EKF+ L++                      + +   K I+FV  Q   D +   L+  G +  A+H G    +R   +  FK  +N +L+ T V +RGL+V +++LV+ Y+    +  YVH  GRT R    G A T +  D+      +  A+ LS A   E+ + A D  + +  QE
Sbjct:  203 QIYYSPEELEPFQKNFYIESETVSSMSEMEVEELRLSLDNIKIKGTGCPKPVTKWSQLGLSTDTMVLITEKLH-FGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPMGLILAPTRELALQIHEEVTKFTEADTSIRSVCCTGGSEMKKQITDLKRGTEIVVATPGRFIDILTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATFPNKLRSFAVRVLHSPISITINSKGMVNENVKQKFRICHSEDEKFDNLVQLIHERSEFFDEVQSENDGQSSDVEEVDAKAIIFVSSQNICDFISKKLLNAGIVTCAIHAGKPYQERLMNLEKFKREKNSILLCTEVLSRGLNVPEVSLVIIYNAVKTFAQYVHTTGRTARGSRSGTAITLLLHDE------LSGAYILSKAMRDEE-IKALDPLQAKELQE 662          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Yeast
Match: DBP1 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs; protein abundance increases in response to DNA replication stress; DBP1 has a paralog, DED1, that arose from the whole genome duplication [Source:SGD;Acc:S000006040])

HSP 1 Score: 270.396 bits (690), Expect = 1.227e-79
Identity = 149/386 (38.60%), Postives = 223/386 (57.77%), Query Frame = 1
Query:  898 IKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHV----------KAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIR----PDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYI 2013
            +   GKD P+PI  ++   +   +M  +K+  F  PTP+Q  +IP +  GRD++  A+TGSGKT  +L PL   +          KAQ        P ++V++PTRELA QI+ E  K T    +R   +YGG  I  Q+ ++  G ++LV TPGR+ D++      + N++   +LVLDEADRM DMGFEPQ+  I+         +RQT+MFSATFP  ++ LAR  L+N I + VG      ++++Q  L +D+ +K    L  L   +  G  ++FVE +  AD+L   LI + +   A+HG   Q +R+  +S FK     +L+AT+VAARGLD+ ++  V+NYD P+  +DYVHR GRTGRAGN GVA +F   + +  +
Sbjct:  142 VDASGKDVPEPILDFSSPPLDELLMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANIK---YLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDDMDK-KSALLDLLSAEHKGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFNSNNQNIV 523          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 269.24 bits (687), Expect = 2.214e-79
Identity = 144/386 (37.31%), Postives = 228/386 (59.07%), Query Frame = 1
Query:  898 IKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRH-VKAQP-PVQSGEG--------PISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGH--IRP--DRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYI 2013
            +   GKD P+PI  +    +   ++  +K+ +F  PTP+Q  ++P + +GRD++  A+TGSGKT  +L P++    K  P P    +G        P +++M+PTRELA QI+ E  K T    ++   +YGG+ I  Q+ +++ G ++LV TPGR+ D++      + N++   +LVLDEADRM DMGFEPQ+  I+    + P  +RQT+MFSATFP  ++ LAR  L++ I + VG      ++++Q  L ++  +K    L  L      G  ++FVE +  AD+L   LI + +   A+HG   Q +R+  ++ F++G   LL+AT+VAARGLD+ ++  V+NYD P+  +DYVHR GRTGRAGN G+A  F   +    +
Sbjct:  130 VDASGKDVPEPITEFTSPPLDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVK---YLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVENQDK-KSALLDLLSASTDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAFFNSENSNIV 511          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Yeast
Match: DBP3 (RNA-Dependent ATPase, member of DExD/H-box family; involved in cleavage of site A3 within the ITS1 spacer during rRNA processing; not essential for growth, but deletion causes severe slow-growth phenotype [Source:SGD;Acc:S000003046])

HSP 1 Score: 262.692 bits (670), Expect = 7.061e-78
Identity = 156/428 (36.45%), Postives = 250/428 (58.41%), Query Frame = 1
Query:  811 VHTNFYIEVDELKKMTPNEVSKY-RNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPD-RQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQD--VSQNALILDETEKFNKXXXXXXXXXX----XXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLV 2070
            V + FY++ + L  +  +++ +Y + +   ++       +P+ ++ +  + S I    ++ KF  PTPIQ  A P ++SG+DV+GVA+TGSGKT A+ +P + H+      Q   G   +V+SPTRELA QIY  ++ LT+   ++C C+YGG    EQ  +LK  ++++V TPGR++D++    G V ++ +  +LVLDEADRM + GFE  +  I+       RQT+MF+AT+P+++  LA   +NNPI++ +G    +  +  ++Q   ++D   K  KLLELL  Y        KV++F   ++ A R+   L   GY  AA+HG + Q  R   ++ FK+G++ LL+AT VAARGLD+ ++  V+N   P   EDYVHR GRTGRAG  G A+T  T  ++   G ++     +    PEDL+
Sbjct:   72 VASEFYVQSEALTSLPQSDIDEYFKENEIAVEDSLDLALRPLLSFDYLSLDSSIQA--EISKFPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMND---QKKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQRIQLK-KSQVVVATPGRLLDLL--QEGSV-DLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPKEVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKKYHSGPKKNEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQEKHLAGGLVNVLNGANQPVPEDLI 490          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Nematostella
Match: EDO42894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S034])

HSP 1 Score: 688.337 bits (1775), Expect = 0.000e+0
Identity = 392/750 (52.27%), Postives = 508/750 (67.73%), Query Frame = 1
Query:  634 IIKTVVKKSKT-----EKGEIMEDNIDAIXXXXXXXXXXXXXMSVIA-----KKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEEVNLDDKIID--MFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            I   VVKK +      +KGE+ME +IDA+EYS+EEE+E  +  S  A     KK +L  VDH  + YQ    +FY+EV EL KMTP E  ++R SL  I V+GK+ PKP+KTWA  GV  KI+ +LK + +  PTPIQ QAIP IMSGRD+IG+AKTGSGKT+A+LIP+ RH+K QPP++  EGPI+IVM+PTRELA QI+RE  K      +RCVC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+  N GRVTN +RCT+LVLDEADRMFDMGFEPQV+ I+  IRPDRQTVMFSATFPR+MEALARK+L+ PIEI+VGG+S+VC DV QN ++++E +KF KLLELLGLYQE G V+VFVEKQ++AD L   L++R Y C ++HGG+DQ DRDS I++FK G   L+IATSVAARGLDV  LNLVVNYDCPNHYEDYVHR GRTGRAGNKG AYTF+TP+Q ++  DVIKA +++    PED+    + + E  K EGK +  +SGF GKGF+F++ E     E +K ++  LGL+DSD+E   ++K ID  + AV     +V +       P+       QA      +   A   A KI+ +   G    D TQ  A  +  GG +            ++G DLA Q A+++H KL Y        E ++      +YE+E+EIN+F    R+++TSKET+  ++EY +  V+VRG Y P     K  + GER +YL +E  S
Sbjct:   27 ITHVVVKKPEVTEKSEKKGELMEGDIDAMEYSSEEEKEEEDLESTYAGYKTKKKKELQPVDHKTVVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILDVLKKNSYEKPTPIQAQAIPVIMSGRDMIGIAKTGSGKTLAFLIPMFRHIKDQPPLEREEGPIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLTANNGRVTNCQRCTYLVLDEADRMFDMGFEPQVMRIIDCIRPDRQTVMFSATFPRQMEALARKILDKPIEIQVGGRSVVCSDVEQNVVVIEEDDKFLKLLELLGLYQEQGSVLVFVEKQDSADSLFKDLLKRSYPCLSLHGGMDQFDRDSTIADFKNGVTKLMIATSVAARGLDVKHLNLVVNYDCPNHYEDYVHRVGRTGRAGNKGTAYTFLTPEQGRFAIDVIKALEMAENPVPEDVRNLANTYIETRKAEGKNIVKNSGFSGKGFKFNDEEKAKVSEAKKIQKWALGLQDSDDEAEAEEKAIDKRLDAVFSKKPHVKKVVPQVGEPAVKREGEQQA------KFNLASSIAAKINQKISAGTNNLDPTQQAASQIIKGGTV----------TALTGLDLAKQLAQKVHTKLNYEGPQEEVKEKEEEKQEAERYEDEVEINEFPQTARWKITSKETIMTITEYSECAVTVRGTYFPP---GKEPKEGERKIYLYIEGPS 757          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Nematostella
Match: EDO43557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY08])

HSP 1 Score: 355.525 bits (911), Expect = 6.533e-112
Identity = 183/436 (41.97%), Postives = 268/436 (61.47%), Query Frame = 1
Query:  766 DKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDET-EKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLV 2070
            + LP VDH++I Y+  + NFY E  E+ K +  E+   R  +G IKV G    +P  ++AH G   ++M  ++  ++  PT IQCQA+P  +SGRD+IG+AKTGSGKT A+L P + H+  QP +Q G+GPI ++ +PTREL  QIY E  +      I  V ++GG    EQ   L+ GAEI+V TPGR+ID +     + TN+ R T+LV DEADRMFDMGFEPQV +I  ++RPDRQT++FSATF +K+E L R +L +P+ + +G      +DV+Q   I +    K+  L + L  +   G V++FV K+ N++ L   L +  +  A +HG +DQ +R   +  FK    P+L+AT VAARGLD+  +  V+NYD       + HR GRTGRAG KG AYT +T   + + GD+++  +++    PE L+
Sbjct:   51 EPLPRVDHSEIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMG-IKVSGAMPARPCISFAHFGFDEQMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFGKAYNIHVVAVFGGGNKYEQSKALQEGAEIVVATPGRLIDHVK---AKATNLHRVTYLVFDEADRMFDMGFEPQVRSIANNVRPDRQTLLFSATFKKKVEHLCRDILVDPVRVVIGELGEANEDVTQIVHIFNSMPSKWEWLTQNLVSFASAGSVLIFVTKKLNSEELATNLRKNDFEVALLHGDMDQFERSKVLGQFKKREIPILVATDVAARGLDIPSIKTVINYDVARDITTHTHRIGRTGRAGEKGNAYTLLTQSDQNFAGDLVRNLEIANQVVPESLM 482          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Nematostella
Match: EDO38061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX5])

HSP 1 Score: 331.257 bits (848), Expect = 7.912e-104
Identity = 174/424 (41.04%), Postives = 256/424 (60.38%), Query Frame = 1
Query:  775 PVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVC-QDVSQNALILDETEKFNKXXXXXXXXX--XXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFK 2037
            P  D N +  QK   NFY E   ++    +EV  YR S   + V G++ PKP+ T+        I +  K   F  PT IQ Q  P  ++GR+++G+A+TGSGKT+++++P + H+  QP +Q G+GPI +V+ PTRELA Q+      +    ++R  CIYGG     QI +L+ G EI + TPGR+IDM+     R TN+RRCT+LVLDEADRM DMGFEPQ+ TI+  IRPDRQT+M+SAT+P++++ LA   L++ + I VG   +     + Q   + ++ EK +KLL+LL      +  K ++F E +  AD L   L   G+    +HG   Q +RD  +S F+ G  P+L+AT VA+RGLD++D+  V+N+D PN  EDYVHR GRT R+   G +YTF T +  K   +++   +
Sbjct:    8 PRWDMNSL--QKFEKNFYREHPVVQARGQHEVDAYRRS-KDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQGWPVALTGRNLVGIAQTGSGKTLSFILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELERGVEICIATPGRLIDMLE---SRKTNLRRCTYLVLDEADRMLDMGFEPQIRTIIDQIRPDRQTLMWSATWPKEVQGLAHDFLSDYVHITVGSLGLTANHKILQIVDVCEDHEKEHKLLKLLEEIMGEKENKTLIFTETKRRADELTRKLRSDGWPAMCIHGDKAQPERDWVLSEFRKGHAPILVATDVASRGLDISDIKFVINFDFPNCTEDYVHRIGRTARSDRTGTSYTFFTVNNAKQAKELVSVLQ 425          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Nematostella
Match: EDO43602 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYA5])

HSP 1 Score: 291.197 bits (744), Expect = 3.106e-85
Identity = 158/411 (38.44%), Postives = 234/411 (56.93%), Query Frame = 1
Query:  844 LKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQ----SGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGH-----IRPD-------------------RQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVT 1992
            L++MT  +   +R     I  KG   P PI+ W    +   I+ I+    + +PTPIQ QAIP  +  RD+IGVA+TGSGKT A+ IPL+  +   P ++    + +GP +++++PTRELA QI  EILK      IR V + GG    +Q  +L+ G EI++ TPGR+ID++     R   + RC+++V+DEADRM DMGFEP+V  IL H     ++PD                   RQTVMF+AT P ++E LA+  L  P  + +G      + V Q   +++E +K  K L  L        +I+FV +++ AD L   L + G+    +HGG +Q+ R+  +S+ K G   +L+AT VA RG+D+ D++ V+NYD     EDY HR GRTGRAG  G+A +F+T
Sbjct:  321 LEEMTERDWRIFREDFN-ISTKGGRIPFPIRKWKEAQIPDSILEIVDKLGYKDPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFAIPLLVWIMGLPKIERDNDADQGPYALILAPTRELAQQIEEEILKFGRPLGIRTVSVIGGLSREDQGFQLRLGVEIVIATPGRLIDVLE---NRYLVLNRCSYIVMDEADRMIDMGFEPEVQKILEHLPVSNVKPDSEDSEDPEHLLTHMGKDKYRQTVMFTATMPPQVERLAKNYLRRPAVVYIGSVGKPVERVEQRVYLVNEQQK-RKKLLELLNKDLEPPIIIFVNQKKGADVLAKSLEKMGFRATTLHGGRNQEQREFALSSLKGGSKDILVATDVAGRGIDIKDVSHVINYDMAKTIEDYTHRIGRTGRAGKTGIAVSFLT 726          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Nematostella
Match: EDO37956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE71])

HSP 1 Score: 275.018 bits (702), Expect = 2.862e-83
Identity = 150/400 (37.50%), Postives = 237/400 (59.25%), Query Frame = 1
Query:  820 NFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRC----VCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILG---HIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPD 1998
            ++Y E +++ +++   V + R    GI ++G+DCPKPI+++    +  ++ T L    F  PTPIQ Q++  +MSGRD+IG+A+TGSGKT+AY +PL   ++ + P   G+ P++++++PTREL  Q++  + ++ +   IRC    VC  GG  +S Q   L+ GA+++V TPGR++D+          + + T+LV+DEADRM  MG E Q+  I+G        RQT+++SAT P  +E LAR  + NPI I+VG   ++   V QN + L   +K  K L           VIVF    +N D +  LL +  +  + +H    QD R   +  F+ G+  +L+AT VA+RGLD  ++  V+NYD P+  E Y+HRCGRTGR G+ G+A +F+T D
Sbjct:    3 SYYDENEKVSRLSDEVVDEIRWK-NGIHIEGEDCPKPIESFHDLNLPPELSTYLAKKNFQVPTPIQMQSLSCVMSGRDIIGLAETGSGKTLAYSLPLCMLLRTKAPSNPGDTPVALILTPTRELMQQVFMNVSEMLD--VIRCPGNPVC--GGVPVSTQTIALREGADVVVATPGRLLDLCKRGA---LCLDKITYLVMDEADRMLGMGMEEQLRKIVGLATGTSRARQTLLWSATLPESLERLARSAVLNPITIQVGPGGLIAPSVQQNVVFLYHYQKPQK-LLETLRTTPYPPVIVFTSSIQNVDYVTELLKQEQFHASGLHSEKPQDYRFKLVKAFRDGKVDILVATDVASRGLDFPEVTHVINYDLPDTIECYIHRCGRTGRIGHHGIATSFLTLD 393          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Medaka
Match: ddx46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:101161571])

HSP 1 Score: 727.628 bits (1877), Expect = 0.000e+0
Identity = 450/903 (49.83%), Postives = 613/903 (67.88%), Query Frame = 1
Query:  340 HECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXX-XXXYMKQLNKEFG----SETTTVSQKGRSQIIKTVVKK-------SKTEKGEIMEDNIDAIXXXXXXXXX-XXXXMSVIAKKDK--LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNV----------DRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDG--LNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVSXXXXXXXXXXXXXXXXXXXXXXXXVGHTVVQGRYKVV 2958
            ++ EE +++R+ERVE+WR+ Q++K  + I E K +     E   GKKW+LEDD+D+++        EE+E   L+ YM+++ +E      S+     +KG   + K V          +  +KGE+ME++ DA+EYS+EEEE     +++    K +  L  VDH KI Y+    NFY+EV EL KMT  EV+ YR  L GI VKGK CPKPIKTW  CGVS KI++ LK   +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q P++  EGPIS++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+  N GRVTN+RR T++VLDEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEALAR++L+ PIE++VGG+S+VC DV Q+ L+++E +KF KLLE+LG YQE G VI+FV+KQE+AD L+  L++  Y C ++HGGIDQ DRDS I++FK G   L++ATSVAARGLDV  L LVVNY+CPNHYEDYVHR GRTGRAGNKG AYTF+T DQ +Y GD+IK  +LSGA  P +L   +  FK++ K EGK + SSSGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   ++++++I  MF  K+ + ++             S   ++P    +    A +  N++LE A++ A+KI+ Q+ LG   +D  Q    A+  GG I+        S  VS K +A Q AE+I+ KL Y+  +  E+E +       VR+YEEELEINDF    R+++TSKE +  + EY +  +++RG Y P     K  + GER +YL++ES +E+ +Q AK EI R+IKEEL++LQ       +GRYKV+
Sbjct:   67 NKLEEEMRKRKERVEKWREEQRKKAIENIGEIKKEL---EEMKQGKKWSLEDDEDQEKETPMEQQAEEDEVDPLDAYMEEVKQEVKKFNMSDMKGNDKKGAMMVTKVVTVVKTKKGAGTHKKKGELMENDQDAMEYSSEEEEVDLQTALTGFQTKQRKILEPVDHAKIQYEPYRKNFYVEVPELAKMTTEEVNAYRLELEGIMVKGKGCPKPIKTWVQCGVSMKILSALKKQGYDKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRPLEESEGPISVIMTPTRELALQITKECKKFSKALGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLGANSGRVTNLRRATYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQHVLVIEEDQKFLKLLEILGHYQEKGSVIIFVDKQEHADGLLKDLMKASYPCLSLHGGIDQYDRDSIINDFKNGVCRLMVATSVAARGLDVKQLILVVNYNCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQVRYAGDIIKGLELSGAPVPPELEQLWASFKDQQKAEGKTIKSSSGFSGKGFKFDETEHALANERKKLQKAALGLQDSDDEDGALDIEEQIESMFNSKKRVKDLSAPGAAGGGGGVVSSSAASPGGFGMTPTSAGN--NQKLEMAKKLALKINAQKNLGAEAQDVMQQATNAILRGGPIV--------SPSVSAKTIAEQLAEKINAKLNYTPVEKLEEERQSAEQAETVRRYEEELEINDFPQTARWKVTSKEALQRIGEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESANELAVQKAKTEITRLIKEELIRLQNSYQPTSKGRYKVL 953          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Medaka
Match: ddx46 (DEAD-box helicase 46 [Source:NCBI gene;Acc:101161571])

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 393/744 (52.82%), Postives = 521/744 (70.03%), Query Frame = 1
Query:  670 KGEIMEDNIDAIX-XXXXXXXXXXXXMSVIAKKDK--LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEE---VNLDDKIIDMFAVKRNITNV----------DRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDG--LNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVS 2847
            KGE+ME++ DA+E  S EEE +   +++    K +  L  VDH KI Y+    NFY+EV EL KMT  EV+ YR  L GI VKGK CPKPIKTW  CGVS KI++ LK   +  PTPIQ QAIPAIMSGRD+IG+AKTGSGKT+A+L+P+ RH+  Q P++  EGPIS++M+PTRELA QI +E  K +    +R VC+YGGT ISEQIA+LK GAEI+VCTPGRMIDM+  N GRVTN+RR T++VLDEADRMFDMGFEPQV+ I+ ++RPDRQTVMFSATFPR MEALAR++L+ PIE++VGG+S+VC DV Q+ L+++E +KF KLLE+LG YQE G VI+FV+KQE+AD L+  L++  Y C ++HGGIDQ DRDS I++FK G   L++ATSVAARGLDV  L LVVNY+CPNHYEDYVHR GRTGRAGNKG AYTF+T DQ +Y GD+IK  +LSGA  P +L   +  FK++ K EGK + SSSGF GKGF+FDE E  LA ER+K ++  LGL+DSD+E   ++++++I  MF  K+ + ++             S   ++P    +    A +  N++LE A++ A+KI+ Q+ LG   +D  Q    A+  GG I+        S  VS K +A Q AE+I+ KL Y+  +  E+E +       VR+YEEELEINDF    R+++TSKE +  + EY +  +++RG Y P     K  + GER +YL++ES +
Sbjct:  296 KGELMENDQDAMEYSSEEEEVDLQTALTGFQTKQRKILEPVDHAKIQYEPYRKNFYVEVPELAKMTTEEVNAYRLELEGIMVKGKGCPKPIKTWVQCGVSMKILSALKKQGYDKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIAFLLPMFRHIMDQRPLEESEGPISVIMTPTRELALQITKECKKFSKALGLRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLGANSGRVTNLRRATYVVLDEADRMFDMGFEPQVMRIVDNVRPDRQTVMFSATFPRAMEALARRILSKPIEVQVGGRSVVCSDVEQHVLVIEEDQKFLKLLEILGHYQEKGSVIIFVDKQEHADGLLKDLMKASYPCLSLHGGIDQYDRDSIINDFKNGVCRLMVATSVAARGLDVKQLILVVNYNCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQVRYAGDIIKGLELSGAPVPPELEQLWASFKDQQKAEGKTIKSSSGFSGKGFKFDETEHALANERKKLQKAALGLQDSDDEDGALDIEEQIESMFNSKKRVKDLSAPGAAGGGGGVVSSSAASPGGFGMTPTSAGN--NQKLEMAKKLALKINAQKNLGAEAQDVMQQATNAILRGGPIV--------SPSVSAKTIAEQLAEKINAKLNYTPVEKLEEERQSAEQAETVRRYEEELEINDFPQTARWKVTSKEALQRIGEYSEAAITIRGTYFPP---GKEPKEGERKIYLAIESAN 1026          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Medaka
Match: ddx42 (DEAD-box helicase 42 [Source:NCBI gene;Acc:101174023])

HSP 1 Score: 374.4 bits (960), Expect = 1.734e-114
Identity = 188/427 (44.03%), Postives = 273/427 (63.93%), Query Frame = 1
Query:  772 LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNA-LILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGA 2049
            LP +DH++I Y     NFY E +EL  +T ++V + R  L  ++V G   PK   ++AH G   ++M  ++  ++  PTPIQCQ +P  +SGRD+IG+AKTGSGKT A++ P++ H+  Q  ++ GEGPI++++ PTREL  QI+ E  +      +R V +YGG  + EQ   L+ GAEI+VCTPGR+ID +     + T+++R T+LV DEADRMFDMGFE QV +I  H+RPDRQT++FSATF +K+E LAR +L +PI +  G      +DV+Q   ++L  ++K+  L   L  +   G V++FV K+ N+D L   L + GY    +HG +DQ +R+  IS+FK    P+L+AT VAARGLD+  +  VVNYD     + + HR GRTGRAG KGVAYT +T     + GD+++   L GA
Sbjct:  183 LPPIDHSEIDYPPFEKNFYNEHEELSSLTGSQVVELRQKLN-LRVSGAAPPKLCTSFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPIALSGRDMIGIAKTGSGKTAAFIWPMLVHIMDQKELEPGEGPIAVIVCPTRELCQQIHAECKRFGKAYSLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK---KATSLQRVTYLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIERLARDILVDPIRVVQGDIGEANEDVTQVVEILLSGSDKWAWLTRRLVEFTSAGSVLIFVTKKANSDELAANLTQEGYSLGLLHGDMDQSERNKVISDFKKKNLPILVATDVAARGLDIPSIRTVVNYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTNKDTSFAGDLVR--NLEGA 603          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Medaka
Match: ddx42 (DEAD-box helicase 42 [Source:NCBI gene;Acc:101174023])

HSP 1 Score: 373.629 bits (958), Expect = 1.125e-113
Identity = 188/427 (44.03%), Postives = 273/427 (63.93%), Query Frame = 1
Query:  772 LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNA-LILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGA 2049
            LP +DH++I Y     NFY E +EL  +T ++V + R  L  ++V G   PK   ++AH G   ++M  ++  ++  PTPIQCQ +P  +SGRD+IG+AKTGSGKT A++ P++ H+  Q  ++ GEGPI++++ PTREL  QI+ E  +      +R V +YGG  + EQ   L+ GAEI+VCTPGR+ID +     + T+++R T+LV DEADRMFDMGFE QV +I  H+RPDRQT++FSATF +K+E LAR +L +PI +  G      +DV+Q   ++L  ++K+  L   L  +   G V++FV K+ N+D L   L + GY    +HG +DQ +R+  IS+FK    P+L+AT VAARGLD+  +  VVNYD     + + HR GRTGRAG KGVAYT +T     + GD+++   L GA
Sbjct:  220 LPPIDHSEIDYPPFEKNFYNEHEELSSLTGSQVVELRQKLN-LRVSGAAPPKLCTSFAHFGFDEQLMHQIRKSEYTQPTPIQCQGVPIALSGRDMIGIAKTGSGKTAAFIWPMLVHIMDQKELEPGEGPIAVIVCPTRELCQQIHAECKRFGKAYSLRSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKK---KATSLQRVTYLVFDEADRMFDMGFEYQVRSIASHVRPDRQTLLFSATFRKKIERLARDILVDPIRVVQGDIGEANEDVTQVVEILLSGSDKWAWLTRRLVEFTSAGSVLIFVTKKANSDELAANLTQEGYSLGLLHGDMDQSERNKVISDFKKKNLPILVATDVAARGLDIPSIRTVVNYDVARDIDTHTHRIGRTGRAGEKGVAYTLLTNKDTSFAGDLVR--NLEGA 640          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Medaka
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:101167926])

HSP 1 Score: 357.451 bits (916), Expect = 6.783e-111
Identity = 175/413 (42.37%), Postives = 257/413 (62.23%), Query Frame = 1
Query:  808 KVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVC-QDVSQNALILDETEKFNK--XXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFK 2037
            K   NFY E  ++   +P E+ +YR S   + VKG+DCPKP+  +      S +M ++    F +PTPIQ Q  P  +SG+D++G+A+TGSGKT+AYL+P + H++ QP ++ G+GPI +V++PTRELA Q+ +   +      ++  CIYGG     QI  L+ G EI + TPGR+ID +  N    TN+RRCT+LVLDEADRM DMGFEPQ+  I+  IRPDRQT+M+SAT+P+++  LA   L + ++I +G   +    ++ Q   + ++ EK +K   L    + ++  K I+FVE +   D L   +   G+    +HG   Q +RD  ++ F+ G+ P+LIAT VA+RGLDV D+  V+NYD PN  EDY+HR GRT R+   G AYTF TP+  K  GD+I   +
Sbjct:   59 KFQKNFYQEHPDVTHRSPQEIEQYRRS-KEVTVKGRDCPKPMIKFNEASFPSYVMDMIVKQNFTDPTPIQSQGWPVALSGKDMVGIAQTGSGKTLAYLLPAIVHIQHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECN---KTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYVQINIGALQLSANHNILQIVDVCNDMEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDELTRRMRRDGWPAMGIHGDKSQQERDWVLNEFRYGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYIHRIGRTARSQKTGTAYTFFTPNNMKQAGDLISVLR 467          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Planmine SMEST
Match: SMESG000079612.1 (SMESG000079612.1)

HSP 1 Score: 1672.91 bits (4331), Expect = 0.000e+0
Identity = 916/917 (99.89%), Postives = 917/917 (100.00%), Query Frame = 1
Query:  208 PVKDSKRRDHKEKHPEIPIKQVEINDIPLPPSDNNGKNDISLLTHECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLXXXXXXXXXXXXXXXXXXXXXXXXXYMKQLNKEFGSETTTVSQKGRSQIIKTVVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXXXMSVIAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEEVNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVSXXXXXXXXXXXXXXXXXXXXXXXXVGHTVVQGRYKVV 2958
            PVKDSKRRDHKEKHPEIPIKQVEINDIPLPPSDNNGKNDISLLTHECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLEDDDDEDENANNNGTGEEEEDPLEEYMKQLNKEFGSETTTVSQKGRSQIIKTVVKKSKTEKGEIMEDNIDAIEYSTEEEEETLESMSVIAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKLLELLGLYQEGGKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEGKKVFSSSGFKGKGFQFDEAESQLAYERRKFERETLGLEDSDEEVNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDGLN+VRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVSEIKIQAAKKEIIRIIKEELLKLQKVGHTVVQGRYKVV
Sbjct:   48 PVKDSKRRDHKEKHPEIPIKQVEINDIPLPPSDNNGKNDISLLTHECEEIIKQRRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLEDDDDEDENANNNGTGEEEEDPLEEYMKQLNKEFGSETTTVSQKGRSQIIKTVVKKSKTEKGEIMEDNIDAIEYSTEEEEETLESMSVIAKKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKLLELLGLYQEGGKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEGKKVFSSSGFKGKGFQFDEAESQLAYERRKFERETLGLEDSDEEVNLDDKIIDMFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDGLNMVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYMPTHIKHKMEQNGERPLYLSLESVSEIKIQAAKKEIIRIIKEELLKLQKVGHTVVQGRYKVV 964          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Planmine SMEST
Match: SMESG000075674.1 (SMESG000075674.1)

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 351/748 (46.93%), Postives = 472/748 (63.10%), Query Frame = 1
Query:  628 SQIIKTVVKKSKTEKGEIMEDNIDAIXXXXXXXXXXXXXMSVIA----KKDKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNG-KEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQDVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLVVAYDKFKERMKQEXXXXXXXXXXXXXXXXXDEAESQLAYERRKFERETLGLEDSDEEVNLDDKIID--MFAVKRNITNVDRNSIVKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVTAQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGEDEMKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRGLYM-PTHIKHKMEQNGERPLYLSLESVS 2847
            S +IKTV   S  + GE  +D+I+  +   +  E         A    KK KLP V+H+K+YY+K   N Y EV E+ KMT  EV + R S+  I VKGK+CPKPI  W+H  VS KI+  LK +K   PTPIQ Q IPAIMSG+DVIG+AKTGSGKT++YL+PL+RH+  QP V  GEGPI+IV+ PTREL+ QI++EI K+T   +++ C CIYGG   ++QI++LK G EI+V TPGR+ID+MA NGGR  ++ RCTF+VLDEADRMFDMGFEPQV+ I+  IRPDRQTVMFSATFPR++EA+A+K++  PIE+ V G + VC DV Q+  +LDE +KF KL+ELL  ++  GK +VFVE QE A  L   L  +G+  + +HGG+ Q+ R+  + NFK+G  P+LIATS+AARGLDV DL +VVNYDCPNHYEDYVHRCGRTGRAGNKG +YTFVT DQE  IG++IKA K +G   P +L  AY ++ ERM  EGK + + SGF+G G++FD AE+     ++  E      E+  EE   D+ +++      +R    ++ N +V   PS    A + A        +AA Q AMK++++        D T         G V+  +G            D+A    EEI                               IN+  +N+RY LT+++  TNLSE +DV ++V+G++M P  IK K+EQ GE+PL+L LES S
Sbjct:  176 STLIKTVKDPSIAKIGEFTDDHIEDTDEYHQTVEPETLESITQALFEEKKQKLPDVNHDKVYYRKYDFNLYKEVPEISKMTTKEVKELRRSMA-IVVKGKECPKPITKWSHAIVSMKILNALKYNKMNEPTPIQSQTIPAIMSGKDVIGIAKTGSGKTLSYLLPLIRHIHNQPNVTVGEGPIAIVLCPTRELSIQIHQEIEKITYALRDVNCGCIYGGADTAQQISRLKRGVEIVVGTPGRIIDIMATNGGRNLSLSRCTFIVLDEADRMFDMGFEPQVMAIISRIRPDRQTVMFSATFPRRIEAVAKKIMKEPIEVRVDGGNKVCTDVVQHVYLLDENDKFLKLVELLSEFKYRGKSLVFVETQETAQILSSNLTHQGFEVSMIHGGLTQEKREEGMFNFKSGTVPILIATSIAARGLDVNDLMMVVNYDCPNHYEDYVHRCGRTGRAGNKGYSYTFVTSDQEVMIGNLIKALKENGQEIPGELTEAYARYTERMVSEGKTIKAPSGFRGHGYKFDAAEAMKEKGKKLQELFKYCPEEITEE---DEAVLEEMQLTSQRTSHQLNANPLVPQIPSYE--AQNHA--------KAAHQMAMKLNMKL-------DST---------GSVVEPSG------------DIAPSSREEI------------------------------PINNLPANIRYLLTTRDLRTNLSENFDVALTVKGVFMAPKDIK-KLEQIGEKPLHLVLESDS 850          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Planmine SMEST
Match: SMESG000012031.1 (SMESG000012031.1)

HSP 1 Score: 362.073 bits (928), Expect = 7.127e-107
Identity = 177/437 (40.50%), Postives = 270/437 (61.78%), Query Frame = 1
Query:  766 DKLPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQ-DVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTP--DQEKYIGDVIKAFKLSGATPPEDL 2067
            +KL   D N I   K   NFY E+  ++    +EV K+R     I + G++ P P+  +      + IM  +K ++++ PT IQ Q  P  +SG DV+G+A+TGSGKT ++L+P + H++AQPPVQSG+GPI +++ PTRELA Q+ +  ++ +   +I+  C YGG   + QI +L    E+++ TPGR+ID +     ++TN+RRCT+LVLDEADRM DMGFEP +  I+  +RPDRQT+M+SAT+P +++ LA   L N ++I VG   +    D+ Q   ILDE EK  + L  +    +  + +VF E +   D L  +++ +G  C A+HG   Q +R+  + +F+ GR  +LIAT VA+RGLD+ D+  V+NYD P+  EDY+HR GRT R+G KG+AYTF  P  D+ +   D+I   + +    P +L
Sbjct:   22 NKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKE-NNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFL---NDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQKVEILDEKEK-EERLIEILCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIDDIEYVINYDYPSKLEDYIHRIGRTARSGKKGIAYTFFNPMKDKPRQAQDLIMILEEAKQEVPTEL 453          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Planmine SMEST
Match: SMESG000033908.1 (SMESG000033908.1)

HSP 1 Score: 343.584 bits (880), Expect = 2.079e-106
Identity = 180/444 (40.54%), Postives = 271/444 (61.04%), Query Frame = 1
Query:  772 LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQ-DVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLV-VAYDKFKER 2097
            L  VD N         NFY E   +   + +E+  YR  L  + VKG +  KPI ++    +S +IM++++ +K+  PTPIQ Q +P  +SGR+++GVA+TGSGKT +YLIP + H+KAQPP++ G+GPI +++ PTRELA Q+            IR VC+YGG    +QI +L+ GAEI+V TPGR+ID++  +   +TN+ R T++VLDEADRM DMGFEPQ+  I   +R DRQT+M+SAT+P++++ LA+  L   I++ +G + +    ++ Q   ILDE  K +K L  +       K+IVF E ++ AD +   L  + +   A+HG   Q DR+  ++ F+     +L+AT VA+RGLDV D+ +V+NYD P  +EDY+HR GRTGR G  GV+YTF      K    ++K  + +  +  + L  +AY    ER
Sbjct:   86 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYR-RLKEMTVKGDNINKPIFSFNEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRSGAEIIVATPGRLIDLLKSS---ITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEILDEYSK-DKRLLEVVSKTPRDKMIVFAETKKKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSER 524          
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Planmine SMEST
Match: SMESG000033916.1 (SMESG000033916.1)

HSP 1 Score: 342.813 bits (878), Expect = 2.350e-106
Identity = 180/444 (40.54%), Postives = 271/444 (61.04%), Query Frame = 1
Query:  772 LPVVDHNKIYYQKVHTNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSKIMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMRHVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGGTVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEADRMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIEVGGKSIVCQ-DVSQNALILDETEKFNKXXXXXXXXXXXXKVIVFVEKQENADRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARGLDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIGDVIKAFKLSGATPPEDLV-VAYDKFKER 2097
            L  VD N         NFY E   +   + +E+  YR  L  + VKG +  KPI ++    +S +IM++++ +K+  PTPIQ Q +P  +SGR+++GVA+TGSGKT +YLIP + H+KAQPP++ G+GPI +++ PTRELA Q+            IR VC+YGG    +QI +L+ GAEI+V TPGR+ID++  +   +TN+ R T++VLDEADRM DMGFEPQ+  I   +R DRQT+M+SAT+P++++ LA+  L   I++ +G + +    ++ Q   ILDE  K +K L  +       K+IVF E ++ AD +   L  + +   A+HG   Q DR+  ++ F+     +L+AT VA+RGLDV D+ +V+NYD P  +EDY+HR GRTGR G  GV+YTF      K    ++K  + +  +  + L  +AY    ER
Sbjct:   80 LNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYR-RLKEMTVKGDNINKPIFSFNEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRNGAEIIVATPGRLIDLLKSS---ITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEILDEYSK-DKRLLEVVSKTPRDKMIVFAETKKKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDIKVVINYDFPIQFEDYIHRIGRTGRRGKSGVSYTFFNRKNSKSARQLVKVMEEANQSVSDSLYDLAYIPRSER 518          
The following BLAST results are available for this feature:
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX460.000e+049.42DEAD-box helicase 46 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX460.000e+049.36DEAD-box helicase 46 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX421.533e-11643.82DEAD-box helicase 42 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX429.535e-11643.82DEAD-box helicase 42 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX421.238e-11443.82DEAD-box helicase 42 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F53H1.10.000e+047.28pep chromosome:WBcel235:IV:1297222:1309652:-1 gene... [more]
F53H1.10.000e+056.26pep chromosome:WBcel235:IV:1297400:1309644:-1 gene... [more]
F53H1.13.719e-13848.26pep chromosome:WBcel235:IV:1297283:1309644:-1 gene... [more]
F53H1.17.263e-11965.07pep chromosome:WBcel235:IV:1297400:1309644:-1 gene... [more]
C46F11.46.795e-10440.73pep chromosome:WBcel235:III:3657716:3664494:-1 gen... [more]
back to top
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG62273.235e-1856.68gene:FBgn0030631 transcript:FBtr0074011[more]
CG64186.043e-11743.81gene:FBgn0036104 transcript:FBtr0076274[more]
mahe9.926e-10242.96gene:FBgn0029979 transcript:FBtr0071132[more]
mahe9.926e-10242.96gene:FBgn0029979 transcript:FBtr0344137[more]
CG100773.149e-10140.70gene:FBgn0035720 transcript:FBtr0333083[more]
back to top
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx460.000e+048.11DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
ddx421.216e-11443.55DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
DDX178.723e-10842.62si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
ddx51.021e-10741.16DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
ddx56.368e-10641.89DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
back to top
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX460.000e+049.94DEAD-box helicase 46 [Source:NCBI gene;Acc:1001453... [more]
DDX460.000e+049.66DEAD-box helicase 46 [Source:NCBI gene;Acc:1001453... [more]
DDX460.000e+047.22DEAD-box helicase 46 [Source:NCBI gene;Acc:1001453... [more]
cul23.819e-11443.36cullin 2 [Source:Xenbase;Acc:XB-GENE-960931][more]
cul22.295e-11343.36cullin 2 [Source:Xenbase;Acc:XB-GENE-960931][more]
back to top
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx460.000e+049.13DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
Ddx460.000e+049.13DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
Ddx460.000e+047.11DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
Ddx428.239e-11543.82DEAD (Asp-Glu-Ala-Asp) box polypeptide 42 [Source:... [more]
Ddx179.464e-11044.20DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
back to top
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q7L014|DDX46_HUMAN0.000e+049.42Probable ATP-dependent RNA helicase DDX46 OS=Homo ... [more]
sp|Q4TVV3|DDX46_DANRE0.000e+047.99Probable ATP-dependent RNA helicase DDX46 OS=Danio... [more]
sp|Q569Z5|DDX46_MOUSE0.000e+049.13Probable ATP-dependent RNA helicase DDX46 OS=Mus m... [more]
sp|Q5R6D8|DDX46_PONAB0.000e+049.13Probable ATP-dependent RNA helicase DDX46 OS=Pongo... [more]
sp|Q62780|DDX46_RAT0.000e+048.90Probable ATP-dependent RNA helicase DDX46 OS=Rattu... [more]
back to top
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4V3SDC10.000e+055.45Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LAF80.000e+055.45Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2L9X70.000e+055.45Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZFK30.000e+055.84Uncharacterized protein (Fragment) OS=Opisthorchis... [more]
A0A1S8WPA10.000e+055.71DEAD/DEAH box helicase (Fragment) OS=Opisthorchis ... [more]
back to top
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx460.000e+052.02DEAD-box helicase 46 [Source:NCBI gene;Acc:1030417... [more]
ddx460.000e+050.07DEAD-box helicase 46 [Source:NCBI gene;Acc:1030417... [more]
ddx421.524e-11243.32DEAD-box helicase 42 [Source:NCBI gene;Acc:1030444... [more]
ddx421.534e-11243.32DEAD-box helicase 42 [Source:NCBI gene;Acc:1030444... [more]
ddx56.280e-10841.89probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
back to top
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx460.000e+049.19DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
ddx428.369e-11041.49DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
ENSPMAT00000003898.13.774e-8740.36pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
ddx231.967e-8538.81DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ENSPMAT00000000216.13.108e-6035.05pep scaffold:Pmarinus_7.0:GL476721:117971:126978:-... [more]
back to top
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DBP23.308e-11241.69ATP-dependent RNA helicase of the DEAD-box protein... [more]
PRP55.166e-10740.38RNA helicase in the DEAD-box family; necessary for... [more]
DBP11.227e-7938.60Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
DED12.214e-7937.31ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
DBP37.061e-7836.45RNA-Dependent ATPase, member of DExD/H-box family;... [more]
back to top
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO428940.000e+052.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435576.533e-11241.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380617.912e-10441.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO436023.106e-8538.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379562.862e-8337.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx460.000e+049.83DEAD-box helicase 46 [Source:NCBI gene;Acc:1011615... [more]
ddx460.000e+052.82DEAD-box helicase 46 [Source:NCBI gene;Acc:1011615... [more]
ddx421.734e-11444.03DEAD-box helicase 42 [Source:NCBI gene;Acc:1011740... [more]
ddx421.125e-11344.03DEAD-box helicase 42 [Source:NCBI gene;Acc:1011740... [more]
DDX56.783e-11142.37probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
back to top
BLAST of Pre-mRNA-processing ATP-dependent RNA helicase PRP5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079612.10.000e+099.89SMESG000079612.1[more]
SMESG000075674.10.000e+046.93SMESG000075674.1[more]
SMESG000012031.17.127e-10740.50SMESG000012031.1[more]
SMESG000033908.12.079e-10640.54SMESG000033908.1[more]
SMESG000033916.12.350e-10640.54SMESG000033916.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031576 ID=SMED30031576|Name=Pre-mRNA-processing ATP-dependent RNA helicase PRP5|organism=Schmidtea mediterranea sexual|type=transcript|length=3007bp
CGATCTCTTAAATTTACAATATTTTTTAAATCGACGTTTTCAAAATTTCA
ATTTTAAAACAACTAAATGCCAAGTAGCAGTAGAAAACGTTCACGTGATA
GACATTCTCGTAGGCGCTCCAAATCTCGATCACATTCGAGAACCCATAAA
CGATCAAGAAGCCGTCATAGATCTCGTGAAAGACGACCTCATAGAAAATC
AAGATCTCCCGTAAAAGATTCTAAAAGACGTGATCACAAAGAAAAGCACC
CTGAAATTCCTATTAAACAAGTCGAAATTAACGATATACCACTTCCACCA
TCCGATAATAATGGAAAAAATGATATTAGTTTACTAACTCATGAATGCGA
AGAAATTATAAAACAACGTCGAGAAAGAGTTGAACAATGGCGAAAGTTGC
AAAAAGAAAAGGGAGCAAAAGAGATATTGGAATCCAAAGCTAAAGCTGCT
GCAAACAATGAAGATTACTCAGGTAAAAAATGGAATTTAGAAGATGACGA
CGATGAAGATGAAAATGCCAATAATAATGGAACTGGAGAAGAAGAAGAAG
ATCCATTAGAAGAATACATGAAACAGTTGAATAAAGAATTTGGATCTGAA
ACCACAACAGTCAGTCAAAAAGGCCGATCACAAATTATCAAAACTGTTGT
GAAGAAATCTAAAACGGAAAAGGGGGAAATAATGGAAGACAACATCGATG
CGATAGAATATTCCACTGAAGAAGAAGAAGAAACACTGGAATCGATGTCA
GTCATTGCCAAAAAGGATAAACTACCGGTTGTAGATCACAATAAAATCTA
TTACCAAAAGGTGCACACGAATTTCTATATCGAAGTTGACGAACTGAAGA
AAATGACACCGAATGAAGTGTCAAAGTATCGAAATAGTCTCGGAGGGATA
AAAGTCAAAGGCAAAGATTGTCCTAAACCAATCAAAACCTGGGCTCATTG
CGGAGTATCATCGAAAATCATGACCATCCTTAAAATGCACAAATTCCTGA
ATCCTACCCCAATCCAATGCCAGGCAATCCCGGCAATTATGTCGGGTAGA
GATGTTATAGGAGTAGCTAAAACCGGCAGTGGCAAAACTATGGCGTATCT
GATACCGCTGATGAGGCACGTCAAAGCCCAGCCTCCTGTCCAATCGGGAG
AAGGCCCTATTTCGATAGTCATGTCTCCGACGCGAGAGCTGGCCTGTCAG
ATCTACCGAGAGATATTAAAGCTGACAAATGGAAAGGAGATCCGATGCGT
TTGCATTTACGGTGGGACAGTCATTTCCGAGCAGATAGCCAAGCTGAAAT
ACGGAGCAGAGATATTGGTGTGCACTCCAGGCAGAATGATCGATATGATG
GCAGTGAATGGCGGCCGGGTTACGAATATGAGGCGGTGCACGTTTCTGGT
ACTCGATGAAGCCGACAGAATGTTCGATATGGGATTTGAACCGCAGGTTT
TAACGATTCTCGGTCACATTCGGCCAGATCGACAAACGGTGATGTTCAGT
GCGACATTTCCTCGGAAAATGGAGGCTTTAGCTCGAAAAGTCCTAAACAA
TCCAATTGAAATCGAAGTCGGAGGGAAAAGTATCGTTTGTCAGGATGTTT
CCCAAAATGCGTTGATTTTGGATGAAACAGAAAAATTTAACAAATTATTG
GAACTACTTGGTTTATATCAAGAAGGTGGTAAAGTTATTGTTTTTGTAGA
AAAACAAGAGAACGCCGACAGATTAATCCCGTTACTAATTGAAAGAGGAT
ATATCTGTGCAGCGGTTCACGGGGGAATCGATCAGGATGATCGAGATTCT
TTTATTTCTAATTTTAAAACCGGAAGAAATCCATTATTAATAGCAACCTC
TGTAGCTGCCAGAGGATTGGATGTAACAGATTTGAATTTAGTAGTCAATT
ACGATTGCCCCAATCACTATGAGGATTATGTGCATCGATGCGGTCGAACT
GGTAGAGCTGGTAACAAAGGTGTTGCGTACACATTTGTCACCCCGGACCA
AGAAAAATATATCGGGGACGTTATAAAGGCATTTAAATTAAGCGGCGCCA
CTCCACCGGAAGATCTTGTTGTCGCTTATGATAAGTTCAAGGAAAGAATG
AAACAGGAAGGCAAAAAGGTATTTAGTTCCTCCGGGTTCAAGGGTAAGGG
ATTTCAATTCGATGAAGCCGAATCTCAGCTGGCCTATGAGAGGAGGAAAT
TCGAAAGGGAAACATTGGGTCTCGAAGATTCCGATGAAGAAGTAAATCTC
GATGACAAAATTATCGACATGTTCGCTGTGAAACGGAACATCACAAATGT
CGATAGAAATTCCATAGTGAAATCTGCACCGAGCGCTGCGACTGTTGCCA
GTGACCAAGCGACCCATTTGTTGAACAAGCGATTGGAAGCTGCCAGGCAA
CAGGCGATGAAAATCGATGTCCAAAGAAAATTAGGTCAAGTGACAAAAGA
TCAAACACAAGTTACAGCTCAAGCGGTTTTCAGCGGAGGAGTAATAATGC
AAAACGGAACCCGATTGGTCAACTCGAATCCGGTATCTGGTAAGGATTTG
GCGGCTCAGAAAGCAGAAGAAATCCACAACAAACTCGGATACTCGAAAAG
CGATGCTGGCGAAGATGAAATGAAAGACGGGCTGAATCTGGTGAGGAAAT
ACGAAGAGGAGCTGGAAATCAATGATTTTGCCAGTAACGTCCGGTATCGG
TTGACGAGCAAAGAAACAATGACGAACCTCAGTGAATATTATGATGTCGG
CGTGTCAGTGAGAGGCCTCTATATGCCGACTCATATCAAACACAAAATGG
AACAGAATGGAGAACGGCCTCTCTATTTGTCATTGGAATCGGTTTCGGAA
ATTAAAATCCAAGCAGCTAAAAAGGAAATCATTCGAATCATCAAAGAAGA
ATTGCTGAAATTACAAAAGGTCGGTCACACTGTTGTCCAAGGCAGATACA
AAGTCGTTTGAAAATTCCGTTCTATCCTCACTACAAAATCATGTAATTAA
ATACAAC
back to top

protein sequence of SMED30031576-orf-1

>SMED30031576-orf-1 ID=SMED30031576-orf-1|Name=SMED30031576-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=965bp
MPSSSRKRSRDRHSRRRSKSRSHSRTHKRSRSRHRSRERRPHRKSRSPVK
DSKRRDHKEKHPEIPIKQVEINDIPLPPSDNNGKNDISLLTHECEEIIKQ
RRERVEQWRKLQKEKGAKEILESKAKAAANNEDYSGKKWNLEDDDDEDEN
ANNNGTGEEEEDPLEEYMKQLNKEFGSETTTVSQKGRSQIIKTVVKKSKT
EKGEIMEDNIDAIEYSTEEEEETLESMSVIAKKDKLPVVDHNKIYYQKVH
TNFYIEVDELKKMTPNEVSKYRNSLGGIKVKGKDCPKPIKTWAHCGVSSK
IMTILKMHKFLNPTPIQCQAIPAIMSGRDVIGVAKTGSGKTMAYLIPLMR
HVKAQPPVQSGEGPISIVMSPTRELACQIYREILKLTNGKEIRCVCIYGG
TVISEQIAKLKYGAEILVCTPGRMIDMMAVNGGRVTNMRRCTFLVLDEAD
RMFDMGFEPQVLTILGHIRPDRQTVMFSATFPRKMEALARKVLNNPIEIE
VGGKSIVCQDVSQNALILDETEKFNKLLELLGLYQEGGKVIVFVEKQENA
DRLIPLLIERGYICAAVHGGIDQDDRDSFISNFKTGRNPLLIATSVAARG
LDVTDLNLVVNYDCPNHYEDYVHRCGRTGRAGNKGVAYTFVTPDQEKYIG
DVIKAFKLSGATPPEDLVVAYDKFKERMKQEGKKVFSSSGFKGKGFQFDE
AESQLAYERRKFERETLGLEDSDEEVNLDDKIIDMFAVKRNITNVDRNSI
VKSAPSAATVASDQATHLLNKRLEAARQQAMKIDVQRKLGQVTKDQTQVT
AQAVFSGGVIMQNGTRLVNSNPVSGKDLAAQKAEEIHNKLGYSKSDAGED
EMKDGLNLVRKYEEELEINDFASNVRYRLTSKETMTNLSEYYDVGVSVRG
LYMPTHIKHKMEQNGERPLYLSLESVSEIKIQAAKKEIIRIIKEELLKLQ
KVGHTVVQGRYKVV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003724RNA helicase activity
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0004004ATP-dependent RNA helicase activity
GO:0004386helicase activity
GO:0016787hydrolase activity
GO:0016887ATPase activity
GO:1990446U1 snRNP binding
GO:1990447U2 snRNP binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR014001Helicase_ATP-bd
IPR001650Helicase_C
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: biological process
TermDefinition
GO:0000398mRNA splicing, via spliceosome
GO:0006397mRNA processing
GO:0008380RNA splicing
GO:0010468regulation of gene expression
GO:0010501RNA secondary structure unwinding
GO:1903241U2-type prespliceosome assembly
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005829cytosol
GO:0044732mitotic spindle pole body
GO:0071004U2-type prespliceosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 111..131
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 242..500
e-value: 5.4E-87
score: 293.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 501..672
e-value: 7.4E-48
score: 164.2
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 8..51
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..87
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 104..163
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 104..126
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 52..67
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 142..163
NoneNo IPR availablePANTHERPTHR24031:SF25ATP-DEPENDENT RNA HELICASE DDX46-RELATEDcoord: 115..963
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 115..963
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 511..641
e-value: 1.20043E-52
score: 178.085
NoneNo IPR availableCDDcd17953DEADc_DDX46coord: 279..499
e-value: 9.74068E-141
score: 416.778
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 309..514
e-value: 1.3E-62
score: 224.0
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 321..499
score: 31.515
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 551..632
e-value: 3.9E-28
score: 109.5
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 522..632
e-value: 5.6E-28
score: 97.5
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 526..675
score: 21.444
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 314..487
e-value: 1.9E-46
score: 158.1
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 445..453
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 290..318
score: 8.93
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 230..649
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 437..671