Fibroblast growth factor receptor

Overview
NameFibroblast growth factor receptor
Smed IDSMED30031557
Length (bp)2419
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fibroblast growth factor receptor (SMED30031557) t-SNE clustered cells

Violin plots show distribution of expression levels for Fibroblast growth factor receptor (SMED30031557) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fibroblast growth factor receptor (SMED30031557) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fibroblast growth factor receptor (SMED30031557) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Fibroblast growth factor receptor vs. Ensembl Human
Match: FGFR1 (fibroblast growth factor receptor 1 [Source:HGNC Symbol;Acc:HGNC:3688])

HSP 1 Score: 208.764 bits (530), Expect = 1.512e-56
Identity = 113/311 (36.33%), Postives = 178/311 (57.23%), Query Frame = 1
Query: 1489 SKLSFSTT------SSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            S+LS S T      S +E   D    L    + + K +G G FG+V L E   +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R              + +++    +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  358 SRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVE 663          
BLAST of Fibroblast growth factor receptor vs. Ensembl Human
Match: FGFR1 (fibroblast growth factor receptor 1 [Source:HGNC Symbol;Acc:HGNC:3688])

HSP 1 Score: 208.379 bits (529), Expect = 1.894e-56
Identity = 113/311 (36.33%), Postives = 178/311 (57.23%), Query Frame = 1
Query: 1489 SKLSFSTT------SSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            S+LS S T      S +E   D    L    + + K +G G FG+V L E   +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R              + +++    +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  356 SRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVE 661          
BLAST of Fibroblast growth factor receptor vs. Ensembl Human
Match: FGFR1 (fibroblast growth factor receptor 1 [Source:HGNC Symbol;Acc:HGNC:3688])

HSP 1 Score: 208.379 bits (529), Expect = 2.080e-56
Identity = 113/311 (36.33%), Postives = 178/311 (57.23%), Query Frame = 1
Query: 1489 SKLSFSTT------SSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            S+LS S T      S +E   D    L    + + K +G G FG+V L E   +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R              + +++    +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  358 SRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVE 663          
BLAST of Fibroblast growth factor receptor vs. Ensembl Human
Match: FGFR1 (fibroblast growth factor receptor 1 [Source:HGNC Symbol;Acc:HGNC:3688])

HSP 1 Score: 208.764 bits (530), Expect = 3.725e-56
Identity = 138/447 (30.87%), Postives = 226/447 (50.56%), Query Frame = 1
Query: 1069 IGISHRTPRNITILNKIKFTPKKTKSTNHSKTVIF-NGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKEL-KKSSRYYDDQTEISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            IG+SH +   +T+L  ++  P    S  + + +I+  G F I   +G VI +          MK+  KK          S+  S +      K    ++++S  +  S+NS  L  + SR     T +                   +  S +E   D    L    + + K +G G FG+V L E   +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R              + +++    +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  339 IGLSHHS-AWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVY---------KMKSGTKK----------SDFHSQMAVHKLAKSIPLRRQVSADSSASMNSGVLLVRPSRLSSSGTPM------------------LAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVE 742          
BLAST of Fibroblast growth factor receptor vs. Ensembl Human
Match: FGFR1 (fibroblast growth factor receptor 1 [Source:HGNC Symbol;Acc:HGNC:3688])

HSP 1 Score: 208.764 bits (530), Expect = 3.887e-56
Identity = 138/447 (30.87%), Postives = 226/447 (50.56%), Query Frame = 1
Query: 1069 IGISHRTPRNITILNKIKFTPKKTKSTNHSKTVIF-NGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKEL-KKSSRYYDDQTEISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            IG+SH +   +T+L  ++  P    S  + + +I+  G F I   +G VI +          MK+  KK          S+  S +      K    ++++S  +  S+NS  L  + SR     T +                   +  S +E   D    L    + + K +G G FG+V L E   +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R              + +++    +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  345 IGLSHHS-AWLTVLEALEERPAVMTSPLYLEIIIYCTGAFLISCMVGSVIVY---------KMKSGTKK----------SDFHSQMAVHKLAKSIPLRRQVSADSSASMNSGVLLVRPSRLSSSGTPM------------------LAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVE 748          
BLAST of Fibroblast growth factor receptor vs. Ensembl Celegans
Match: R151.1 (pep chromosome:WBcel235:III:7218813:7221186:1 gene:WBGene00020106.1 transcript:R151.1c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.1)

HSP 1 Score: 204.527 bits (519), Expect = 1.282e-57
Identity = 107/274 (39.05%), Postives = 158/274 (57.66%), Query Frame = 1
Query: 1558 KDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGI----FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEK 2367
            +D+ +   IG GAFG+VF G +             VAVK++  N++D    E      +E+ +M+ +G H NIV++ GYC  + Q   +IMEY   G LK +L  +R +      I    FL F+ QIA GMA+L S  IIHRDLAARN+L+    V KISDFGMSR       Y +   G++PL+W++PE +    YS+++DVW++G+LLWEI  LG  PY N +   +++ +  G R+  P  C  ++  L++ CW  +A DRP+F  I+ K
Sbjct:  187 QDIVVGAVIGEGAFGQVFKGILR----GPNGQVIPVAVKQLKANAID----EEREEFVREIQMMQTVGQHDNIVTMYGYCMDE-QLQCMIMEYVPYGDLKHYLQNMRKEKDSDSAIDSKEFLSFTNQIACGMAHLESVGIIHRDLAARNILVGTGKVLKISDFGMSRP----GVYIKMSKGVIPLRWLSPEAIKDNTYSNKSDVWAFGVLLWEIATLGGFPYNNVADKDILNQLTEGMRLEQPAKCSDDMYILMKSCWNLKAEDRPSFLAILSK 447          
BLAST of Fibroblast growth factor receptor vs. Ensembl Celegans
Match: R151.1 (pep chromosome:WBcel235:III:7217839:7221186:1 gene:WBGene00020106.1 transcript:R151.1b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.1)

HSP 1 Score: 203.756 bits (517), Expect = 6.717e-56
Identity = 107/274 (39.05%), Postives = 158/274 (57.66%), Query Frame = 1
Query: 1558 KDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGI----FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEK 2367
            +D+ +   IG GAFG+VF G +             VAVK++  N++D    E      +E+ +M+ +G H NIV++ GYC  + Q   +IMEY   G LK +L  +R +      I    FL F+ QIA GMA+L S  IIHRDLAARN+L+    V KISDFGMSR       Y +   G++PL+W++PE +    YS+++DVW++G+LLWEI  LG  PY N +   +++ +  G R+  P  C  ++  L++ CW  +A DRP+F  I+ K
Sbjct:  350 QDIVVGAVIGEGAFGQVFKGILR----GPNGQVIPVAVKQLKANAID----EEREEFVREIQMMQTVGQHDNIVTMYGYCMDE-QLQCMIMEYVPYGDLKHYLQNMRKEKDSDSAIDSKEFLSFTNQIACGMAHLESVGIIHRDLAARNILVGTGKVLKISDFGMSRP----GVYIKMSKGVIPLRWLSPEAIKDNTYSNKSDVWAFGVLLWEIATLGGFPYNNVADKDILNQLTEGMRLEQPAKCSDDMYILMKSCWNLKAEDRPSFLAILSK 610          
BLAST of Fibroblast growth factor receptor vs. Ensembl Celegans
Match: R151.1 (pep chromosome:WBcel235:III:7216526:7221186:1 gene:WBGene00020106.1 transcript:R151.1a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.1)

HSP 1 Score: 203.371 bits (516), Expect = 2.413e-55
Identity = 107/274 (39.05%), Postives = 158/274 (57.66%), Query Frame = 1
Query: 1558 KDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGI----FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEK 2367
            +D+ +   IG GAFG+VF G +             VAVK++  N++D    E      +E+ +M+ +G H NIV++ GYC  + Q   +IMEY   G LK +L  +R +      I    FL F+ QIA GMA+L S  IIHRDLAARN+L+    V KISDFGMSR       Y +   G++PL+W++PE +    YS+++DVW++G+LLWEI  LG  PY N +   +++ +  G R+  P  C  ++  L++ CW  +A DRP+F  I+ K
Sbjct:  415 QDIVVGAVIGEGAFGQVFKGILR----GPNGQVIPVAVKQLKANAID----EEREEFVREIQMMQTVGQHDNIVTMYGYCMDE-QLQCMIMEYVPYGDLKHYLQNMRKEKDSDSAIDSKEFLSFTNQIACGMAHLESVGIIHRDLAARNILVGTGKVLKISDFGMSRP----GVYIKMSKGVIPLRWLSPEAIKDNTYSNKSDVWAFGVLLWEIATLGGFPYNNVADKDILNQLTEGMRLEQPAKCSDDMYILMKSCWNLKAEDRPSFLAILSK 675          
BLAST of Fibroblast growth factor receptor vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 181.03 bits (458), Expect = 1.391e-48
Identity = 98/275 (35.64%), Postives = 153/275 (55.64%), Query Frame = 1
Query: 1549 LAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACG--IFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEK 2367
            ++  D+++   IG+G FG V LG              KVA+K    +    ++S     L  E   M  +  H N+V+L+G     +   ++I EY +NG+L   +D LR + + A      + F+  I  GM YL SK I+HRDLAARNVLL +  V K+SDFG++++   N   ++   G  P+KW APE L   ++++++DVWS+GILLWEI++ G  PY    +  V+  I  GYRM  P+ CP  I +++   WA  A+DRP+F  ++++
Sbjct:  278 ISSNDIDVGDTIGHGEFGDVRLGTY---------KNRKVALKVSKRHGNGMLDS-----LLDEAKFMVGLS-HPNLVTLVGVVL-DDVNVYMITEYMANGNL---IDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAKK--ANSQSHDSASGKFPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIPIQDVVRYIEKGYRMEAPEGCPPEIFKVMNETWALSAQDRPSFGQVLQR 531          
BLAST of Fibroblast growth factor receptor vs. Ensembl Celegans
Match: csk-1 (Tyrosine-protein kinase csk-1 [Source:UniProtKB/Swiss-Prot;Acc:G5ECJ6])

HSP 1 Score: 181.03 bits (458), Expect = 1.391e-48
Identity = 98/275 (35.64%), Postives = 153/275 (55.64%), Query Frame = 1
Query: 1549 LAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACG--IFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEK 2367
            ++  D+++   IG+G FG V LG              KVA+K    +    ++S     L  E   M  +  H N+V+L+G     +   ++I EY +NG+L   +D LR + + A      + F+  I  GM YL SK I+HRDLAARNVLL +  V K+SDFG++++   N   ++   G  P+KW APE L   ++++++DVWS+GILLWEI++ G  PY    +  V+  I  GYRM  P+ CP  I +++   WA  A+DRP+F  ++++
Sbjct:  278 ISSNDIDVGDTIGHGEFGDVRLGTY---------KNRKVALKVSKRHGNGMLDS-----LLDEAKFMVGLS-HPNLVTLVGVVL-DDVNVYMITEYMANGNL---IDLLRSRGRHALERRQLMMFAMDICQGMCYLESKQIVHRDLAARNVLLDDDLVAKVSDFGLAKK--ANSQSHDSASGKFPIKWTAPEALRHSQFTTKSDVWSFGILLWEIFSFGRVPYPRIPIQDVVRYIEKGYRMEAPEGCPPEIFKVMNETWALSAQDRPSFGQVLQR 531          
BLAST of Fibroblast growth factor receptor vs. Ensembl Fly
Match: btl (gene:FBgn0285896 transcript:FBtr0100676)

HSP 1 Score: 206.838 bits (525), Expect = 3.752e-55
Identity = 114/295 (38.64%), Postives = 169/295 (57.29%), Query Frame = 1
Query: 1549 LAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD---QNKIACGIFL-----------------KFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYEN-FSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKY 2370
            +  + +++   +G GAFG+V + E + +  +    +  VAVK +     D        +L +EM +MK IG H NI++L+G C +     W+I+EY  +G+LK FL + R    Q +     +L                 KF+ QIA GM YL S+  IHRDLAARNVL+S+ YV KI+DFG++R +   E Y ++ +G +P+KW+APE L +KKY SQ+DVWSYG+LLWEI   G  PY +  S  ++   +  G RM  P  C  NI  +++ CW FE+  RPTF ++VE +
Sbjct:  707 IPRQQLSLGSILGEGAFGRVVMAEAEGLPRSPQLAETIVAVKMVKEEHTD----TDMASLVREMEVMKMIGKHINIINLLGCCSQGGPL-WVIVEYAPHGNLKDFLKQNRPGAPQRRSDSDGYLDDKPLISTQHLGEKELTKFAFQIARGMEYLASRRCIHRDLAARNVLVSDGYVMKIADFGLARDIQDTEYYRKNTNGRLPIKWMAPESLQEKKYDSQSDVWSYGVLLWEIMTYGDQPYPHILSAEELYSYLITGQRMEKPAKCSLNIYVVMRQCWHFESCARPTFAELVESF 996          
BLAST of Fibroblast growth factor receptor vs. Ensembl Fly
Match: btl (gene:FBgn0285896 transcript:FBtr0075778)

HSP 1 Score: 206.838 bits (525), Expect = 3.752e-55
Identity = 114/295 (38.64%), Postives = 169/295 (57.29%), Query Frame = 1
Query: 1549 LAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD---QNKIACGIFL-----------------KFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYEN-FSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKY 2370
            +  + +++   +G GAFG+V + E + +  +    +  VAVK +     D        +L +EM +MK IG H NI++L+G C +     W+I+EY  +G+LK FL + R    Q +     +L                 KF+ QIA GM YL S+  IHRDLAARNVL+S+ YV KI+DFG++R +   E Y ++ +G +P+KW+APE L +KKY SQ+DVWSYG+LLWEI   G  PY +  S  ++   +  G RM  P  C  NI  +++ CW FE+  RPTF ++VE +
Sbjct:  707 IPRQQLSLGSILGEGAFGRVVMAEAEGLPRSPQLAETIVAVKMVKEEHTD----TDMASLVREMEVMKMIGKHINIINLLGCCSQGGPL-WVIVEYAPHGNLKDFLKQNRPGAPQRRSDSDGYLDDKPLISTQHLGEKELTKFAFQIARGMEYLASRRCIHRDLAARNVLVSDGYVMKIADFGLARDIQDTEYYRKNTNGRLPIKWMAPESLQEKKYDSQSDVWSYGVLLWEIMTYGDQPYPHILSAEELYSYLITGQRMEKPAKCSLNIYVVMRQCWHFESCARPTFAELVESF 996          
BLAST of Fibroblast growth factor receptor vs. Ensembl Fly
Match: htl (gene:FBgn0010389 transcript:FBtr0083550)

HSP 1 Score: 202.986 bits (515), Expect = 5.813e-55
Identity = 121/316 (38.29%), Postives = 176/316 (55.70%), Query Frame = 1
Query: 1471 NKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDK----LRDQNK-------------IACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYEN-FSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            N+   +++  F   S++E        L    + +   +G GAFG+V + E++            VAVK +     D    +   +L +EM +MK IG H NI++L+G C  +N   ++I+EY  +G+LK FL K     RDQ++             I     +KF+ QIA GM YL S+  IHRDLAARNVL+S+ YV KI+DFG++R +   + Y ++ +G +P+KW+APE L +K Y S++DVWSYGILLWEI   G  PY    S  ++   + +G RM  P  C  NI  L++ CW F A DRP F +IVE
Sbjct:  393 NEPAPFNEYEFPLDSNWE--------LPRSHLVLGATLGEGAFGRVVMAEVN---------NAIVAVKMVKEGHTD----DDIASLVREMEVMKIIGRHINIINLLGCCS-QNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVE 686          
BLAST of Fibroblast growth factor receptor vs. Ensembl Fly
Match: htl (gene:FBgn0010389 transcript:FBtr0083549)

HSP 1 Score: 202.986 bits (515), Expect = 5.813e-55
Identity = 121/316 (38.29%), Postives = 176/316 (55.70%), Query Frame = 1
Query: 1471 NKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDK----LRDQNK-------------IACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYEN-FSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            N+   +++  F   S++E        L    + +   +G GAFG+V + E++            VAVK +     D    +   +L +EM +MK IG H NI++L+G C  +N   ++I+EY  +G+LK FL K     RDQ++             I     +KF+ QIA GM YL S+  IHRDLAARNVL+S+ YV KI+DFG++R +   + Y ++ +G +P+KW+APE L +K Y S++DVWSYGILLWEI   G  PY    S  ++   + +G RM  P  C  NI  L++ CW F A DRP F +IVE
Sbjct:  393 NEPAPFNEYEFPLDSNWE--------LPRSHLVLGATLGEGAFGRVVMAEVN---------NAIVAVKMVKEGHTD----DDIASLVREMEVMKIIGRHINIINLLGCCS-QNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVE 686          
BLAST of Fibroblast growth factor receptor vs. Ensembl Fly
Match: htl (gene:FBgn0010389 transcript:FBtr0083548)

HSP 1 Score: 202.986 bits (515), Expect = 5.813e-55
Identity = 121/316 (38.29%), Postives = 176/316 (55.70%), Query Frame = 1
Query: 1471 NKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDK----LRDQNK-------------IACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYEN-FSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            N+   +++  F   S++E        L    + +   +G GAFG+V + E++            VAVK +     D    +   +L +EM +MK IG H NI++L+G C  +N   ++I+EY  +G+LK FL K     RDQ++             I     +KF+ QIA GM YL S+  IHRDLAARNVL+S+ YV KI+DFG++R +   + Y ++ +G +P+KW+APE L +K Y S++DVWSYGILLWEI   G  PY    S  ++   + +G RM  P  C  NI  L++ CW F A DRP F +IVE
Sbjct:  393 NEPAPFNEYEFPLDSNWE--------LPRSHLVLGATLGEGAFGRVVMAEVN---------NAIVAVKMVKEGHTD----DDIASLVREMEVMKIIGRHINIINLLGCCS-QNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVE 686          
BLAST of Fibroblast growth factor receptor vs. Ensembl Zebrafish
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:58129])

HSP 1 Score: 207.994 bits (528), Expect = 1.519e-59
Identity = 113/322 (35.09%), Postives = 179/322 (55.59%), Query Frame = 1
Query: 1444 ISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLR----DQNKIACGI---------FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKY 2370
            I+ LS+     +PN S+L   +   +E             + + K +G G FG+V + E   +D  K N    VAVK + ++  D    +  ++L  EM +MK IG H NI++L+G C +     ++++EY S G+L+ +L   R    D +   C I          +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWSYG+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTF+ +VE +
Sbjct:   10 IARLSSSDGPMLPNVSELELPSDPKWE--------FTRTKLTLGKPLGEGCFGQVVMAEAIGIDKEKPNKPLTVAVKMLKDDGTD----KDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPL-YVLVEYASKGNLREYLRARRPPGMDYSFDTCKIPNETLTFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVEDH 318          
BLAST of Fibroblast growth factor receptor vs. Ensembl Zebrafish
Match: fgfr1b (fibroblast growth factor receptor 1b [Source:ZFIN;Acc:ZDB-GENE-060503-14])

HSP 1 Score: 207.994 bits (528), Expect = 1.900e-56
Identity = 109/301 (36.21%), Postives = 173/301 (57.48%), Query Frame = 1
Query: 1501 FSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIAC-------------GIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
             S  S +E   D    ++ + + + K +G G FG+V +GE   +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+E+ S G+L+ +L   R      C                +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L+R G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  376 LSGVSEYELPQDPCWEVSRERLVLGKPLGEGCFGQVVMGEAIGLDKDKPNRITKVAVKMLKSDATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEFASKGNLREYLRARRPHGMEYCYNPDPLPIESMSIKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDVHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLREGHRMDKPSACTQELYLMMKDCWHAVPTQRPTFKQLVE 671          
BLAST of Fibroblast growth factor receptor vs. Ensembl Zebrafish
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:58129])

HSP 1 Score: 207.994 bits (528), Expect = 3.335e-56
Identity = 113/322 (35.09%), Postives = 179/322 (55.59%), Query Frame = 1
Query: 1444 ISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLR----DQNKIACGI---------FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKY 2370
            I+ LS+     +PN S+L   +   +E             + + K +G G FG+V + E   +D  K N    VAVK + ++  D    +  ++L  EM +MK IG H NI++L+G C +     ++++EY S G+L+ +L   R    D +   C I          +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWSYG+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTF+ +VE +
Sbjct:  428 IARLSSSDGPMLPNVSELELPSDPKWE--------FTRTKLTLGKPLGEGCFGQVVMAEAIGIDKEKPNKPLTVAVKMLKDDGTD----KDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPL-YVLVEYASKGNLREYLRARRPPGMDYSFDTCKIPNETLTFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVEDH 736          
BLAST of Fibroblast growth factor receptor vs. Ensembl Zebrafish
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:58129])

HSP 1 Score: 207.994 bits (528), Expect = 4.343e-56
Identity = 113/322 (35.09%), Postives = 179/322 (55.59%), Query Frame = 1
Query: 1444 ISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLR----DQNKIACGI---------FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKY 2370
            I+ LS+     +PN S+L   +   +E             + + K +G G FG+V + E   +D  K N    VAVK + ++  D    +  ++L  EM +MK IG H NI++L+G C +     ++++EY S G+L+ +L   R    D +   C I          +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWSYG+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTF+ +VE +
Sbjct:  447 IARLSSSDGPMLPNVSELELPSDPKWE--------FTRTKLTLGKPLGEGCFGQVVMAEAIGIDKEKPNKPLTVAVKMLKDDGTD----KDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPL-YVLVEYASKGNLREYLRARRPPGMDYSFDTCKIPNETLTFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVEDH 755          
BLAST of Fibroblast growth factor receptor vs. Ensembl Zebrafish
Match: fgfr1b (fibroblast growth factor receptor 1b [Source:ZFIN;Acc:ZDB-GENE-060503-14])

HSP 1 Score: 203.756 bits (517), Expect = 6.152e-55
Identity = 105/278 (37.77%), Postives = 164/278 (58.99%), Query Frame = 1
Query: 1570 ISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIAC-------------GIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            + K +G G FG+V +GE   +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+E+ S G+L+ +L   R      C                +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L+R G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  425 LGKPLGEGCFGQVVMGEAIGLDKDKPNRITKVAVKMLKSDATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEFASKGNLREYLRARRPHGMEYCYNPDPLPIESMSIKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDVHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLREGHRMDKPSACTQELYLMMKDCWHAVPTQRPTFKQLVE 697          
BLAST of Fibroblast growth factor receptor vs. Ensembl Xenopus
Match: tirap (toll-interleukin 1 receptor (TIR) domain containing adaptor protein [Source:Xenbase;Acc:XB-GENE-920263])

HSP 1 Score: 206.453 bits (524), Expect = 2.692e-56
Identity = 113/302 (37.42%), Postives = 171/302 (56.62%), Query Frame = 1
Query: 1501 FSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGE-TNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIAC-------GIFLKF------SRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
             S  S +E   D    +A   + + K +G G FG+V + E   +D  K N   KVAVK + +++     SE + ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R      C          L F      + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    M ++  L++ G+RM  P +C   +  +++ CW      RPTF  +VE
Sbjct:  294 LSGVSEYELPEDPRWEVARDRLILGKPLGEGCFGQVVMAEAIGLDKEKPNKVTKVAVKMLKSDA-----SEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLRARRPPGMEYCYNPTCAPDQLLSFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPMEELFKLLKEGHRMDKPTTCTNELYMMMKDCWHAMPSQRPTFNQLVE 589          
BLAST of Fibroblast growth factor receptor vs. Ensembl Xenopus
Match: tirap (toll-interleukin 1 receptor (TIR) domain containing adaptor protein [Source:Xenbase;Acc:XB-GENE-920263])

HSP 1 Score: 206.068 bits (523), Expect = 3.054e-56
Identity = 113/302 (37.42%), Postives = 171/302 (56.62%), Query Frame = 1
Query: 1501 FSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGE-TNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIAC-------GIFLKF------SRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
             S  S +E   D    +A   + + K +G G FG+V + E   +D  K N   KVAVK + +++     SE + ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R      C          L F      + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    M ++  L++ G+RM  P +C   +  +++ CW      RPTF  +VE
Sbjct:  283 LSGVSEYELPEDPRWEVARDRLILGKPLGEGCFGQVVMAEAIGLDKEKPNKVTKVAVKMLKSDA-----SEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLRARRPPGMEYCYNPTCAPDQLLSFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPMEELFKLLKEGHRMDKPTTCTNELYMMMKDCWHAMPSQRPTFNQLVE 578          
BLAST of Fibroblast growth factor receptor vs. Ensembl Xenopus
Match: tirap (toll-interleukin 1 receptor (TIR) domain containing adaptor protein [Source:Xenbase;Acc:XB-GENE-920263])

HSP 1 Score: 206.453 bits (524), Expect = 3.438e-56
Identity = 113/302 (37.42%), Postives = 171/302 (56.62%), Query Frame = 1
Query: 1501 FSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGE-TNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIAC-------GIFLKF------SRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
             S  S +E   D    +A   + + K +G G FG+V + E   +D  K N   KVAVK + +++     SE + ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R      C          L F      + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    M ++  L++ G+RM  P +C   +  +++ CW      RPTF  +VE
Sbjct:  311 LSGVSEYELPEDPRWEVARDRLILGKPLGEGCFGQVVMAEAIGLDKEKPNKVTKVAVKMLKSDA-----SEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLRARRPPGMEYCYNPTCAPDQLLSFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPMEELFKLLKEGHRMDKPTTCTNELYMMMKDCWHAMPSQRPTFNQLVE 606          
BLAST of Fibroblast growth factor receptor vs. Ensembl Xenopus
Match: tirap (toll-interleukin 1 receptor (TIR) domain containing adaptor protein [Source:Xenbase;Acc:XB-GENE-920263])

HSP 1 Score: 206.838 bits (525), Expect = 1.324e-55
Identity = 113/302 (37.42%), Postives = 171/302 (56.62%), Query Frame = 1
Query: 1501 FSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGE-TNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIAC-------GIFLKF------SRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
             S  S +E   D    +A   + + K +G G FG+V + E   +D  K N   KVAVK + +++     SE + ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R      C          L F      + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    M ++  L++ G+RM  P +C   +  +++ CW      RPTF  +VE
Sbjct:  441 LSGVSEYELPEDPRWEVARDRLILGKPLGEGCFGQVVMAEAIGLDKEKPNKVTKVAVKMLKSDA-----SEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLRARRPPGMEYCYNPTCAPDQLLSFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPMEELFKLLKEGHRMDKPTTCTNELYMMMKDCWHAMPSQRPTFNQLVE 736          
BLAST of Fibroblast growth factor receptor vs. Ensembl Xenopus
Match: tirap (toll-interleukin 1 receptor (TIR) domain containing adaptor protein [Source:Xenbase;Acc:XB-GENE-920263])

HSP 1 Score: 206.453 bits (524), Expect = 1.611e-55
Identity = 113/302 (37.42%), Postives = 171/302 (56.62%), Query Frame = 1
Query: 1501 FSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGE-TNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIAC-------GIFLKF------SRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
             S  S +E   D    +A   + + K +G G FG+V + E   +D  K N   KVAVK + +++     SE + ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R      C          L F      + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    M ++  L++ G+RM  P +C   +  +++ CW      RPTF  +VE
Sbjct:  448 LSGVSEYELPEDPRWEVARDRLILGKPLGEGCFGQVVMAEAIGLDKEKPNKVTKVAVKMLKSDA-----SEKDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLRARRPPGMEYCYNPTCAPDQLLSFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPMEELFKLLKEGHRMDKPTTCTNELYMMMKDCWHAMPSQRPTFNQLVE 743          
BLAST of Fibroblast growth factor receptor vs. Ensembl Mouse
Match: Fgfr3 (fibroblast growth factor receptor 3 [Source:MGI Symbol;Acc:MGI:95524])

HSP 1 Score: 212.231 bits (539), Expect = 1.425e-57
Identity = 117/358 (32.68%), Postives = 197/358 (55.03%), Query Frame = 1
Query: 1372 FCNIQS-----INSKELKKSSRYYDDQTEISLLSTKAIN---KVPNYSKLS------FSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
             C ++S     + S  + K SR+   + ++SL S  ++N    +   ++LS       +  S  E   D    L+   + + K +G G FG+V + E   +D ++      VAVK + +++ D    +  ++L  EM +MK IG H NI++L+G C +     ++++EY + G+L+ FL   R              + ++ C   +  + Q+A GM YL S+  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P SC  ++  +++ CW      RPTFK +VE
Sbjct:  389 LCRLRSPPKKGLGSPTVHKVSRFPLKRQQVSLESNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPKWELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATD----KDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPL-YVLVEYAAKGNLREFLRARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPASCTHDLYMIMRECWHAVPSQRPTFKQLVE 741          
BLAST of Fibroblast growth factor receptor vs. Ensembl Mouse
Match: Fgfr1 (fibroblast growth factor receptor 1 [Source:MGI Symbol;Acc:MGI:95522])

HSP 1 Score: 208.764 bits (530), Expect = 1.048e-56
Identity = 113/311 (36.33%), Postives = 178/311 (57.23%), Query Frame = 1
Query: 1489 SKLSFSTT------SSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            S+LS S T      S +E   D    L    + + K +G G FG+V L E   +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R              + +++    +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  358 SRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVE 663          
BLAST of Fibroblast growth factor receptor vs. Ensembl Mouse
Match: Fgfr1 (fibroblast growth factor receptor 1 [Source:MGI Symbol;Acc:MGI:95522])

HSP 1 Score: 208.764 bits (530), Expect = 1.048e-56
Identity = 113/311 (36.33%), Postives = 178/311 (57.23%), Query Frame = 1
Query: 1489 SKLSFSTT------SSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            S+LS S T      S +E   D    L    + + K +G G FG+V L E   +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R              + +++    +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  358 SRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVE 663          
BLAST of Fibroblast growth factor receptor vs. Ensembl Mouse
Match: Fgfr1 (fibroblast growth factor receptor 1 [Source:MGI Symbol;Acc:MGI:95522])

HSP 1 Score: 208.379 bits (529), Expect = 1.387e-56
Identity = 113/311 (36.33%), Postives = 178/311 (57.23%), Query Frame = 1
Query: 1489 SKLSFSTT------SSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            S+LS S T      S +E   D    L    + + K +G G FG+V L E   +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R              + +++    +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  358 SRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVE 663          
BLAST of Fibroblast growth factor receptor vs. Ensembl Mouse
Match: Fgfr3 (fibroblast growth factor receptor 3 [Source:MGI Symbol;Acc:MGI:95524])

HSP 1 Score: 208.379 bits (529), Expect = 2.277e-56
Identity = 117/358 (32.68%), Postives = 197/358 (55.03%), Query Frame = 1
Query: 1372 FCNIQS-----INSKELKKSSRYYDDQTEISLLSTKAIN---KVPNYSKLS------FSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
             C ++S     + S  + K SR+   + ++SL S  ++N    +   ++LS       +  S  E   D    L+   + + K +G G FG+V + E   +D ++      VAVK + +++ D    +  ++L  EM +MK IG H NI++L+G C +     ++++EY + G+L+ FL   R              + ++ C   +  + Q+A GM YL S+  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P SC  ++  +++ CW      RPTFK +VE
Sbjct:  371 LCRLRSPPKKGLGSPTVHKVSRF-PLKRQVSLESNSSMNSNTPLVRIARLSSGEGPVLANVSELELPADPKWELSRTRLTLGKPLGEGCFGQVVMAEAIGIDKDRTAKPVTVAVKMLKDDATD----KDLSDLVSEMEMMKMIGKHKNIINLLGACTQGGPL-YVLVEYAAKGNLREFLRARRPPGMDYSFDACRLPEEQLTCKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPASCTHDLYMIMRECWHAVPSQRPTFKQLVE 722          
BLAST of Fibroblast growth factor receptor vs. UniProt/SwissProt
Match: sp|P18460|FGFR3_CHICK (Fibroblast growth factor receptor 3 OS=Gallus gallus OX=9031 GN=FGFR3 PE=2 SV=1)

HSP 1 Score: 211.075 bits (536), Expect = 2.359e-56
Identity = 116/351 (33.05%), Postives = 198/351 (56.41%), Query Frame = 1
Query: 1378 NIQSINSKELKKSSRYYDDQTEISLLSTKAIN---KVPNYSKLSFSTTSSFENIH------DFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            N +++N+  ++K S++   + ++SL S  ++N    +   ++LS S      N+       D    LA   + + K +G G FG+V + E   +D +K N    VAVK + +++ D    +  ++L  EM +MK IG H NI++L+G C +     ++++EY S G+L+ +L   R              + ++     +  + Q+A GM YL S+  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C  ++  +++ CW      RPTFK +VE
Sbjct:  395 NKKAMNTTTVQKVSKFPLKRQQVSLESNSSMNSNTPLVRITRLSSSDGPMLANVSELELPPDPKWELARSRLTLGKPLGEGCFGQVVMAEAIGIDKDKPNKAITVAVKMLKDDATD----KDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPL-YVLVEYASKGNLREYLRARRPPGMDYSFDTCKLPEEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHDLYMIMRECWHAVPSQRPTFKQLVE 740          
BLAST of Fibroblast growth factor receptor vs. UniProt/SwissProt
Match: sp|P11362|FGFR1_HUMAN (Fibroblast growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FGFR1 PE=1 SV=3)

HSP 1 Score: 207.994 bits (528), Expect = 2.873e-55
Identity = 113/311 (36.33%), Postives = 178/311 (57.23%), Query Frame = 1
Query: 1489 SKLSFSTT------SSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            S+LS S T      S +E   D    L    + + K +G G FG+V L E   +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R              + +++    +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  447 SRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVE 752          
BLAST of Fibroblast growth factor receptor vs. UniProt/SwissProt
Match: sp|P16092|FGFR1_MOUSE (Fibroblast growth factor receptor 1 OS=Mus musculus OX=10090 GN=Fgfr1 PE=1 SV=2)

HSP 1 Score: 207.994 bits (528), Expect = 3.071e-55
Identity = 113/311 (36.33%), Postives = 178/311 (57.23%), Query Frame = 1
Query: 1489 SKLSFSTT------SSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            S+LS S T      S +E   D    L    + + K +G G FG+V L E   +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R              + +++    +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  447 SRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVLGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVE 752          
BLAST of Fibroblast growth factor receptor vs. UniProt/SwissProt
Match: sp|P21804|FGFR1_CHICK (Fibroblast growth factor receptor 1 OS=Gallus gallus OX=9031 GN=FGFR1 PE=2 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 6.511e-55
Identity = 113/311 (36.33%), Postives = 178/311 (57.23%), Query Frame = 1
Query: 1489 SKLSFSTT------SSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            S+LS S T      S +E   D    L    + + K +G G FG+V L E   +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R              + +++    +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  445 SRLSSSGTPMLAGVSEYELPEDPRWELPRDRLILGKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLQARRPPGMEYCYNPTRIPEEQLSFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSNCTNELYMMMRDCWHAVPSQRPTFKQLVE 750          
BLAST of Fibroblast growth factor receptor vs. UniProt/SwissProt
Match: sp|Q498D6|FGFR4_RAT (Fibroblast growth factor receptor 4 OS=Rattus norvegicus OX=10116 GN=Fgfr4 PE=1 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 7.134e-55
Identity = 105/278 (37.77%), Postives = 164/278 (58.99%), Query Frame = 1
Query: 1570 ISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            + K +G G FG+V   E   +D ++ +    VAVK + +N+ D    +   +L  EM +MK IG H NI++L+G C ++    ++I+EY + G+L+ FL   R              +  ++    +  + Q+A GM YL S+  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+GILLWEI+ LG +PY    + ++  L+R G+RM  P +CP  +  L++ CW      RPTFK +VE
Sbjct:  467 LGKPLGEGCFGQVVRAEALGMDSSRPDQTSTVAVKMLKDNASD----KDLADLISEMEMMKLIGRHKNIINLLGVCTQEGPL-YVIVEYAAKGNLREFLRARRPPGPDLSPDGPRSSEGPLSFPALVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDDVMKIADFGLARGVHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGILLWEIFTLGGSPYPGIPVEELFSLLREGHRMERPPNCPSELYGLMRECWHAAPSQRPTFKQLVE 739          
BLAST of Fibroblast growth factor receptor vs. TrEMBL
Match: A7RN88 (Predicted protein (Fragment) OS=Nematostella vectensis OX=45351 GN=v1g87486 PE=2 SV=1)

HSP 1 Score: 219.935 bits (559), Expect = 1.491e-61
Identity = 117/287 (40.77%), Postives = 171/287 (59.58%), Query Frame = 1
Query: 1567 NISKCIGNGAFGKVFLGE----MDYVDVNK--MNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTD-WLIMEYCSNGSLKCFLDKLRDQNKIA-CGI------------FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEK 2367
            +I   +G+GAFG+V+LGE    +DY   +   M    KVA+K +   +    ESE + +L  E+ ++ ++G H NIV+L+G C +  Q D W+I+E+C+NG L  +L K RD    A C               +  + Q+A GM +L S+  IHRDLAARNVL+++ YV K++DFG++R +  NE Y +H  G+VP+KWIA E L  K YS ++DVWSYG+LLWEI+ LG NPY +     V + + +G RM  P  C   I  ++  CW     DRPTF ++V+K
Sbjct:   17 HIKYLLGSGAFGQVYLGETEGGIDYRRPSAISMRGNIKVAIKTLKGGA---TESE-QKDLLSELKILIHVGSHKNIVNLLGACTKGPQRDLWIILEFCANGDLLSYLKKKRDIYDPAWCAPSEDHDVQFTQMELVSAAYQVARGMEFLASRRCIHRDLAARNVLIADDYVLKVADFGLARDVYKNEEYVKHTPGLVPIKWIAIESLTDKIYSQKSDVWSYGVLLWEIFTLGGNPYPDLHPSDVFEYLLDGKRMEKPVDCAQEIYNIMTDCWVLSPEDRPTFTELVKK 299          
BLAST of Fibroblast growth factor receptor vs. TrEMBL
Match: A0A2R7X2V5 (Breathless OS=Oncopeltus fasciatus OX=7536 GN=btl PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 8.781e-58
Identity = 113/304 (37.17%), Postives = 178/304 (58.55%), Query Frame = 1
Query: 1498 SFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFL--------------DKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENF-SMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            S    S +E   D       +++ +S+ +G GAFGKV      Y  V K      VAVK +     D       T+L  EM +MK IG H NI++++G C +K    ++I+E+C  G+L+ FL              + ++D+N +     + F+ Q+A GM YL+SK+ +HRDLAARN+L+S+ YV KI+DFG++R +  N+ Y +   G +P+KW+APE L  + Y++++DVWSYG+LL+EI  LG  PY +  SM ++  L+R G+RM  P  C   I  +++ CW+++ ++RPTF  +VE
Sbjct:   17 SLEPDSEYELPTDVDWEFPRENLTLSETLGEGAFGKVVKAH-GYGIVEK-GVSTVVAVKMLKQGHTD----AEMTDLVSEMEMMKAIGKHRNIINILGCCTKKGPL-YVIVEFCPYGNLRDFLRQHRPSSGYEPAIGEDIQDRNTLTEKDLISFAFQVARGMEYLSSKSCLHRDLAARNILVSDNYVMKIADFGLARDVHSNDYYRKKGEGRLPVKWMAPEALFHRLYTTKSDVWSYGVLLYEIMTLGGTPYPSVPSMEKLFQLLRTGHRMEKPPGCSLEIYLIMRDCWSYQPKERPTFTKLVE 313          
BLAST of Fibroblast growth factor receptor vs. TrEMBL
Match: A0A3Q3ED85 (Protein kinase domain-containing protein OS=Labrus bergylta OX=56723 PE=3 SV=1)

HSP 1 Score: 210.69 bits (535), Expect = 1.742e-57
Identity = 110/301 (36.54%), Postives = 171/301 (56.81%), Query Frame = 1
Query: 1501 FSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQ-------------NKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
             S  S +E  HD    L    + + K +G G FG+V L E   VD NK     KVAVK +  ++ +    +  ++L  EM +MK IG H NI++L+G C +     ++++EY S G+L+ FL   R               + +     +  + Q++ GMAYL SK  IHRDLAARNVL++E+ V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTF  +VE
Sbjct:   17 LSGVSEYELPHDPAWELPRDRLTLGKPLGEGCFGQVVLAEAVGVDKNKPTRLTKVAVKMLKADATE----KDLSDLISEMEMMKMIGKHKNIINLLGACTQDGPL-YVVVEYASQGNLREFLRTRRPAGLEYWSGSRQEALDSVEVRELVSAAYQVSRGMAYLASKKCIHRDLAARNVLVTEENVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMEKPSACTQEMYLMMRDCWHAVPSRRPTFLQLVE 312          
BLAST of Fibroblast growth factor receptor vs. TrEMBL
Match: V4B5T1 (Protein kinase domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_132698 PE=3 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 2.272e-57
Identity = 106/272 (38.97%), Postives = 159/272 (58.46%), Query Frame = 1
Query: 1564 VNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLR-------DQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDI 2358
            + I + +G G FGKV   E   +D++   T   VAVK     + D  + E       E+SL+K I  H N+VS +GYCK  +Q  ++I+EY S G+L  FL   R       ++ +I       F+ QIA G+A+L+  NIIHRD+AARN+L+SE ++CK++D G++R L  ++ Y     G +P++W+APE L    Y++Q+D+WSYG+LLWEI  LG +PY   S  QV+  +  G ++  P+ C   I++LI  CW  +   RPTF  I
Sbjct:   13 LRIQETLGEGNFGKVVKAEA--LDISGNGTWETVAVKMCKEAATDLQKEE----FSHELSLVKRIPKHPNVVSYLGYCKSLDQPTFIILEYISGGNLIQFLRDRRPGSGSKSNEQEINSSELSSFAHQIAKGLAHLSHHNIIHRDVAARNILISESHICKVADLGLARDLYESDVYEIASKGGLPIRWMAPESLTDGLYTTQSDIWSYGVLLWEIITLGASPYPGLSARQVMSTVVGGNKLECPEFCSQTIKDLIMQCWEIDKDKRPTFDQI 278          
BLAST of Fibroblast growth factor receptor vs. TrEMBL
Match: A0A1B6ML94 (Protein kinase domain-containing protein (Fragment) OS=Graphocephala atropunctata OX=36148 GN=g.36778 PE=4 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 3.038e-57
Identity = 116/327 (35.47%), Postives = 181/327 (55.35%), Query Frame = 1
Query: 1429 DDQTEISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLR--------------DQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENF-SMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            +DQ    LL    I K  + S    S  S +E   D         + + K +G GAFGKV   E   +    ++T   V + +  +   + M      +L  EM +MK IG H NI++L+G C +     ++I+E+  +G+L+ FL + R              D+N +     + F+ Q+A GM YL S+  IHRDLAARNVL+S+ Y+ KI+DFG++R +  ++ Y +   G +P+KW+APE L  + Y++Q+DVWSYG+LLWEI  LG  PY +  SM ++  L+R+G+RM  P  C   I  L++ CW+++  +RP F ++VE
Sbjct:   41 NDQDSSLLLPIVKIEKQKSRSGKLDSAVSEYELPLDCDWEFPRDQLTLGKTLGEGAFGKVIRAEAQGILQQGISTVAAVKMLKEGHTDTEMM------DLVSEMEMMKMIGKHRNIINLLGCCTQDGPL-FVIVEFAPHGNLRDFLRQHRPSSGYEPAIGANVKDRNTLTQKDLVSFAFQVARGMEYLASRRCIHRDLAARNVLVSDNYILKIADFGLARDIHSHDYYRKTTDGRLPVKWMAPEALFHRVYTTQSDVWSYGVLLWEIMTLGGTPYPSVPSMEKLFQLLRSGHRMEKPPCCSLEIYMLMRDCWSYQPNERPMFSELVE 360          
BLAST of Fibroblast growth factor receptor vs. Ensembl Cavefish
Match: fgfr1a (fibroblast growth factor receptor 1a [Source:NCBI gene;Acc:30705])

HSP 1 Score: 206.453 bits (524), Expect = 4.580e-56
Identity = 109/301 (36.21%), Postives = 172/301 (57.14%), Query Frame = 1
Query: 1501 FSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIAC-------------GIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
             S  S +E   D    L    + + K +G G FG+V +GE+  +D +K N   KVAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+E+ S G+L+ +L   R      C                +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  369 LSGVSEYELPQDPRWELPRDKLVLGKPLGEGCFGQVVMGEVLGMDKDKPNRITKVAVKMLKSDATE----KDLSDLISEMEMMKIIGKHKNIINLLGACTQDGPL-YVIVEFASKGNLREYLRARRPPGMEYCYNPDQVPVENMSIKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDRPTTCTHELYMMMRDCWHAIPSQRPTFKQLVE 664          
BLAST of Fibroblast growth factor receptor vs. Ensembl Cavefish
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:58129])

HSP 1 Score: 207.608 bits (527), Expect = 4.932e-56
Identity = 112/322 (34.78%), Postives = 179/322 (55.59%), Query Frame = 1
Query: 1444 ISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLR----DQNKIACGI---------FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKY 2370
            I+ LS+     +PN S+L   +   +E             + + K +G G FG+V + E   +D  K N    VAVK + ++  D    +  ++L  EM +MK IG H NI++L+G C +     ++++EY S G+L+ +L   R    D +   C I          +  + Q+A GM YL S+  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWSYG+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTF+ +VE +
Sbjct:  442 IARLSSSDGPMLPNVSELELPSDPKWE--------FPRSKLTLGKALGEGCFGQVVMAEAIGIDKEKPNKPLTVAVKMLKDDGTD----KDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPL-YVLVEYASKGNLREYLRARRPPGMDYSFDTCKIPNETLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVEDH 750          
BLAST of Fibroblast growth factor receptor vs. Ensembl Cavefish
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:58129])

HSP 1 Score: 207.608 bits (527), Expect = 5.377e-56
Identity = 112/322 (34.78%), Postives = 179/322 (55.59%), Query Frame = 1
Query: 1444 ISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLR----DQNKIACGI---------FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKY 2370
            I+ LS+     +PN S+L   +   +E             + + K +G G FG+V + E   +D  K N    VAVK + ++  D    +  ++L  EM +MK IG H NI++L+G C +     ++++EY S G+L+ +L   R    D +   C I          +  + Q+A GM YL S+  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWSYG+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTF+ +VE +
Sbjct:  443 IARLSSSDGPMLPNVSELELPSDPKWE--------FPRSKLTLGKALGEGCFGQVVMAEAIGIDKEKPNKPLTVAVKMLKDDGTD----KDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPL-YVLVEYASKGNLREYLRARRPPGMDYSFDTCKIPNETLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVEDH 751          
BLAST of Fibroblast growth factor receptor vs. Ensembl Cavefish
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:58129])

HSP 1 Score: 199.519 bits (506), Expect = 3.276e-54
Identity = 128/410 (31.22%), Postives = 210/410 (51.22%), Query Frame = 1
Query: 1183 FTIQITLGIVISF-IVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKELKKSSRYYDDQTEISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLR----DQNKIACGI---------FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKY 2370
            F I  T+ ++  F IV++ L  + M T K      ++K S              K+ L ++++S  +  S+NS               I+ LS+     +PN S+L   +   +E             + + K +G G FG+V + E   +D  K N    VAVK + ++  D    +  ++L  EM +MK IG H NI++L+G C +     ++++EY S G+L+ +L   R    D +   C I          +  + Q+A GM    S + IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWSYG+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTF+ +VE +
Sbjct:  211 FLISGTVCVLFVFTIVIIILCRLRMSTQKTLPTPPVQKLS--------------KFPLKRQQVSLESNSSMNSNT---------PLVRIARLSSSDGPMLPNVSELELPSDPKWE--------FPRSKLTLGKALGEGCFGQVVMAEAIGIDKEKPNKPLTVAVKMLKDDGTD----KDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPL-YVLVEYASKGNLREYLRARRPPGMDYSFDTCKIPNETLTFKDLVSCAYQVARGME--ASWSCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVEDH 582          
BLAST of Fibroblast growth factor receptor vs. Ensembl Cavefish
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 196.438 bits (498), Expect = 2.478e-52
Identity = 99/280 (35.36%), Postives = 164/280 (58.57%), Query Frame = 1
Query: 1564 VNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQN-------------KIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            + + K +G G FG+V + E   +D +K      VAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R                 +     +  + Q+A GM YL S+  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+L+WEI+ LG +PY    + ++  L++ G+RM  P +C  ++  +++ CW   +  RPTFK +VE
Sbjct:  445 LTLGKPLGEGCFGQVVMAEALGIDKDKPKEAVTVAVKMLKDDATE----KDLSDLVSEMEMMKMIGRHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLRARRPPGMEYSYDIARVSDEPLTFKDLVSCTYQVARGMEYLASQKCIHRDLAARNVLVTESNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTNDLYMMMKDCWHAISSQRPTFKQLVE 719          
BLAST of Fibroblast growth factor receptor vs. Ensembl Sea Lamprey
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 209.534 bits (532), Expect = 1.195e-58
Identity = 107/303 (35.31%), Postives = 174/303 (57.43%), Query Frame = 1
Query: 1498 SFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQN--------------KIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            + +  S +E   D     + + + + K +G G FG+V + E   +D  K N   +VAVK +  ++ D    +   +L  EM +MKNIG H NI++L+G C +     ++I+E+ + G+L+ FL   R                 +++    + F+ Q+A GM YL SK  IHRDLAARNVL+++  V KI+DFG++R ++  + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P  C   +  +++ CWA     RPTFK +VE
Sbjct:  254 TLAGVSEYELTEDPRWEFSREWLTLGKPLGEGCFGQVVMAEALGIDKEKPNRSLRVAVKMLKEDATD----KDLYDLVSEMEMMKNIGKHKNIINLLGACTQGGPL-YVIVEFAAKGNLREFLRARRPPGTEYTFEGAAAAQGEQLSIKELVSFTYQVARGMEYLASKKCIHRDLAARNVLVTDDNVMKIADFGLARDVNYIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDRPALCSTELYMMMKDCWAAVPSHRPTFKQLVE 551          
BLAST of Fibroblast growth factor receptor vs. Ensembl Sea Lamprey
Match: fer (fer (fps/fes related) tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-060526-234])

HSP 1 Score: 196.438 bits (498), Expect = 5.628e-53
Identity = 107/270 (39.63%), Postives = 148/270 (54.81%), Query Frame = 1
Query: 1549 LAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDI 2358
            L   D+ + + +G G FG+V+ G +    V        VAVK    N    +  + +     E  ++K    H N+V LIG C R+    +++ME    G    FL   R+ ++++    L +S Q A GMAYL S N IHRDLAARN L+ E  V KISDFGMSRQ +        V   +P+KW APE L    Y++ +DVWSYGILLWEI++LG++PY  +S     + + +GYRMP P  CP  I  L+  CW F A  RPTF ++
Sbjct:  553 LDHDDIILGEKLGKGNFGEVYAGRLKASGV-------PVAVKACHEN----LSQDLKNRFLMEARILKRYN-HPNVVRLIGVCTRRTPV-YIVMELVRGGDFLTFLR--REGSRLSVPQLLNYSEQAAAGMAYLESHNCIHRDLAARNCLVGEASVLKISDFGMSRQQADGVYLATGVMRQIPIKWTAPEALHYGTYTTMSDVWSYGILLWEIFSLGSSPYPGWSNKMACEQVASGYRMPPPAVCPDGIYSLMLRCWEFHAEQRPTFTEL 807          
BLAST of Fibroblast growth factor receptor vs. Ensembl Sea Lamprey
Match: fgfr2 (fibroblast growth factor receptor 2 [Source:NCBI gene;Acc:352940])

HSP 1 Score: 184.882 bits (468), Expect = 4.134e-50
Identity = 98/281 (34.88%), Postives = 154/281 (54.80%), Query Frame = 1
Query: 1498 SFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQN---------------KIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNI 2295
                 S +E   D         + + K +G G FG+V + +   VD  K N    VAVK + +++ D    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R                  ++     +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +CP  +
Sbjct:  310 GLPGVSEYELPEDPRWEFPRDRLTLGKPLGEGCFGQVVMADGLGVDKEKPNKPATVAVKMLKDDATD----KELSDLVSEMEVMKMIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLRARRPPGVGYSFDPIGYSDPSEQLTFKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQCDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPSNCPNEL 585          
BLAST of Fibroblast growth factor receptor vs. Ensembl Sea Lamprey
Match: NTRK2 (neurotrophic receptor tyrosine kinase 2 [Source:HGNC Symbol;Acc:HGNC:8032])

HSP 1 Score: 177.178 bits (448), Expect = 1.805e-49
Identity = 100/287 (34.84%), Postives = 152/287 (52.96%), Query Frame = 1
Query: 1546 NLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACG-------------IFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEK 2367
            ++  +D+ +   +G GAFGKV+L E   +DV +      VA K     +L  +      + Y+E  L+ N+  H +IV   G C  + +   ++ EY  NG L  FL +LR  + +  G               L    QIA GMAYL S++ +HRDLA RN L+    V KI DFGMSR +   + Y    H ++P++W+ PE ++ +K+++ +DVWS G++LWEI+  G  P+   S  +VID I  G  +  P SCP  + EL+ GCW  E + R   KDI+ +
Sbjct:   70 HIKRQDIALMCELGEGAFGKVYLAECSSLDVGQ--EPMLVAAK-----TLKDLSDGARKDFYREAELLTNL-QHEHIVRFYGVCV-EGEPLIMVFEYMKNGDLNKFL-RLRGPDAVFMGDAPQAEPRLLSQAQMLNMGSQIAAGMAYLASQHFVHRDLATRNCLVGAGLVVKIGDFGMSRDVYSTDYYRVGGHTMLPIRWMPPESIMYRKFTADSDVWSLGVVLWEIFTYGKQPWYQLSNTEVIDCICQGRVLERPRSCPMEVYELMLGCWHREPQHRLGIKDILAR 346          
BLAST of Fibroblast growth factor receptor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004129.1 (pep scaffold:Pmarinus_7.0:GL490249:304:4500:1 gene:ENSPMAG00000003774.1 transcript:ENSPMAT00000004129.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 173.326 bits (438), Expect = 4.238e-49
Identity = 93/268 (34.70%), Postives = 147/268 (54.85%), Query Frame = 1
Query: 1546 NLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTF 2349
            ++    + +   +G G FG+V+ G        + N    VA+K +  NS             KE+  M +   H N++ +   CK K    W++ E    G++  +L +   +      +++ F   IA GMAYL+ K  IH DLA RN+L+ +  +CK++DFG+S +L   E YY+    +VP +W+APEVLIQ K++ ++DVWS+G+LL+E++  G  PY +    QV DLI+ G R+  PD+CP  +  ++Q CW FE R RP F
Sbjct:   17 HVPRSSIKMGNLLGRGNFGEVYEG--------RWNDTTDVAIKIVRTNS-------SFDTFMKEVKTMISFK-HENVLQIYAVCKEK-WPYWIVTELVPYGNMLHYLGRFGHELSEVERLYMAFG--IASGMAYLSKKRCIHCDLAGRNILMGQHNICKVADFGLSHKL--KEEYYDATGHVVPFQWMAPEVLIQLKFTRKSDVWSFGVLLYELFTDGKRPYADMDKQQVQDLIKCGGRLKRPDACPNVVYHIMQRCWNFEHRKRPPF 263          
BLAST of Fibroblast growth factor receptor vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 112.849 bits (281), Expect = 6.877e-26
Identity = 86/285 (30.18%), Postives = 146/285 (51.23%), Query Frame = 1
Query: 1576 KCIGNGAFGKVFL------GEM---DYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEH----VHGIVPLKWIAPEVLIQKK-YSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLI-RNGYRMPIP-DSCP--GNI-RELIQGCWAFEARDRPTFKDIVEKYF 2373
            + IG G+FG V+L      GEM     V+V K +++ +  +  +               L  E+S +K++  H NIV  +G+ + KN    L +EY + GS+   +   R   +    +    + Q+  G+AYL SK I+HRD+ A N+LL +  +CKISDFG+SR+   ++  Y +    + G V   W+APE++  K+ YS++ D+WS G ++ E++A G  P+ N  ++  +  I ++    PIP D+ P    I R  +  C+      RPT  +++   F
Sbjct: 1179 EMIGKGSFGAVYLCLNVTTGEMMAVKQVEVPKYSSQNEAILSTV-------------EALRSEVSTLKDLD-HLNIVQYLGF-ENKNNIYSLFLEYVAGGSVGSLI---RMYGRFDEPLIKHLTTQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISRK---SKDIYSNSDMTMRGTV--FWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFA-GKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANELLSHPF 1439          
BLAST of Fibroblast growth factor receptor vs. Ensembl Yeast
Match: STE11 (Signal transducing MEK kinase; involved in pheromone response and pseudohyphal/invasive growth pathways where it phosphorylates Ste7p, and the high osmolarity response pathway, via phosphorylation of Pbs2p; regulated by Ste20p and Ste50p; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004354])

HSP 1 Score: 110.923 bits (276), Expect = 1.508e-25
Identity = 94/341 (27.57%), Postives = 157/341 (46.04%), Query Frame = 1
Query: 1501 FSTTSSFENIHDFMGNLAE-----------KDVNISKCIGNGAFGKVFLGEMDYVDVNKMN--TKYKVAVK--EIMNNSLDFME---------------------------SEGETN----------LYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLS-VNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
             S  S  E  HDF G  ++           K+     CIG+G+FG V+LG         MN  T   +AVK  EI NN++                               S  +TN          L  EM+L+K + +H NIV+  G  +     + + +EY   GS+   L+   +       +   F+RQI +G+AYL  KNIIHRD+   N+L+  K   KI+DFG+S++LS +N+   +       + W++PEV+ Q   +++AD+WS G ++ E++  G +P+ +FS +Q I  I       IP       +  ++  +  + + RP+  ++++
Sbjct:  383 LSVESGEEEDHDFFGEDSDIVSLPTKIATPKNWLKGACIGSGSFGSVYLG---------MNAHTGELMAVKQVEIKNNNIGVPTDNNKQANSDENNEQEEQQEKIEDVGAVSHPKTNQNIHRKMVDALQHEMNLLKEL-HHENIVTYYGASQEGGNLN-IFLEYVPGGSVSSMLN---NYGPFEESLITNFTRQILIGVAYLHKKNIIHRDIKGANILIDIKGCVKITDFGISKKLSPLNKKQNKRASLQGSVFWMSPEVVKQTATTAKADIWSTGCVVIEMFT-GKHPFPDFSQMQAIFKIGTNTTPEIPSWATSEGKNFLRKAFELDYQYRPSALELLQ 708          
BLAST of Fibroblast growth factor receptor vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 110.538 bits (275), Expect = 2.691e-25
Identity = 82/287 (28.57%), Postives = 143/287 (49.83%), Query Frame = 1
Query: 1552 AEKDV--NISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKYF*FKINNFVVEK 2406
            +EK V  ++ + IG G++G V      Y  +NK +T   VA+KE++     +   E   ++  E+SL+KN+  H NIV   G+  RK+   ++++EYC+NGSL+  +   R    ++      +  Q  LG+ YL  + +IHRD+ A N+LLS     K++DFG+S  ++ +            L W+APE+L  +  S+ +D+WS G  + E+      PY N +   +   + N    P P S    +++ +  C+      RPT   +++  +     N  V+K
Sbjct:   19 SEKSVQYHLKQVIGRGSYGVV------YKAINK-HTDQVVAIKEVV-----YENDEELNDIMAEISLLKNLN-HNNIVKYHGFI-RKSYELYILLEYCANGSLRRLIS--RSSTGLSENESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAGT-----LNWMAPEILGNRGASTLSDIWSLGATVVEMLT-KNPPYHNLTDANIYYAVENDTYYP-PSSFSEPLKDFLSKCFVKNMYKRPTADQLLKHVWINSTENVKVDK 282          
BLAST of Fibroblast growth factor receptor vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 102.064 bits (253), Expect = 1.082e-22
Identity = 90/372 (24.19%), Postives = 167/372 (44.89%), Query Frame = 1
Query: 1345 YGLNKKELSFCNIQSI---NSKELKKSSRYYDDQTEISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNI--SKC------IGNGAFGKVFLGEMDYV------------DVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLK----FSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIR-NG-YRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKYF 2373
            Y  N+   S  ++Q +   N +   ++ R    + +  +     + K    ++ + ST        + M  L +  VN   S+C       G GA G V+L E  ++            D+++ +   KVA+K+++       +   +  +  E+ +MK+   H NIV+ +    R +   W++ME+   GSL   ++     +     +         R+   G+ +L  K+IIHRD+ + NVLL  +   KI+DFG   +L+   +    + G     W+APEV+ Q++Y  + DVWS GI+  E+   G  PY N   ++ + LI  NG  ++  P+S    I+  +  C   + R R + ++++   F
Sbjct:  469 YPSNQNATSNTHVQPVAPKNDQSTPQTMRQAPKRPDADVAQPGGVAKPKKPARPTMSTA-------EIMSKLKKVTVNADPSQCFKVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMV-----LSKQPRKELIVNEILVMKD-SRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTP--YWMAPEVVKQREYDEKIDVWSLGIMTIEMLE-GEPPYLNEDPLKALYLIATNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGF 824          
BLAST of Fibroblast growth factor receptor vs. Ensembl Yeast
Match: ATG1 (Protein serine/threonine kinase; required for vesicle formation in autophagy and the cytoplasm-to-vacuole targeting (Cvt) pathway; structurally required for phagophore assembly site formation; during autophagy forms a complex with Atg13p and Atg17p; essential for cell cycle progression from G2/M to G1 under nitrogen starvation [Source:SGD;Acc:S000003148])

HSP 1 Score: 100.523 bits (249), Expect = 3.320e-22
Identity = 93/332 (28.01%), Postives = 154/332 (46.39%), Query Frame = 1
Query: 1507 TTSSFENIHDFMGN-LAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLD---FMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD---------------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKY---------------------VCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYR-MPIPDSC--PGNIRELIQGCWAFEARDRPTFKD 2355
            TTS   N+    GN  AEK+      IG G+F  V+ G +        +    VA+KE+    L     +E     NL  E++++K I  H +IV LI  C+R +   +LIMEYC+ G L   L + ++                      N +     L + +Q+A  + +L SKN++HRD+  +N+LLS                        + KI+DFG +R L  N +  E + G  PL ++APE+L  +KY+++AD+WS G +++E+   GT P+   + +++   I+     +  P  C     ++ELI     F+   R  F++
Sbjct:   10 TTSVNHNLMASAGNYTAEKE------IGKGSFATVYRGHL------TSDKSQHVAIKEVSRAKLKNKKLLE-----NLEIEIAILKKIK-HPHIVGLID-CERTSTDFYLIMEYCALGDLTFLLKRRKELMENHPLLRTVFEKYPPPSENHNGLHRAFVLSYLQQLASALKFLRSKNLVHRDIKPQNLLLSTPLIGYHDSKSFHELGFVGIYNLPILKIADFGFARFLP-NTSLAETLCG-SPL-YMAPEILNYQKYNAKADLWSVGTVVFEM-CCGTPPFRASNHLELFKKIKRANDVITFPSYCNIEPELKELICSLLTFDPAQRIGFEE 318          
BLAST of Fibroblast growth factor receptor vs. Ensembl Nematostella
Match: EDO47094 (Predicted protein; Vascular endothelial growth factor receptor-like protein [Source:UniProtKB/TrEMBL;Acc:A7RN88])

HSP 1 Score: 219.935 bits (559), Expect = 2.062e-65
Identity = 117/287 (40.77%), Postives = 171/287 (59.58%), Query Frame = 1
Query: 1567 NISKCIGNGAFGKVFLGE----MDYVDVNK--MNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTD-WLIMEYCSNGSLKCFLDKLRDQNKIA-CGI------------FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEK 2367
            +I   +G+GAFG+V+LGE    +DY   +   M    KVA+K +   +    ESE + +L  E+ ++ ++G H NIV+L+G C +  Q D W+I+E+C+NG L  +L K RD    A C               +  + Q+A GM +L S+  IHRDLAARNVL+++ YV K++DFG++R +  NE Y +H  G+VP+KWIA E L  K YS ++DVWSYG+LLWEI+ LG NPY +     V + + +G RM  P  C   I  ++  CW     DRPTF ++V+K
Sbjct:   17 HIKYLLGSGAFGQVYLGETEGGIDYRRPSAISMRGNIKVAIKTLKGGA---TESE-QKDLLSELKILIHVGSHKNIVNLLGACTKGPQRDLWIILEFCANGDLLSYLKKKRDIYDPAWCAPSEDHDVQFTQMELVSAAYQVARGMEFLASRRCIHRDLAARNVLIADDYVLKVADFGLARDVYKNEEYVKHTPGLVPIKWIAIESLTDKIYSQKSDVWSYGVLLWEIFTLGGNPYPDLHPSDVFEYLLDGKRMEKPVDCAQEIYNIMTDCWVLSPEDRPTFTELVKK 299          
BLAST of Fibroblast growth factor receptor vs. Ensembl Nematostella
Match: EDO49126 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGW8])

HSP 1 Score: 200.675 bits (509), Expect = 6.882e-58
Identity = 108/293 (36.86%), Postives = 165/293 (56.31%), Query Frame = 1
Query: 1537 FMGNLAEKD--------VNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQ-------------NKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYE-HVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTF 2349
             +G + E D        +   + +G+GAFGKV    +  +     N +  VAVK++  N++  ME     N   E+ +MK +G H NIVS++G      Q   LI EYC  G L+ +L  +RD+              ++     L F+RQIA+GM YL+ K  +HRDLAARN+L+ E  + KISDFG++R +  +  Y++ H  G +PLKW+APE + Q  +++++DVW++G++LWEI  LG +PY   S  +    ++NGYRM  PD C   +  +++ CWA    DRPTF
Sbjct:    1 MLGPIPEPDEWEVDYSSIAFGEVVGSGAFGKVTKATIVGLPGGPENKETVVAVKKL--NAMATMEDR--RNFLSEIEMMKQLGKHLNIVSILGCVTHAGQL-CLITEYCPYGDLRNYLRAIRDKVSTRDSLAGRAPGRELTQNDLLSFARQIAVGMEYLSQKMFVHRDLAARNILICEDNLVKISDFGLTRDVYESSEYHKMHNTGKLPLKWMAPEAIFQNVHTTKSDVWAFGVVLWEIVTLGGSPYPGQSGKEFYKKLKNGYRMEKPDMCSPELYAMMRSCWASSPEDRPTF 288          
BLAST of Fibroblast growth factor receptor vs. Ensembl Nematostella
Match: EDO37886 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEI8])

HSP 1 Score: 198.364 bits (503), Expect = 1.628e-57
Identity = 108/297 (36.36%), Postives = 166/297 (55.89%), Query Frame = 1
Query: 1531 HDFMGNLAEKDVNISKCIGNGAFGKVF----LGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGE-TNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEK 2367
            +D      EK + + + +G+GAFG+V     +G +     +K +    VAVK +  N+     SE +  +L  E+ +M ++G H NI++L+G C R  +   LI+EY  +G+L  FL   RD             + +      +  + QIA GM +L SK  IHRDLAARNVL+ E Y  KI DFG++R +   + Y +   G++P+KW+APE L  ++YSS+ DVW++G++LWEI  LG +PY    + Q++D I  G RM  P  CP  I  ++  CW+ E   RPTF ++V +
Sbjct:    4 YDADWEFPEKRLILQEVLGSGAFGQVIKAEAIGILSLSARDKTSEATTVAVKMLKENA-----SESDYKDLASELKIMIHLGEHKNIINLLGACTR-GENLMLILEYAKHGNLLQFLRTRRDIYEPTWKKTTFNPKTEFTLADQVVDAYQIAQGMDFLASKKCIHRDLAARNVLVDEGYALKIGDFGLARDIYKTDLYVKKGAGLLPVKWMAPEALFDREYSSKTDVWAFGVVLWEILTLGGSPYPGVPLEQLLDYINEGKRMAQPRDCPPEIYAIMCDCWSLEQDRRPTFAELVRR 294          
BLAST of Fibroblast growth factor receptor vs. Ensembl Nematostella
Match: EDO47097 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN91])

HSP 1 Score: 196.438 bits (498), Expect = 7.426e-57
Identity = 106/281 (37.72%), Postives = 159/281 (56.58%), Query Frame = 1
Query: 1564 VNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWL-IMEYCSNGSLKCFLDKLRD-------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            + +   +G GAFG+VFL E   +  NK  T+  VA K +  N+ D   SE   +L  E+ ++ +IG H NIV+L+G C +  + D L I+EYC +G+L  FL K RD                      +  S Q++  M +L S+  +HRDLAARNVL+ E YV KI+DFG++R +   E Y +   G++P+KW+A E L+ + Y+  +DVWS+G+LLWEI+ LG +PY      +V   +  G RM  P+ CP  + +L+  CW  +   RPTF  ++E
Sbjct:   16 IKLLDIVGTGAFGQVFLAEAVGIS-NKQVTR--VACKGLKENATD---SEYR-DLLSELKILMHIGEHKNIVNLLGACTKGRECDLLVIIEYCPHGNLLNFLRKRRDVFEATWSPPTEKPDETFTLTDLVITSFQVSRAMQFLASRRCVHRDLAARNVLVGENYVMKIADFGLARDIYKEEHYVKTTAGLLPVKWMAIEALVDQVYTHSSDVWSFGVLLWEIFTLGGSPYPGLPANEVYQYLMEGQRMAQPEDCPQEMYDLMLRCWQHDPAQRPTFTQLLE 289          
BLAST of Fibroblast growth factor receptor vs. Ensembl Nematostella
Match: EDO43236 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ71])

HSP 1 Score: 204.142 bits (518), Expect = 2.371e-56
Identity = 119/338 (35.21%), Postives = 188/338 (55.62%), Query Frame = 1
Query: 1423 YYDDQTEISLLSTKAINKVPNYSKLSFSTTSSFE-NIHDFMGNLAEKD-------VNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD--------------QNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKY 2370
            Y + +T I   ST + N      +    TTSS E +  DF     ++D       + I + +G GAFG V   E   + +  M  ++ VAVK +     D  E+E   +L  EM  MKNIG H NI++LIG C  +N   ++++E+  +G+L+ FL + R               Q  +    F+ F+ QIA GM YL+ K  IHRDLAARN+L+ E YV KI+DFG++R +   + Y +   G +P+KW+A E L  + Y++Q+DVW++GILLWEI+ LG +PY    + ++ +L+++GYRM +P  CP  + +++  CW      RP+F ++  ++
Sbjct:  281 YANSRTRIG--STGSANSSTPLIRYRNVTTSSIEESFLDFYELPIDEDWEIDRSQITIKEQLGEGAFGLVMKAEA--LGLTDMPYRHTVAVKML---KADATENE-LADLLSEMDTMKNIGSHKNIINLIGACT-QNGPLYVVVEFAPHGNLRQFLRERRPSDYHRSRSDSSTHSQPSLIVRDFISFAFQIARGMEYLSFKKCIHRDLAARNILVGEDYVMKIADFGLARNVRDMDYYRKATDGRLPIKWLAIEALFDRVYTTQSDVWTFGILLWEIFTLGGSPYPGIPVEKLFELLKSGYRMQMPQKCPDKMYDIMLSCWNENPNARPSFTELRAEF 609          
BLAST of Fibroblast growth factor receptor vs. Ensembl Medaka
Match: ENSORLT00000000391.2 (fibroblast growth factor receptor 1-A [Source:NCBI gene;Acc:101155126])

HSP 1 Score: 204.527 bits (519), Expect = 1.759e-55
Identity = 112/312 (35.90%), Postives = 180/312 (57.69%), Query Frame = 1
Query: 1489 SKLSFSTTS------SFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGE-TNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD---------QNKIACGI----FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            S+LS + TS       +E  +D    L    + + K +G G FG+V L E   +D +K     KVAVK +  ++     SE + ++L  EM +MK IG H NI++L+G C ++    ++++EY S G+L+ +L   R          +  +  G+     +  + Q+A GM+YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTF+ +VE
Sbjct:  359 SRLSSTATSVLAGVSEYELPYDPAWELPRDRLTLGKPLGEGCFGQVVLAEAVGLDRSKPARLTKVAVKMLKADA-----SEKDLSDLISEMEMMKMIGKHKNIINLLGACTQEGPL-YVVVEYASKGNLREYLRARRPVGGEYWSGARQPLLGGVEIRELVSAAYQVARGMSYLASKKCIHRDLAARNVLVTEDDVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMEKPSACTQELYLMMRDCWHAVPSRRPTFQQLVE 664          
BLAST of Fibroblast growth factor receptor vs. Ensembl Medaka
Match: ENSORLT00000040527.1 (fibroblast growth factor receptor 1-A [Source:NCBI gene;Acc:101155126])

HSP 1 Score: 204.527 bits (519), Expect = 2.243e-55
Identity = 112/312 (35.90%), Postives = 180/312 (57.69%), Query Frame = 1
Query: 1489 SKLSFSTTS------SFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGE-TNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRD---------QNKIACGI----FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            S+LS + TS       +E  +D    L    + + K +G G FG+V L E   +D +K     KVAVK +  ++     SE + ++L  EM +MK IG H NI++L+G C ++    ++++EY S G+L+ +L   R          +  +  G+     +  + Q+A GM+YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTF+ +VE
Sbjct:  359 SRLSSTATSVLAGVSEYELPYDPAWELPRDRLTLGKPLGEGCFGQVVLAEAVGLDRSKPARLTKVAVKMLKADA-----SEKDLSDLISEMEMMKMIGKHKNIINLLGACTQEGPL-YVVVEYASKGNLREYLRARRPVGGEYWSGARQPLLGGVEIRELVSAAYQVARGMSYLASKKCIHRDLAARNVLVTEDDVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMEKPSACTQELYLMMRDCWHAVPSRRPTFQQLVE 664          
BLAST of Fibroblast growth factor receptor vs. Ensembl Medaka
Match: fgfr1 (fibroblast growth factor receptor 1 [Source:NCBI gene;Acc:100125448])

HSP 1 Score: 204.912 bits (520), Expect = 4.463e-55
Identity = 108/301 (35.88%), Postives = 170/301 (56.48%), Query Frame = 1
Query: 1501 FSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIAC-------------GIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
             S  S +E   D    +    + + K +G G FG+V +GE+  +D  K N    VAVK + +++ +    +  ++L  EM +MK IG H NI++L+G C +     ++I+EY S G+L+ +L   R      C                +  + Q+A GM YL SK  IHRDLAARNVL++E  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWS+G+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTFK +VE
Sbjct:  468 LSGVSEYELPQDPRWEVPRDKLVLGKPLGEGCFGQVMMGEVLGLDKEKPNRVTNVAVKMLKSDATE----KDLSDLISEMEMMKIIGKHKNIINLLGACTQDGPL-YVIVEYASKGNLREYLRARRPPGMEYCYNPDQVSVETMSIKDLVSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNGRLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMDKPSTCTHELYMMMRDCWHAVPSQRPTFKQLVE 763          
BLAST of Fibroblast growth factor receptor vs. Ensembl Medaka
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:100049424])

HSP 1 Score: 201.06 bits (510), Expect = 7.811e-54
Identity = 112/349 (32.09%), Postives = 192/349 (55.01%), Query Frame = 1
Query: 1384 QSINSKELKKSSRYYDDQTEISLLSTKAIN---KVPNYSKLSFSTTSSFENI------HDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLR----DQNKIACGI---------FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            +++ +  ++K S++   + ++SL S  ++N    +   ++LS S      N+       D         + + K +G G FG+V + E   +D  K N    VA K + +++ D    +  ++L  EM +MK IG H NI++L+G C +     ++++E+ S G+L+ +L   R    D +   C I          +  + Q+A GM YL S+  IHRDLAARNVL+++  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWSYG+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTF+ +VE
Sbjct:  411 KTVPAPPVQKLSKFPLKRQQVSLDSNSSMNSNTPLVRIARLSSSDGPMLANVLELELPSDPKWEFPRTRLTLGKPLGEGCFGQVVMAEAIGIDKEKPNKPLTVAAKMLKDDATD----KDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPL-YVLVEFASKGNLREYLRARRPPGMDYSFDTCKIPDEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTDDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVE 754          
BLAST of Fibroblast growth factor receptor vs. Ensembl Medaka
Match: fgfr3 (fibroblast growth factor receptor 3 [Source:NCBI gene;Acc:100049424])

HSP 1 Score: 201.06 bits (510), Expect = 9.348e-54
Identity = 112/349 (32.09%), Postives = 192/349 (55.01%), Query Frame = 1
Query: 1384 QSINSKELKKSSRYYDDQTEISLLSTKAIN---KVPNYSKLSFSTTSSFENI------HDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLR----DQNKIACGI---------FLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            +++ +  ++K S++   + ++SL S  ++N    +   ++LS S      N+       D         + + K +G G FG+V + E   +D  K N    VA K + +++ D    +  ++L  EM +MK IG H NI++L+G C +     ++++E+ S G+L+ +L   R    D +   C I          +  + Q+A GM YL S+  IHRDLAARNVL+++  V KI+DFG++R +   + Y +  +G +P+KW+APE L  + Y+ Q+DVWSYG+LLWEI+ LG +PY    + ++  L++ G+RM  P +C   +  +++ CW      RPTF+ +VE
Sbjct:  411 KTVPAPPVQKLSKFPLKRQQVSLDSNSSMNSNTPLVRIARLSSSDGPMLANVLELELPSDPKWEFPRTRLTLGKPLGEGCFGQVVMAEAIGIDKEKPNKPLTVAAKMLKDDATD----KDLSDLVSEMEMMKMIGKHKNIINLLGACTQDGPL-YVLVEFASKGNLREYLRARRPPGMDYSFDTCKIPDEQLTFKDLVSCAYQVARGMEYLASQKCIHRDLAARNVLVTDDNVMKIADFGLARDVHNIDYYKKTTNGRLPVKWMAPEALFDRVYTHQSDVWSYGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCTHELYMIMRECWHAVPSQRPTFRQLVE 754          
BLAST of Fibroblast growth factor receptor vs. Planmine SMEST
Match: SMESG000051694.1 (SMESG000051694.1)

HSP 1 Score: 1037.71 bits (2682), Expect = 0.000e+0
Identity = 507/519 (97.69%), Postives = 510/519 (98.27%), Query Frame = 1
Query:  817 INIILHLSLVEKFNHRQNLMKNFQFFLFESQVYNGKFLKYVSFGNDTDTSQIKITNKYILKIYCVAEKCHYHVNIFPSMTNDSQIGISHRTPRNITILNKIKFTPKKTKSTNHSKTVIFNGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKELKKSSRYYDDQTEISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKYF 2373
            IN+ + L  +EKFNHRQNLMKNFQF LFE QVYNGKFLKYVSFGNDTDTSQIKITNKYILKIYCVAEKCHYHVNIFPSMTNDSQIGISH TPRNITILNKIKFTPKKTKSTNHSKTVIFNGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKELKKSSRYYDDQTEISLLSTK INKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFK IVEKYF
Sbjct:  114 INVEVILIQLEKFNHRQNLMKNFQFILFEIQVYNGKFLKYVSFGNDTDTSQIKITNKYILKIYCVAEKCHYHVNIFPSMTNDSQIGISHSTPRNITILNKIKFTPKKTKSTNHSKTVIFNGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKELKKSSRYYDDQTEISLLSTKTINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKVIVEKYF 632          

HSP 2 Score: 258.07 bits (658), Expect = 1.582e-75
Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = 1
Query:   64 MLYSIYSLYLNSVISLCGICPILSKSGFISNSFWNNAIFISLNETVQCVHPPNVSCLWTHYNDNPNNRNFIDYTFSKNDTCVFEAYKWLLFKRKLSDKVNCNFFASYQEMDISINVEVILIQ 429
            MLYSIYSLYLNSVISLCGICPILSKSGFISNSFWNNAIFISLNETVQCVHPPNVSCLWTHYNDNPNNRNFIDYTFSKNDTCVFEAYKWLLFKRKLSDKVNCNFFASYQEMDISINVEVILIQ
Sbjct:    1 MLYSIYSLYLNSVISLCGICPILSKSGFISNSFWNNAIFISLNETVQCVHPPNVSCLWTHYNDNPNNRNFIDYTFSKNDTCVFEAYKWLLFKRKLSDKVNCNFFASYQEMDISINVEVILIQ 122          
BLAST of Fibroblast growth factor receptor vs. Planmine SMEST
Match: SMESG000051694.1 (SMESG000051694.1)

HSP 1 Score: 1036.17 bits (2678), Expect = 0.000e+0
Identity = 507/519 (97.69%), Postives = 510/519 (98.27%), Query Frame = 1
Query:  817 INIILHLSLVEKFNHRQNLMKNFQFFLFESQVYNGKFLKYVSFGNDTDTSQIKITNKYILKIYCVAEKCHYHVNIFPSMTNDSQIGISHRTPRNITILNKIKFTPKKTKSTNHSKTVIFNGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKELKKSSRYYDDQTEISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKYF 2373
            IN+ + L  +EKFNHRQNLMKNFQF LFE QVYNGKFLKYVSFGNDTDTSQIKITNKYILKIYCVAEKCHYHVNIFPSMTNDSQIGISH TPRNITILNKIKFTPKKTKSTNHSKTVIFNGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKELKKSSRYYDDQTEISLLSTK INKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFK IVEKYF
Sbjct:  123 INVEVILIQLEKFNHRQNLMKNFQFILFEIQVYNGKFLKYVSFGNDTDTSQIKITNKYILKIYCVAEKCHYHVNIFPSMTNDSQIGISHSTPRNITILNKIKFTPKKTKSTNHSKTVIFNGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKELKKSSRYYDDQTEISLLSTKTINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKVIVEKYF 641          

HSP 2 Score: 273.092 bits (697), Expect = 5.122e-81
Identity = 130/131 (99.24%), Postives = 130/131 (99.24%), Query Frame = 1
Query:   37 MVNYLIKYKMLYSIYSLYLNSVISLCGICPILSKSGFISNSFWNNAIFISLNETVQCVHPPNVSCLWTHYNDNPNNRNFIDYTFSKNDTCVFEAYKWLLFKRKLSDKVNCNFFASYQEMDISINVEVILIQ 429
            MVNY IKYKMLYSIYSLYLNSVISLCGICPILSKSGFISNSFWNNAIFISLNETVQCVHPPNVSCLWTHYNDNPNNRNFIDYTFSKNDTCVFEAYKWLLFKRKLSDKVNCNFFASYQEMDISINVEVILIQ
Sbjct:    1 MVNYFIKYKMLYSIYSLYLNSVISLCGICPILSKSGFISNSFWNNAIFISLNETVQCVHPPNVSCLWTHYNDNPNNRNFIDYTFSKNDTCVFEAYKWLLFKRKLSDKVNCNFFASYQEMDISINVEVILIQ 131          
BLAST of Fibroblast growth factor receptor vs. Planmine SMEST
Match: SMESG000051694.1 (SMESG000051694.1)

HSP 1 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 463/468 (98.93%), Postives = 465/468 (99.36%), Query Frame = 1
Query:  970 IKITNKYILKIYCVAEKCHYHVNIFPSMTNDSQIGISHRTPRNITILNKIKFTPKKTKSTNHSKTVIFNGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKELKKSSRYYDDQTEISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKYF 2373
            I++TNKYILKIYCVAEKCHYHVNIFPSMTNDSQIGISH TPRNITILNKIKFTPKKTKSTNHSKTVIFNGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKELKKSSRYYDDQTEISLLSTK INKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFK IVEKYF
Sbjct:  121 IQLTNKYILKIYCVAEKCHYHVNIFPSMTNDSQIGISHSTPRNITILNKIKFTPKKTKSTNHSKTVIFNGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKELKKSSRYYDDQTEISLLSTKTINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKVIVEKYF 588          

HSP 2 Score: 257.684 bits (657), Expect = 8.318e-76
Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = 1
Query:   64 MLYSIYSLYLNSVISLCGICPILSKSGFISNSFWNNAIFISLNETVQCVHPPNVSCLWTHYNDNPNNRNFIDYTFSKNDTCVFEAYKWLLFKRKLSDKVNCNFFASYQEMDISINVEVILIQ 429
            MLYSIYSLYLNSVISLCGICPILSKSGFISNSFWNNAIFISLNETVQCVHPPNVSCLWTHYNDNPNNRNFIDYTFSKNDTCVFEAYKWLLFKRKLSDKVNCNFFASYQEMDISINVEVILIQ
Sbjct:    1 MLYSIYSLYLNSVISLCGICPILSKSGFISNSFWNNAIFISLNETVQCVHPPNVSCLWTHYNDNPNNRNFIDYTFSKNDTCVFEAYKWLLFKRKLSDKVNCNFFASYQEMDISINVEVILIQ 122          
BLAST of Fibroblast growth factor receptor vs. Planmine SMEST
Match: SMESG000051694.1 (SMESG000051694.1)

HSP 1 Score: 926.391 bits (2393), Expect = 0.000e+0
Identity = 449/460 (97.61%), Postives = 454/460 (98.70%), Query Frame = 1
Query:  994 LKIYCVAEKCHYHVNIFPSMTNDSQIGISHRTPRNITILNKIKFTPKKTKSTNHSKTVIFNGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKELKKSSRYYDDQTEISLLSTKAINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVEKYF 2373
            +++  + +KCHYHVNIFPSMTNDSQIGISH TPRNITILNKIKFTPKKTKSTNHSKTVIFNGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKELKKSSRYYDDQTEISLLSTK INKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFK IVEKYF
Sbjct:  116 VEVILIQQKCHYHVNIFPSMTNDSQIGISHSTPRNITILNKIKFTPKKTKSTNHSKTVIFNGTFTIQITLGIVISFIVLLTLWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQSINSKELKKSSRYYDDQTEISLLSTKTINKVPNYSKLSFSTTSSFENIHDFMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKVIVEKYF 575          

HSP 2 Score: 263.848 bits (673), Expect = 3.097e-78
Identity = 127/133 (95.49%), Postives = 129/133 (96.99%), Query Frame = 1
Query:   64 MLYSIYSLYLNSVISLCGICPILSKSGFISNSFWNNAIFISLNETVQCVHPPNVSCLWTHYNDNPNNRNFIDYTFSKNDTCVFEAYKWLLFKRKLSDKVNCNFFASYQEMDISINVEVILIQQKVN---NIYP 453
            MLYSIYSLYLNSVISLCGICPILSKSGFISNSFWNNAIFISLNETVQCVHPPNVSCLWTHYNDNPNNRNFIDYTFSKNDTCVFEAYKWLLFKRKLSDKVNCNFFASYQEMDISINVEVILIQQK +   NI+P
Sbjct:    1 MLYSIYSLYLNSVISLCGICPILSKSGFISNSFWNNAIFISLNETVQCVHPPNVSCLWTHYNDNPNNRNFIDYTFSKNDTCVFEAYKWLLFKRKLSDKVNCNFFASYQEMDISINVEVILIQQKCHYHVNIFP 133          
BLAST of Fibroblast growth factor receptor vs. Planmine SMEST
Match: SMESG000054557.1 (SMESG000054557.1)

HSP 1 Score: 206.068 bits (523), Expect = 1.432e-55
Identity = 113/272 (41.54%), Postives = 169/272 (62.13%), Query Frame = 1
Query: 1573 SKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMNNSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEYCSNGSLKCFL----DKLRDQNK----IACGIFLKFSRQIALGMAYLTSKNIIHRDLAARNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKKYSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCPGNIRELIQGCWAFEARDRPTFKDIVE 2364
            +K +G GAFG V+ G  +  D+ K  T  KVAVK + +   DF +S    +  KEM +MK+IG H N++ L+G C  +N    +I+E    G+L+ F+    +K   Q K    +   I   +S QIA GM YL S++++HRDL+ARN+L+ E Y  KI+DFG++R   V+  Y +   GI+P+KW+APE L++KKY++++DVWSYGILLWEI+ LG  PY +    +V+D+I+ G++ P P+     I  L+Q CW     +RP F +IVE
Sbjct:  546 NKKLGEGAFGMVYEGLTN--DIAKKPTFTKVAVKMMRD---DFSDSNVH-DFVKEMEIMKHIGRHPNVIQLLGLCT-QNGPLRVIVELAPYGNLRDFVRSKNNKYSKQKKNIENLTASILSTYSFQIANGMTYLASRSVVHRDLSARNILVGEHYEMKIADFGLTR--IVDYYYRKKTDGILPVKWMAPEALLEKKYTTKSDVWSYGILLWEIFTLGDAPYSSILPEKVVDVIKKGFQNPQPELANFEIYSLMQHCWNISTENRPHFFEIVE 808          
The following BLAST results are available for this feature:
BLAST of Fibroblast growth factor receptor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FGFR11.512e-5636.33fibroblast growth factor receptor 1 [Source:HGNC S... [more]
FGFR11.894e-5636.33fibroblast growth factor receptor 1 [Source:HGNC S... [more]
FGFR12.080e-5636.33fibroblast growth factor receptor 1 [Source:HGNC S... [more]
FGFR13.725e-5630.87fibroblast growth factor receptor 1 [Source:HGNC S... [more]
FGFR13.887e-5630.87fibroblast growth factor receptor 1 [Source:HGNC S... [more]
back to top
BLAST of Fibroblast growth factor receptor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
R151.11.282e-5739.05pep chromosome:WBcel235:III:7218813:7221186:1 gene... [more]
R151.16.717e-5639.05pep chromosome:WBcel235:III:7217839:7221186:1 gene... [more]
R151.12.413e-5539.05pep chromosome:WBcel235:III:7216526:7221186:1 gene... [more]
csk-11.391e-4835.64Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
csk-11.391e-4835.64Tyrosine-protein kinase csk-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Fibroblast growth factor receptor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
btl3.752e-5538.64gene:FBgn0285896 transcript:FBtr0100676[more]
btl3.752e-5538.64gene:FBgn0285896 transcript:FBtr0075778[more]
htl5.813e-5538.29gene:FBgn0010389 transcript:FBtr0083550[more]
htl5.813e-5538.29gene:FBgn0010389 transcript:FBtr0083549[more]
htl5.813e-5538.29gene:FBgn0010389 transcript:FBtr0083548[more]
back to top
BLAST of Fibroblast growth factor receptor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfr31.519e-5935.09fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr1b1.900e-5636.21fibroblast growth factor receptor 1b [Source:ZFIN;... [more]
fgfr33.335e-5635.09fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr34.343e-5635.09fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr1b6.152e-5537.77fibroblast growth factor receptor 1b [Source:ZFIN;... [more]
back to top
BLAST of Fibroblast growth factor receptor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tirap2.692e-5637.42toll-interleukin 1 receptor (TIR) domain containin... [more]
tirap3.054e-5637.42toll-interleukin 1 receptor (TIR) domain containin... [more]
tirap3.438e-5637.42toll-interleukin 1 receptor (TIR) domain containin... [more]
tirap1.324e-5537.42toll-interleukin 1 receptor (TIR) domain containin... [more]
tirap1.611e-5537.42toll-interleukin 1 receptor (TIR) domain containin... [more]
back to top
BLAST of Fibroblast growth factor receptor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fgfr31.425e-5732.68fibroblast growth factor receptor 3 [Source:MGI Sy... [more]
Fgfr11.048e-5636.33fibroblast growth factor receptor 1 [Source:MGI Sy... [more]
Fgfr11.048e-5636.33fibroblast growth factor receptor 1 [Source:MGI Sy... [more]
Fgfr11.387e-5636.33fibroblast growth factor receptor 1 [Source:MGI Sy... [more]
Fgfr32.277e-5632.68fibroblast growth factor receptor 3 [Source:MGI Sy... [more]
back to top
BLAST of Fibroblast growth factor receptor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P18460|FGFR3_CHICK2.359e-5633.05Fibroblast growth factor receptor 3 OS=Gallus gall... [more]
sp|P11362|FGFR1_HUMAN2.873e-5536.33Fibroblast growth factor receptor 1 OS=Homo sapien... [more]
sp|P16092|FGFR1_MOUSE3.071e-5536.33Fibroblast growth factor receptor 1 OS=Mus musculu... [more]
sp|P21804|FGFR1_CHICK6.511e-5536.33Fibroblast growth factor receptor 1 OS=Gallus gall... [more]
sp|Q498D6|FGFR4_RAT7.134e-5537.77Fibroblast growth factor receptor 4 OS=Rattus norv... [more]
back to top
BLAST of Fibroblast growth factor receptor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A7RN881.491e-6140.77Predicted protein (Fragment) OS=Nematostella vecte... [more]
A0A2R7X2V58.781e-5837.17Breathless OS=Oncopeltus fasciatus OX=7536 GN=btl ... [more]
A0A3Q3ED851.742e-5736.54Protein kinase domain-containing protein OS=Labrus... [more]
V4B5T12.272e-5738.97Protein kinase domain-containing protein OS=Lottia... [more]
A0A1B6ML943.038e-5735.47Protein kinase domain-containing protein (Fragment... [more]
back to top
BLAST of Fibroblast growth factor receptor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfr1a4.580e-5636.21fibroblast growth factor receptor 1a [Source:NCBI ... [more]
fgfr34.932e-5634.78fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr35.377e-5634.78fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr33.276e-5431.22fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr22.478e-5235.36fibroblast growth factor receptor 2 [Source:NCBI g... [more]
back to top
BLAST of Fibroblast growth factor receptor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgfr21.195e-5835.31fibroblast growth factor receptor 2 [Source:NCBI g... [more]
fer5.628e-5339.63fer (fps/fes related) tyrosine kinase [Source:ZFIN... [more]
fgfr24.134e-5034.88fibroblast growth factor receptor 2 [Source:NCBI g... [more]
NTRK21.805e-4934.84neurotrophic receptor tyrosine kinase 2 [Source:HG... [more]
ENSPMAT00000004129.14.238e-4934.70pep scaffold:Pmarinus_7.0:GL490249:304:4500:1 gene... [more]
back to top
BLAST of Fibroblast growth factor receptor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
BCK16.877e-2630.18MAPKKK acting in the protein kinase C signaling pa... [more]
STE111.508e-2527.57Signal transducing MEK kinase; involved in pheromo... [more]
CDC152.691e-2528.57Protein kinase of the Mitotic Exit Network; locali... [more]
CLA41.082e-2224.19Cdc42p-activated signal transducing kinase; member... [more]
ATG13.320e-2228.01Protein serine/threonine kinase; required for vesi... [more]
back to top
BLAST of Fibroblast growth factor receptor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470942.062e-6540.77Predicted protein; Vascular endothelial growth fac... [more]
EDO491266.882e-5836.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO378861.628e-5736.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470977.426e-5737.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432362.371e-5635.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fibroblast growth factor receptor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000000391.21.759e-5535.90fibroblast growth factor receptor 1-A [Source:NCBI... [more]
ENSORLT00000040527.12.243e-5535.90fibroblast growth factor receptor 1-A [Source:NCBI... [more]
fgfr14.463e-5535.88fibroblast growth factor receptor 1 [Source:NCBI g... [more]
fgfr37.811e-5432.09fibroblast growth factor receptor 3 [Source:NCBI g... [more]
fgfr39.348e-5432.09fibroblast growth factor receptor 3 [Source:NCBI g... [more]
back to top
BLAST of Fibroblast growth factor receptor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051694.11.582e-7597.69SMESG000051694.1[more]
SMESG000051694.15.122e-8197.69SMESG000051694.1[more]
SMESG000051694.18.318e-7698.93SMESG000051694.1[more]
SMESG000051694.13.097e-7897.61SMESG000051694.1[more]
SMESG000054557.11.432e-5541.54SMESG000054557.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031557 ID=SMED30031557|Name=Fibroblast growth factor receptor|organism=Schmidtea mediterranea sexual|type=transcript|length=2419bp
AAATATTCAAATTTTTAGAATCTTAGTTGTTTAAATATGGTGAATTATTT
GATTAAATATAAAATGCTTTACTCGATTTATAGTTTATACCTTAATTCCG
TCATTTCTTTGTGTGGTATTTGTCCAATACTATCCAAAAGTGGATTTATT
TCTAATTCATTTTGGAATAACGCCATTTTTATCAGCTTAAATGAAACAGT
CCAATGTGTCCATCCACCGAATGTATCATGTTTATGGACACATTATAATG
ATAATCCTAACAATAGAAATTTTATAGATTATACATTTTCAAAAAATGAC
ACGTGTGTATTCGAAGCTTATAAATGGCTTTTATTTAAAAGAAAACTATC
AGATAAAGTTAATTGTAATTTTTTTGCAAGTTATCAAGAGATGGATATAA
GTATTAATGTTGAAGTCATTCTAATTCAACAAAAAGTAAACAACATATAT
CCGCAGTGCATTATTTCTAAATCTATTTTATTCAATGATGTGAAATATCT
TGATTCAAATTCCATGAATCCCAAAATCTGTTATCGAAACTTGGAGCTTA
TCGACTTGAAACCTAAGTTTAATCTCACAAATGTTTTCATTTATAATGTT
CGATCTTTTGACAACTTTTTTATTTTCCTGTCGAAATTCAGTGACGATGA
AAACGTAATTATTTATTGGGACAACGATTTATTAACAACAACTAAATATA
TAATTCAAAGTCGATATTATTGGTTATTGGTCGATGTTGATAAATTGTTC
ATTGATCATGTTAGTATTGGTGTTATTAATGCTGTTTATTTCCAGCACGG
AACTCATAAGAAATTCATCAATATTATTTTACATTTATCATTGGTCGAAA
AATTCAATCATAGACAAAATTTGATGAAAAATTTCCAATTTTTTTTATTT
GAAAGTCAAGTTTACAATGGAAAATTTCTAAAATATGTTTCGTTTGGAAA
TGATACCGATACAAGCCAAATAAAAATAACAAATAAATATATTTTGAAGA
TTTATTGCGTTGCAGAGAAATGCCATTATCATGTTAATATTTTCCCTTCA
ATGACAAACGATTCTCAGATCGGTATAAGCCACAGAACCCCACGTAATAT
TACCATATTGAATAAGATCAAATTTACTCCTAAAAAGACAAAATCAACTA
ATCACTCTAAAACCGTCATTTTTAACGGGACATTTACCATTCAAATCACT
TTGGGAATAGTTATCAGCTTTATTGTTCTATTAACTTTATGGACAATCGT
AATGAAAACATCCAAGAAGAAGATTTTTCATTGTTTGAGAAAATGGAGTT
CGTCAAATCACAGAAGTTCTATTTTCTGGATGTCAAATGAAAAATATGGG
CTCAATAAAAAAGAACTATCATTTTGCAATATACAATCTATCAATTCTAA
AGAGTTAAAGAAATCTTCTAGATATTATGATGACCAAACTGAAATTAGTC
TCTTATCTACGAAAGCAATTAATAAAGTCCCAAATTATTCCAAACTTAGT
TTTTCCACCACTTCCAGTTTTGAAAATATTCATGATTTTATGGGAAACCT
GGCTGAAAAGGATGTTAATATTTCGAAATGTATTGGAAATGGAGCTTTTG
GTAAAGTTTTTCTTGGCGAAATGGACTATGTTGATGTCAATAAGATGAAT
ACGAAATATAAAGTTGCTGTGAAAGAAATAATGAATAATTCATTGGATTT
CATGGAATCCGAAGGAGAAACAAACTTGTACAAAGAAATGTCTCTAATGA
AGAACATTGGATATCATGCTAACATTGTGAGTTTGATTGGCTATTGCAAA
AGAAAAAATCAAACTGATTGGTTGATCATGGAATATTGTTCAAACGGAAG
TTTAAAATGCTTTCTCGATAAATTACGTGATCAGAATAAAATAGCGTGTG
GAATATTTCTAAAGTTTTCACGTCAGATCGCTCTTGGAATGGCGTATTTA
ACTTCGAAAAATATTATACACCGCGATTTGGCAGCTCGCAATGTCTTGCT
ATCGGAGAAATATGTTTGCAAAATCAGTGATTTCGGCATGTCACGACAAT
TGTCTGTCAATGAAACGTATTATGAACACGTCCATGGAATAGTTCCATTA
AAATGGATAGCTCCTGAAGTTTTGATTCAAAAGAAATATTCCAGTCAAGC
TGATGTTTGGTCATATGGAATTTTGTTGTGGGAAATTTATGCTCTTGGCA
CCAATCCCTATGAGAATTTCTCTATGATTCAAGTAATAGATTTGATACGT
AACGGTTATCGAATGCCAATTCCTGACAGTTGTCCAGGAAATATAAGGGA
ATTAATCCAAGGTTGCTGGGCATTTGAAGCTAGAGACAGGCCTACTTTTA
AAGATATCGTTGAGAAATATTTTTAATTTAAAATAAATAATTTTGTTGTT
GAAAAAAAAAGATCGGAAG
back to top

protein sequence of SMED30031557-orf-1

>SMED30031557-orf-1 ID=SMED30031557-orf-1|Name=SMED30031557-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=780bp
MVNYLIKYKMLYSIYSLYLNSVISLCGICPILSKSGFISNSFWNNAIFIS
LNETVQCVHPPNVSCLWTHYNDNPNNRNFIDYTFSKNDTCVFEAYKWLLF
KRKLSDKVNCNFFASYQEMDISINVEVILIQQKVNNIYPQCIISKSILFN
DVKYLDSNSMNPKICYRNLELIDLKPKFNLTNVFIYNVRSFDNFFIFLSK
FSDDENVIIYWDNDLLTTTKYIIQSRYYWLLVDVDKLFIDHVSIGVINAV
YFQHGTHKKFINIILHLSLVEKFNHRQNLMKNFQFFLFESQVYNGKFLKY
VSFGNDTDTSQIKITNKYILKIYCVAEKCHYHVNIFPSMTNDSQIGISHR
TPRNITILNKIKFTPKKTKSTNHSKTVIFNGTFTIQITLGIVISFIVLLT
LWTIVMKTSKKKIFHCLRKWSSSNHRSSIFWMSNEKYGLNKKELSFCNIQ
SINSKELKKSSRYYDDQTEISLLSTKAINKVPNYSKLSFSTTSSFENIHD
FMGNLAEKDVNISKCIGNGAFGKVFLGEMDYVDVNKMNTKYKVAVKEIMN
NSLDFMESEGETNLYKEMSLMKNIGYHANIVSLIGYCKRKNQTDWLIMEY
CSNGSLKCFLDKLRDQNKIACGIFLKFSRQIALGMAYLTSKNIIHRDLAA
RNVLLSEKYVCKISDFGMSRQLSVNETYYEHVHGIVPLKWIAPEVLIQKK
YSSQADVWSYGILLWEIYALGTNPYENFSMIQVIDLIRNGYRMPIPDSCP
GNIRELIQGCWAFEARDRPTFKDIVEKYF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008284positive regulation of cell proliferation
GO:0006468protein phosphorylation
GO:0000187activation of MAPK activity
GO:0001763morphogenesis of a branching structure
GO:0007275multicellular organism development
GO:0007298border follicle cell migration
GO:0007424open tracheal system development
GO:0007426tracheal outgrowth, open tracheal system
GO:0007427epithelial cell migration, open tracheal system
GO:0007428primary branching, open tracheal system
GO:0007429secondary branching, open tracheal system
GO:0007430terminal branching, open tracheal system
GO:0007435salivary gland morphogenesis
GO:0008347glial cell migration
GO:0008543fibroblast growth factor receptor signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
GO:0030517negative regulation of axon extension
GO:0035153epithelial cell type specification, open tracheal system
GO:0035215genital disc development
GO:0040018positive regulation of multicellular organism growth
GO:0046847filopodium assembly
GO:0060438trachea development
GO:0060439trachea morphogenesis
GO:0060446branching involved in open tracheal system development
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR020635Tyr_kinase_cat_dom
IPR017441Protein_kinase_ATP_BS
IPR008266Tyr_kinase_AS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0005007fibroblast growth factor-activated receptor activity
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 749..771
score: 37.29
coord: 637..655
score: 62.52
coord: 686..696
score: 53.33
coord: 598..611
score: 44.23
coord: 705..727
score: 53.73
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 511..777
e-value: 2.2E-85
score: 286.1
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 510..778
e-value: 3.8E-106
score: 368.6
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 463..601
e-value: 1.9E-21
score: 78.2
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 602..778
e-value: 8.8E-54
score: 183.8
NoneNo IPR availablePANTHERPTHR24418TYROSINE-PROTEIN KINASEcoord: 458..776
NoneNo IPR availablePANTHERPTHR24418:SF162TYROSINE-PROTEIN KINASE ABLcoord: 458..776
NoneNo IPR availableCDDcd00192PTKccoord: 514..777
e-value: 3.50232E-105
score: 321.41
NoneNo IPR availableTMHMMTMhelixcoord: 383..405
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 516..546
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 643..655
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 510..779
score: 40.612
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 483..777