50S ribosomal protein L1

Overview
Name50S ribosomal protein L1
Smed IDSMED30031548
Length (bp)1165
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 50S ribosomal protein L1 (SMED30031548) t-SNE clustered cells

Violin plots show distribution of expression levels for 50S ribosomal protein L1 (SMED30031548) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 50S ribosomal protein L1 (SMED30031548) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 50S ribosomal protein L1 (SMED30031548) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031548

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031548h1SMcG0020796 SmedASXL_012258SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 50S ribosomal protein L1 vs. Ensembl Celegans
Match: mrpl-1 (Mitochondrial Ribosomal Protein, Large [Source:UniProtKB/TrEMBL;Acc:Q7KPW7])

HSP 1 Score: 68.9366 bits (167), Expect = 1.363e-12
Identity = 62/237 (26.16%), Postives = 118/237 (49.79%), Query Frame = 1
Query:  280 NVYMEKEFEKIKYSFEDATQFHQEYLLDKALYDSPNSVLKVNYLLNMXXXXXXXXXXXXXGIETPAHPFTFLTKPKILAFCTTQEDIDCAISXXXXXXXXXXXXXXXXQGHLFYEEFDQVVCHTEAXXXXXXXXXXXXXXXPTKQNSRIGPDIKSLVETYINGYEFESKKLEGIPEEAILSIPIGEISWPMEKLKENFLVFMRKIVLESSPQIAGSPISKISLICPPSDEIFFLDFQ 990
            +V+++  F+   Y+  +A   H+E L   ++Y++PN+ +++   LNM T++ TK V     I    HPF    K  ILAF    +  + A+  GA  A  +   KK+ +G    +++D  V H++  S +  L+ +LK + PT+ N  +G ++  L+E + NG +   K     P   +    +G +S P E ++ N    +       +P + GS +++  L+  P +E + +D +
Sbjct:  100 DVFIKSHFKTQYYTVSEALDMHRE-LQSPSIYNNPNAPIRLRLELNMTTERQTKMVTGSDEIVPVPHPFNHNEKRTILAFANDVKLQELAVESGAEMALGQDTIKKIIKGQFRTDDYDFCVSHSDMGSSILPLRGILKMRFPTRANGGLGENLPELIEKFKNGVKLNIKGDPVYPIWGLSDCVVGRLSMPNEHIEANIATVIAAACAHRNPAL-GSFVNRALLMTIPGEENYAIDVK 334          
BLAST of 50S ribosomal protein L1 vs. TrEMBL
Match: G4VLH1 (Putative 50s ribosomal protein L1 OS=Schistosoma mansoni OX=6183 GN=Smp_001960 PE=4 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 2.382e-32
Identity = 99/302 (32.78%), Postives = 168/302 (55.63%), Query Frame = 1
Query:   97 RNISTS-QIYKKVQQTNRFKRMTVTNKSSSNK--MLDLKGEKNRTAWLKSIEEEETVKGKIANSNVYMEKEFEKIKYSFEDATQFHQEYLLDKALYDSPNSVLKVNYLLNMXXXXXXXXXXXXXGIETPAHPFTFLTKPKILAFCTTQEDIDCAISXXXXXXXXXXXXXXXXQGHLFYEEFDQVVCHTEAXXXXXXXXXXXXXXXPTKQNSRIGPDIKSLVETYINGYEFESKKLEGIPEEAILSIPIGEISWPMEKLKENFLVFMRKIVLESSPQIAGSPISKISLICPPSDEIFFLDFQE 993
            RN+STS Q+++  QQ  R  ++TV  KS S +    +L  + NRT W + +     +KG+I  S+ Y+  EFE  KYS  +A +  +E      +YD  ++ ++V   LNM TKK T+F+ KF G     +   F+   ++LA C   +D +  I+ GA +AG  +L +++ QGH  + E+D VV H      ++KL+ +L+++LPT +N R+G D+  L+  +    + ES  ++G+PE  +L I +G++SW   +L+EN   ++  I  + S ++    I    + CPP+ E F LD  +
Sbjct:   24 RNLSTSSQLFRNQQQRYREAKVTVNEKSKSRRDAARELLMKTNRTKWEQEMARLNILKGRIPTSDTYLMSEFEPKKYSLSEAVELLRESA-HPDMYDCMDNPVRVKVTLNMCTKKKTRFIPKFNGNLVLPNLLDFMPAHRVLAICQDSDDHEAYITAGAYDAGGSSLIQRISQGHYHWNEYDTVVAHQSWEIQVTKLRHILRERLPTIKNGRLGDDVMKLISIHSRSTQLESTSIDGVPEIGLLDIILGQLSWDFNRLEENLRSYLECIESQKSSRVINDFIQTGEIHCPPTGERFILDISQ 324          
BLAST of 50S ribosomal protein L1 vs. TrEMBL
Match: A0A4E0RPC2 (50S ribosomal protein L1 OS=Fasciola hepatica OX=6192 GN=D915_000295 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 2.403e-32
Identity = 98/272 (36.03%), Postives = 153/272 (56.25%), Query Frame = 1
Query:  169 NKSSSNKMLDLKGEKNRTAWLKSIEEEETVKGKIANSNVYMEKEFEKIKYSFEDATQFHQEYLLDKALYDSPNSVLKVNYLLNMXXXXXXXXXXXXXGIETPAHPFTFLTKPKILAFCTTQEDIDCAISXXXXXXXXXXXXXXXXQGHLFYEEFDQVVCHTEAXXXXXXXXXXXXXXXPTKQNSRIGPDIKSLVETYINGYEFESKKLEGIPEEAILSIPIGEISWPMEKLKENFLVFMRKIVLESSPQIAGSPISKISLICPPSDEIFFLD 984
            +K+  +   ++    NR  W ++      + GK  ++NVY+   F++    F +A  F         +YD   + L+  ++LNM+TKK TKF+ KF+      H  +FL KP++LA C   +D   A+  GA +AG E L  +LE G   +EE+D VV H++ S+ +SKL+ VLK++LPT +N RIG D+ +LV TY+NG   ES +LEG+PE   L + +G++ W    L +N L +   I  + S ++ G  I  + L CPP+ E F LD
Sbjct:   52 SKARKDSAREILATANRIKWEQNNARRAELSGKKPSTNVYLASNFDQSGLKFSEAL-FALREASQPDMYDCMENPLRAKFVLNMQTKKKTKFIPKFEAHVVLPHQLSFLPKPRVLALCKNSDDAQMALDQGATDAGGEELFARLEHGAFHWEEYDFVVAHSDWSNTISKLRHVLKERLPTLKNGRIGEDVTTLVSTYVNGVSLESSQLEGVPEINHLDVIVGQLCWEDNALSDNMLCYFDTIESQKSSRVVGDAIESVHLSCPPTGEQFLLD 322          
BLAST of 50S ribosomal protein L1 vs. TrEMBL
Match: A0A183MFL1 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS14836 PE=4 SV=1)

HSP 1 Score: 133.265 bits (334), Expect = 1.176e-31
Identity = 104/302 (34.44%), Postives = 170/302 (56.29%), Query Frame = 1
Query:   97 RNISTS-QIYKKVQQTNRFKRMTVTNKSSSNK--MLDLKGEKNRTAWLKSIEEEETVKGKIANSNVYMEKEFEKIKYSFEDATQFHQEYLLDKALYDSPNSVLKVNYLLNMXXXXXXXXXXXXXGIETPAHPFTFLTKPKILAFCTTQEDIDCAISXXXXXXXXXXXXXXXXQGHLFYEEFDQVVCHTEAXXXXXXXXXXXXXXXPTKQNSRIGPDIKSLVETYINGYEFESKKLEGIPEEAILSIPIGEISWPMEKLKENFLVFMRKIVLESSPQIAGSPISKISLICPPSDEIFFLDFQE 993
            RN+STS Q++K  QQ  R  ++TV  KS S +    +L  + NRT W + +     +KG+I  S+ Y+  EFE  KYS  +A +  +E      +YD  ++ ++V   LNM TKK T+F+ KF+      +   F+   ++LA C   +D +  ++ GA +AG  AL +++ QGH  + E+D VV H    S ++KL+ +LKD+LPT +N R+G D+  L+  + N  + ES  ++G+PE  +L I +G++SW   +L+EN   ++  I  + S +I    I    + CPP+ E F LD  +
Sbjct:   24 RNLSTSSQLFKHQQQRYREAKVTVNEKSKSRRDAARELLMKTNRTKWEQEMARLNILKGRIPTSDTYLISEFEPKKYSLSEAVELLRESA-QPDMYDCMDNPVRVKVTLNMCTKKKTRFIPKFESNLVLPNVLDFMPVRRVLAICQNSDDREAYLTAGAYDAGGSALIQRVSQGHYHWGEYDTVVAHQSWESQVTKLRHILKDRLPTIKNGRLGEDVMKLMSIHSNSIQLESTSIDGVPEIGLLDIILGQLSWDFNRLEENLRSYLECIESQKSSRIINEFIQSGEIHCPPTGERFILDISQ 324          
BLAST of 50S ribosomal protein L1 vs. TrEMBL
Match: A0A095BWE1 (50S ribosomal protein L1 OS=Schistosoma haematobium OX=6185 GN=MS3_01508 PE=4 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 7.337e-31
Identity = 105/315 (33.33%), Postives = 174/315 (55.24%), Query Frame = 1
Query:   97 RNISTS-QIYKKVQQTNRFKRMTVTNKSSSNK--MLDLKGEKNRTAWLKSIEEEETVKGKIANSNVYMEKEFEKIKYSFEDATQFHQEYLLDKALYDSPNSVLKVNYLLNMXXXXXXXXXXXXXGIETPAHPFTFLTKPKILAFCTTQEDIDCAISXXXXXXXXXXXXXXXXQGHLFYEEFDQVVCHTEAXXXXXXXXXXXXXXXPTKQNSRIGPDIKSLVETYINGYEFESKKLEGIPEEAILSIPIGEISWPMEKLKENFLVFMRKIVLESSPQIAGSPISKISLICPPSDEIFFLDFQEDFERFAKMRQKSK 1032
            RN+STS Q++K  QQ  R  ++TV  KS S +    +L  + NRT W + + +   +KG+I  S+ Y+  EFE  KYS  +A +  +E      +YD  ++ ++V   LNM TKK T+F+ KF+      +   F+   ++L  C   +D +  ++ GA +AG  AL +++ QGH  + E+D VV H    S ++KL+ +LK++LPT +N R G D+  L+  + N  + ES  ++G+PE  +L I +G++SW   +L+EN   ++  I  + S +I    I    + CPP+ E F LD  +    +  +  KSK
Sbjct:   24 RNLSTSSQLFKHQQQRYREAKVTVNEKSKSRRDAARELLMKTNRTKWEQEMAQLNILKGRIPTSDTYLISEFEPKKYSLSEAVELLRESA-QPDMYDCMDNPVRVKVTLNMCTKKKTRFIPKFESNLVLPNILDFMPARRVLVICQNSDDREAYLTAGAYDAGGSALIQRISQGHYHWGEYDTVVAHQSWESQVTKLRHILKERLPTIKNGRFGEDMMKLMSIHSNSIQLESTSIDGVPEIGLLDIILGQLSWDFNRLEENLRSYLECIESQKSSRIINEFIQSGEIHCPPTGERFILDISQ----YCSLGNKSK 333          
BLAST of 50S ribosomal protein L1 vs. TrEMBL
Match: A0A074Z186 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_10805 PE=4 SV=1)

HSP 1 Score: 129.028 bits (323), Expect = 2.814e-30
Identity = 103/305 (33.77%), Postives = 166/305 (54.43%), Query Frame = 1
Query:   97 RNISTSQIYKKVQQTNRFKRMTVT--------NKSSSNKMLDLKGEKNRTAWLKSIEEEETVKGKIANSNVYMEKEFEKIKYSFEDATQFHQEYLLDKALYDSPNSVLKVNYLLNMXXXXXXXXXXXXXGIETPAHPFTFLTKPKILAFCTTQEDIDCAISXXXXXXXXXXXXXXXXQGHLFYEEFDQVVCHTEAXXXXXXXXXXXXXXXPTKQNSRIGPDIKSLVETYINGYEFESKKLEGIPEEAILSIPIGEISWPMEKLKENFLVFMRKIVLESSPQIAGSPISKISLICPPSDEIFFLDF 987
            R+++TS   + ++   R  R+T +        +K   +    L    NRT W  +  +   + GK+  +NVY+   FE+ ++   +A +  +E      ++D   + L+  + LNM+TKK TKF+QKF+G     +   FL K +++A C   ED   A+  GA+ AG   L  +LE G L +EE+D VV HT+    L KL+ VLKD+LPT +N RIG D+ +LV T+  G   ES  LEG+PE A L + IG+++W + +L+ N   +   I    S +++G+ +  + L CPP+ E F +D 
Sbjct:   18 RSLTTSS--RCLKGNTRKPRLTASGMGVISEKSKEKRDSARQLLATTNRTKWEDTNRKLAALTGKLPTTNVYLSANFEQRRFLLAEAAECLREAA-QPEMFDCLQNPLRAKFTLNMRTKKKTKFLQKFEGHVVLPNSLDFLPKSRVIALCNDAEDAALAVEAGAVHAGGTELFTRLENGSLHWEEYDTVVAHTDWEPTLKKLRHVLKDRLPTMRNGRIGSDVFTLVTTHSVGISVESTALEGVPEIAFLDVIIGQLAWDVTRLETNMQAYFDTIQSNKSSRVSGNAVLSVELYCPPTGERFPIDL 319          
BLAST of 50S ribosomal protein L1 vs. Planmine SMEST
Match: SMESG000017111.1 (SMESG000017111.1)

HSP 1 Score: 577.4 bits (1487), Expect = 0.000e+0
Identity = 330/331 (99.70%), Postives = 331/331 (100.00%), Query Frame = 1
Query:   58 MVLKCFFFGTLLRRNISTSQIYKKVQQTNRFKRMTVTNKSSSNKMLDLKGEKNRTAWLKSIEEEETVKGKIANSNVYMEKEFEKIKYSFEDATQFHQEYLLDKALYDSPNSVLKVNYLLNMXXXXXXXXXXXXXGIETPAHPFTFLTKPKILAFCTTQEDIDCAISXXXXXXXXXXXXXXXXQGHLFYEEFDQVVCHTEAXXXXXXXXXXXXXXXPTKQNSRIGPDIKSLVETYINGYEFESKKLEGIPEEAILSIPIGEISWPMEKLKENFLVFMRKIVLESSPQIAGSPISKISLICPPSDEIFFLDFQEDFERFAKMRQKSKLREEEE 1050
            MVLKCFFFGTLLRRNISTSQIYKKVQQTNRFKRMTVTNKSSSNKMLDLKGEKNRTAWLKSIEEEETVKGKIANSNVYMEKEFEKIKYSFEDATQFHQEYLLDKALYDSPNSVLKVNYLLNMKTKKVTKFVQKFQGIETPAHPFTFLTKPKILAFCTTQEDIDCAISLGALEAGDEALAKKLEQGHLFYEEFDQVVCHTEASSLLSKLKSVLKDKLPTKQN+RIGPDIKSLVETYINGYEFESKKLEGIPEEAILSIPIGEISWPMEKLKENFLVFMRKIVLESSPQIAGSPISKISLICPPSDEIFFLDFQEDFERFAKMRQKSKLREEEE
Sbjct:    1 MVLKCFFFGTLLRRNISTSQIYKKVQQTNRFKRMTVTNKSSSNKMLDLKGEKNRTAWLKSIEEEETVKGKIANSNVYMEKEFEKIKYSFEDATQFHQEYLLDKALYDSPNSVLKVNYLLNMKTKKVTKFVQKFQGIETPAHPFTFLTKPKILAFCTTQEDIDCAISLGALEAGDEALAKKLEQGHLFYEEFDQVVCHTEASSLLSKLKSVLKDKLPTKQNNRIGPDIKSLVETYINGYEFESKKLEGIPEEAILSIPIGEISWPMEKLKENFLVFMRKIVLESSPQIAGSPISKISLICPPSDEIFFLDFQEDFERFAKMRQKSKLREEEE 331          
BLAST of 50S ribosomal protein L1 vs. Planmine SMEST
Match: SMESG000017111.1 (SMESG000017111.1)

HSP 1 Score: 509.22 bits (1310), Expect = 0.000e+0
Identity = 297/298 (99.66%), Postives = 298/298 (100.00%), Query Frame = 1
Query:  157 MTVTNKSSSNKMLDLKGEKNRTAWLKSIEEEETVKGKIANSNVYMEKEFEKIKYSFEDATQFHQEYLLDKALYDSPNSVLKVNYLLNMXXXXXXXXXXXXXGIETPAHPFTFLTKPKILAFCTTQEDIDCAISXXXXXXXXXXXXXXXXQGHLFYEEFDQVVCHTEAXXXXXXXXXXXXXXXPTKQNSRIGPDIKSLVETYINGYEFESKKLEGIPEEAILSIPIGEISWPMEKLKENFLVFMRKIVLESSPQIAGSPISKISLICPPSDEIFFLDFQEDFERFAKMRQKSKLREEEE 1050
            MTVTNKSSSNKMLDLKGEKNRTAWLKSIEEEETVKGKIANSNVYMEKEFEKIKYSFEDATQFHQEYLLDKALYDSPNSVLKVNYLLNMKTKKVTKFVQKFQGIETPAHPFTFLTKPKILAFCTTQEDIDCAISLGALEAGDEALAKKLEQGHLFYEEFDQVVCHTEASSLLSKLKSVLKDKLPTKQN+RIGPDIKSLVETYINGYEFESKKLEGIPEEAILSIPIGEISWPMEKLKENFLVFMRKIVLESSPQIAGSPISKISLICPPSDEIFFLDFQEDFERFAKMRQKSKLREEEE
Sbjct:    1 MTVTNKSSSNKMLDLKGEKNRTAWLKSIEEEETVKGKIANSNVYMEKEFEKIKYSFEDATQFHQEYLLDKALYDSPNSVLKVNYLLNMKTKKVTKFVQKFQGIETPAHPFTFLTKPKILAFCTTQEDIDCAISLGALEAGDEALAKKLEQGHLFYEEFDQVVCHTEASSLLSKLKSVLKDKLPTKQNNRIGPDIKSLVETYINGYEFESKKLEGIPEEAILSIPIGEISWPMEKLKENFLVFMRKIVLESSPQIAGSPISKISLICPPSDEIFFLDFQEDFERFAKMRQKSKLREEEE 298          
The following BLAST results are available for this feature:
BLAST of 50S ribosomal protein L1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 50S ribosomal protein L1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl-11.363e-1226.16Mitochondrial Ribosomal Protein, Large [Source:Un... [more]
back to top
BLAST of 50S ribosomal protein L1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 50S ribosomal protein L1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 50S ribosomal protein L1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 50S ribosomal protein L1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 50S ribosomal protein L1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 50S ribosomal protein L1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VLH12.382e-3232.78Putative 50s ribosomal protein L1 OS=Schistosoma m... [more]
A0A4E0RPC22.403e-3236.0350S ribosomal protein L1 OS=Fasciola hepatica OX=6... [more]
A0A183MFL11.176e-3134.44Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A095BWE17.337e-3133.3350S ribosomal protein L1 OS=Schistosoma haematobiu... [more]
A0A074Z1862.814e-3033.77Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of 50S ribosomal protein L1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 50S ribosomal protein L1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 50S ribosomal protein L1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 50S ribosomal protein L1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 50S ribosomal protein L1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of 50S ribosomal protein L1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000017111.10.000e+099.70SMESG000017111.1[more]
SMESG000017111.10.000e+099.66SMESG000017111.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031548 ID=SMED30031548|Name=50S ribosomal protein L1|organism=Schmidtea mediterranea sexual|type=transcript|length=1165bp
ATATATAACTCGATTTTGAATTAAATAAATTTATTCTAATAAATTTCAAA
ATTGATAATGGTTTTAAAATGTTTCTTTTTTGGAACATTGCTACGTAGAA
ATATTTCAACTTCTCAAATATATAAAAAAGTGCAGCAAACTAATAGATTT
AAACGAATGACAGTAACTAATAAAAGCAGTTCAAATAAGATGTTAGATTT
AAAAGGTGAAAAAAATCGTACTGCTTGGTTGAAATCAATTGAAGAAGAAG
AAACTGTGAAAGGTAAAATTGCTAACTCCAATGTTTATATGGAAAAGGAA
TTTGAGAAAATCAAATATTCCTTCGAAGATGCCACTCAATTTCATCAGGA
ATATTTACTTGATAAAGCTTTGTATGATTCTCCGAATTCCGTGTTGAAGG
TGAATTATCTCTTGAACATGAAAACGAAGAAAGTCACGAAGTTTGTCCAG
AAATTCCAAGGAATCGAGACTCCAGCTCATCCGTTTACGTTTCTAACTAA
ACCGAAAATTTTAGCTTTTTGCACGACCCAGGAAGATATCGATTGCGCCA
TTTCCCTCGGGGCGTTGGAGGCTGGTGATGAGGCGCTCGCCAAGAAATTG
GAACAGGGACATTTGTTCTATGAGGAATTCGATCAGGTTGTGTGTCACAC
TGAGGCCTCCTCGCTGCTTAGCAAGCTGAAATCGGTATTGAAGGACAAGC
TGCCAACGAAACAGAACAGCCGAATCGGGCCAGACATAAAATCCCTCGTT
GAGACTTACATCAACGGATACGAATTCGAATCGAAAAAGCTTGAAGGCAT
TCCCGAAGAAGCGATTTTATCGATTCCGATTGGAGAGATCAGTTGGCCGA
TGGAGAAACTCAAGGAGAATTTCCTCGTGTTCATGAGGAAAATCGTGTTG
GAATCCTCACCTCAAATTGCCGGCAGCCCAATTTCAAAGATCTCGTTGAT
TTGCCCGCCGTCCGATGAGATCTTCTTTCTGGATTTCCAGGAGGATTTCG
AGAGGTTCGCCAAAATGAGACAGAAGTCAAAACTTAGAGAAGAGGAGGAA
TAAAATTGGTTTTTTGTTTTAATTATTCGCGTGAATTTTGATTGGTTGGT
TTGAATGGAGTGAAATATCATGTTTTATGTCATTGAGTTATCGCGCATAT
ATTGATTTTTCGGTG
back to top

protein sequence of SMED30031548-orf-1

>SMED30031548-orf-1 ID=SMED30031548-orf-1|Name=SMED30031548-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=332bp
MVLKCFFFGTLLRRNISTSQIYKKVQQTNRFKRMTVTNKSSSNKMLDLKG
EKNRTAWLKSIEEEETVKGKIANSNVYMEKEFEKIKYSFEDATQFHQEYL
LDKALYDSPNSVLKVNYLLNMKTKKVTKFVQKFQGIETPAHPFTFLTKPK
ILAFCTTQEDIDCAISLGALEAGDEALAKKLEQGHLFYEEFDQVVCHTEA
SSLLSKLKSVLKDKLPTKQNSRIGPDIKSLVETYINGYEFESKKLEGIPE
EAILSIPIGEISWPMEKLKENFLVFMRKIVLESSPQIAGSPISKISLICP
PSDEIFFLDFQEDFERFAKMRQKSKLREEEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR016094Ribosomal_L1_2-a/b-sand
IPR028364Ribosomal_L1/biogenesis
IPR016095Ribosomal_L1_3-a/b-sand
IPR023674Ribosomal_L1-like
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
Vocabulary: cellular component
TermDefinition
GO:0005840ribosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 319..331
NoneNo IPR availableGENE3DG3DSA:3.30.190.20coord: 115..297
e-value: 1.1E-18
score: 69.5
NoneNo IPR availablePANTHERPTHR36427FAMILY NOT NAMEDcoord: 20..300
IPR028364Ribosomal protein L1/ribosomal biogenesis proteinPFAMPF00687Ribosomal_L1coord: 107..295
e-value: 3.1E-8
score: 33.6
IPR016095Ribosomal protein L1, 3-layer alpha/beta-sandwichGENE3DG3DSA:3.40.50.790coord: 142..237
e-value: 1.1E-18
score: 69.5
IPR023674Ribosomal protein L1-likeSUPERFAMILYSSF56808Ribosomal protein L1coord: 78..296