Na_H_Exchanger domain-containing protein

Overview
NameNa_H_Exchanger domain-containing protein
Smed IDSMED30031547
Length (bp)1825
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Na_H_Exchanger domain-containing protein (SMED30031547) t-SNE clustered cells

Violin plots show distribution of expression levels for Na_H_Exchanger domain-containing protein (SMED30031547) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Na_H_Exchanger domain-containing protein (SMED30031547) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Na_H_Exchanger domain-containing protein (SMED30031547) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031547

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031547SMESG000005979.1 dd_Smed_v4_7736_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031547SMESG000005979.1 dd_Smed_v4_7736_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031547SMESG000005979.1 dd_Smed_v4_7736_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031547SMESG000005979.1 dd_Smed_v4_7736_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031547SMESG000005979.1 dd_Smed_v4_7736_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Human
Match: SLC9B2 (solute carrier family 9 member B2 [Source:HGNC Symbol;Acc:HGNC:25143])

HSP 1 Score: 284.648 bits (727), Expect = 1.118e-88
Identity = 162/342 (47.37%), Postives = 224/342 (65.50%), Query Frame = 3
Query:  408 GMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQ 1433
            GML+ GF +RN P IN  + I   WS +LR++AL IIL+RAGLGLD K LK+L  V VRL+  PCI+EA T A+++H+L+GL W W F+LGF+L AVSPAVVVPS+L L+  G GV++G+ TL++AA S DD+LAITGF  CLG +FS    +   +L G LE + G+  G +LG    Y PS D D  +  R+ L+  LS++++F S+ F  PG+G L  L +AF+ G GW+ +      +  V K+  + W +FQP LFGLIGA + I S+    +G  + T+ I ++ R+L +F  V    F +KE++FI  AWLPKATVQAA+G VALD A  +   Q
Sbjct:   91 GMLLAGFLIRNIPVINDNVQIKHKWSSSLRSIALSIILVRAGLGLDSKALKKLKGVCVRLSMGPCIVEACTSALLAHYLLGLPWQWGFILGFVLGAVSPAVVVPSMLLLQGGGYGVEKGVPTLLMAAGSFDDILAITGFNTCLGIAFSTGSTV-FNVLRGVLEVVIGVATGSVLGFFIQYFPSRDQDKLVCKRTFLVLGLSVLAVFSSVHFGFPGSGGLCTLVMAFLAGMGWTSE------KAEVEKIIAVAWDIFQPLLFGLIGAEVSIASLRPETVGLCVATVGIAVLIRILTTFLMVCFAGFNLKEKIFISFAWLPKATVQAAIGSVALDTARSHGEKQ 425          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Human
Match: SLC9B2 (solute carrier family 9 member B2 [Source:HGNC Symbol;Acc:HGNC:25143])

HSP 1 Score: 281.952 bits (720), Expect = 5.991e-87
Identity = 174/377 (46.15%), Postives = 241/377 (63.93%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILI------VYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQ 1433
            GNL G+++L+    IGG L+           P LLGML+ GF +RN P IN  + I   WS +LR++AL IIL+RAGLGLD K LK+L  V VRL+  PCI+EA T A+++H+L+GL W W F+LGF+L AVSPAVVVPS+L L+  G GV++G+ TL++AA S DD+LAITGF  CLG +FS    +   +L G LE + G+  G +LG    Y PS D D  +  R+ L+  LS++++F S+ F  PG+G L  L +AF+ G GW+ +      +  V K+  + W +FQP LFGLIGA + I S+    +G  + T+ I ++ R+L +F  V    F +KE++FI  AWLPKATVQAA+G VALD A  +   Q
Sbjct:  113 GNLFGIIILFYCAIIGGKLLGLIKLPTLPPLPSLLGMLLAGFLIRNIPVINDNVQIKHKWSSSLRSIALSIILVRAGLGLDSKALKKLKGVCVRLSMGPCIVEACTSALLAHYLLGLPWQWGFILGFVLGAVSPAVVVPSMLLLQGGGYGVEKGVPTLLMAAGSFDDILAITGFNTCLGIAFSTGSTV-FNVLRGVLEVVIGVATGSVLGFFIQYFPSRDQDKLVCKRTFLVLGLSVLAVFSSVHFGFPGSGGLCTLVMAFLAGMGWTSE------KAEVEKIIAVAWDIFQPLLFGLIGAEVSIASLRPETVGLCVATVGIAVLIRILTTFLMVCFAGFNLKEKIFISFAWLPKATVQAAIGSVALDTARSHGEKQ 482          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Human
Match: SLC9B2 (solute carrier family 9 member B2 [Source:HGNC Symbol;Acc:HGNC:25143])

HSP 1 Score: 281.952 bits (720), Expect = 5.991e-87
Identity = 174/377 (46.15%), Postives = 241/377 (63.93%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILI------VYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQ 1433
            GNL G+++L+    IGG L+           P LLGML+ GF +RN P IN  + I   WS +LR++AL IIL+RAGLGLD K LK+L  V VRL+  PCI+EA T A+++H+L+GL W W F+LGF+L AVSPAVVVPS+L L+  G GV++G+ TL++AA S DD+LAITGF  CLG +FS    +   +L G LE + G+  G +LG    Y PS D D  +  R+ L+  LS++++F S+ F  PG+G L  L +AF+ G GW+ +      +  V K+  + W +FQP LFGLIGA + I S+    +G  + T+ I ++ R+L +F  V    F +KE++FI  AWLPKATVQAA+G VALD A  +   Q
Sbjct:  113 GNLFGIIILFYCAIIGGKLLGLIKLPTLPPLPSLLGMLLAGFLIRNIPVINDNVQIKHKWSSSLRSIALSIILVRAGLGLDSKALKKLKGVCVRLSMGPCIVEACTSALLAHYLLGLPWQWGFILGFVLGAVSPAVVVPSMLLLQGGGYGVEKGVPTLLMAAGSFDDILAITGFNTCLGIAFSTGSTV-FNVLRGVLEVVIGVATGSVLGFFIQYFPSRDQDKLVCKRTFLVLGLSVLAVFSSVHFGFPGSGGLCTLVMAFLAGMGWTSE------KAEVEKIIAVAWDIFQPLLFGLIGAEVSIASLRPETVGLCVATVGIAVLIRILTTFLMVCFAGFNLKEKIFISFAWLPKATVQAAIGSVALDTARSHGEKQ 482          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Human
Match: SLC9B1 (solute carrier family 9 member B1 [Source:HGNC Symbol;Acc:HGNC:24244])

HSP 1 Score: 254.603 bits (649), Expect = 9.502e-77
Identity = 164/428 (38.32%), Postives = 245/428 (57.24%), Query Frame = 3
Query:  147 ITCPPRLFINVFLTVILCFITIGICLYSFDPKDFDIVNCTSRLSQNTTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLII------GFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            I+CP R  +NV        IT G+ L+        ++ C       T  I  +     GNL GL +++    IGG ++  I+ P +  +  +      GF +RN P+IN  + +   WS  LR++AL IILIRAGLGLDP+ L+ L  V  RLA  PC++EA   A+ SHF++   W WAF+LGF+L AVSPAVVVP ++ L++ G GV++GI TL++AA+S+DD+LAITGF  CL   FS    L   I S        ++ GI+LG    Y PS D       R  L+  + + ++ GS    + G+G L  L L+F+ G  WS++      +  V K+   +W +FQP LFGL+GA + ++S+  + +G  + TL + +  R+L ++  +    F+ KE++FI +AW+PKATVQA LGP+AL+ A
Sbjct:   56 ISCPLRGVLNVI-------ITNGVILF--------VIWCM------TWSILGSEALPGGNLFGLFIIFYSAIIGGKILQLIRIPLVPPLPPLLGMLLAGFTIRNVPFINEHVHVPNTWSSILRSIALTIILIRAGLGLDPQALRHLKVVCFRLAVGPCLMEASAAAVFSHFIMKFPWQWAFLLGFVLGAVSPAVVVPYMMVLQENGYGVEEGIPTLLMAASSMDDILAITGFNTCLSIVFSSGGILNNAIAS-IRNVCISLLAGIVLGFFVRYFPSEDQKKLTLKRGFLVLTMCVSAVLGSQRIGLHGSGGLCTLVLSFIAGTKWSQE------KMKVQKIITTVWDIFQPLLFGLVGAEVSVSSLESNIVGISVATLSLALCVRILTTYLLMCFAGFSFKEKIFIALAWMPKATVQAVLGPLALETA 455          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Human
Match: SLC9B1 (solute carrier family 9 member B1 [Source:HGNC Symbol;Acc:HGNC:24244])

HSP 1 Score: 241.121 bits (614), Expect = 4.519e-72
Identity = 157/417 (37.65%), Postives = 236/417 (56.59%), Query Frame = 3
Query:  147 ITCPPRLFINVFLTVILCFITIGICLYSFDPKDFDIVNCTSRLSQNTTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLII------GFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQ 1379
            I+CP R  +NV        IT G+ L+        ++ C       T  I  +     GNL GL +++    IGG ++  I+ P +  +  +      GF +RN P+IN  + +   WS  LR++AL IILIRAGLGLDP+ L+ L  V  RLA  PC++EA   A+ SHF++   W WAF+LGF+L AVSPAVVVP ++ L++ G GV++GI TL++AA+S+DD+LAITGF  CL   FS    L   I S        ++ GI+LG    Y PS D       R  L+  + + ++ GS    + G+G L  L L+F+ G  WS++      +  V K+   +W +FQP LFGL+GA + ++S+  + +G  + TL + +  R+L ++  +    F+ KE++FI +AW+PKATVQ
Sbjct:   56 ISCPLRGVLNVI-------ITNGVILF--------VIWCM------TWSILGSEALPGGNLFGLFIIFYSAIIGGKILQLIRIPLVPPLPPLLGMLLAGFTIRNVPFINEHVHVPNTWSSILRSIALTIILIRAGLGLDPQALRHLKVVCFRLAVGPCLMEASAAAVFSHFIMKFPWQWAFLLGFVLGAVSPAVVVPYMMVLQENGYGVEEGIPTLLMAASSMDDILAITGFNTCLSIVFSSGGILNNAIAS-IRNVCISLLAGIVLGFFVRYFPSEDQKKLTLKRGFLVLTMCVSAVLGSQRIGLHGSGGLCTLVLSFIAGTKWSQE------KMKVQKIITTVWDIFQPLLFGLVGAEVSVSSLESNIVGISVATLSLALCVRILTTYLLMCFAGFSFKEKIFIALAWMPKATVQ 444          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Celegans
Match: F41E7.2 (pep chromosome:WBcel235:X:10273692:10278261:1 gene:WBGene00009618.1 transcript:F41E7.2.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F41E7.2)

HSP 1 Score: 109.768 bits (273), Expect = 4.310e-25
Identity = 89/378 (23.54%), Postives = 187/378 (49.47%), Query Frame = 3
Query:  267 SRLSQNTTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLY--LLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGP 1394
            S ++ N+ ++ N       +++   ++ +     G L+ +I  P L+G +++G A+RN P      +IN+ W   LR ++L++I+IR G+ ++ + +K+       L       EA+     +        S   + GF+++ VSPAV +P+++ L+++G+G    I  +V AA   D+V+++  F +    +F+ +      + S     LA I+  +I  ++ W+ P +DN +  F R +++     ++++    + +  P  G +  L +  V+   W +D+   G +  V +   L +++  P LF L+G   D  +++        + + +G  FRL+++    +   F + E++ + +  +PKATVQ AL P
Sbjct:   52 SPVTSNSLNLQNAANEVLHSIISCFMMVVLAVAAGKLVKFIYTPSLIGCMLVGIAMRNVPQFGELFYINEYWQFILRKLSLVVIIIRWGISINVRFIKKNYIFPPILGLGSAFSEALAICFTACVFFDFPLSLGLICGFVVATVSPAVGMPTMIRLKEQGIGTTNNIPDVVPAACCFDNVVSLLIFSVTSSVTFTHDAFFLTMVKSIGAIVLAAIIGCVIGWLLRWF-PKNDNRHTHFARFLVIASPAYAVITSMLILGYAFP--GIVSALCICCVSTTHWREDNP-KGIKVLVHQFDNLWYFVAVPLLFSLVGYTFDFQNMSAENWKTAFIIIAVGSSFRLISAMILSYYGHFNIYEQIILALTLMPKATVQCALAP 425          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Celegans
Match: F41E7.2 (pep chromosome:WBcel235:X:10273888:10278261:1 gene:WBGene00009618.1 transcript:F41E7.2.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F41E7.2)

HSP 1 Score: 109.768 bits (273), Expect = 4.310e-25
Identity = 89/378 (23.54%), Postives = 187/378 (49.47%), Query Frame = 3
Query:  267 SRLSQNTTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLY--LLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGP 1394
            S ++ N+ ++ N       +++   ++ +     G L+ +I  P L+G +++G A+RN P      +IN+ W   LR ++L++I+IR G+ ++ + +K+       L       EA+     +        S   + GF+++ VSPAV +P+++ L+++G+G    I  +V AA   D+V+++  F +    +F+ +      + S     LA I+  +I  ++ W+ P +DN +  F R +++     ++++    + +  P  G +  L +  V+   W +D+   G +  V +   L +++  P LF L+G   D  +++        + + +G  FRL+++    +   F + E++ + +  +PKATVQ AL P
Sbjct:   52 SPVTSNSLNLQNAANEVLHSIISCFMMVVLAVAAGKLVKFIYTPSLIGCMLVGIAMRNVPQFGELFYINEYWQFILRKLSLVVIIIRWGISINVRFIKKNYIFPPILGLGSAFSEALAICFTACVFFDFPLSLGLICGFVVATVSPAVGMPTMIRLKEQGIGTTNNIPDVVPAACCFDNVVSLLIFSVTSSVTFTHDAFFLTMVKSIGAIVLAAIIGCVIGWLLRWF-PKNDNRHTHFARFLVIASPAYAVITSMLILGYAFP--GIVSALCICCVSTTHWREDNP-KGIKVLVHQFDNLWYFVAVPLLFSLVGYTFDFQNMSAENWKTAFIIIAVGSSFRLISAMILSYYGHFNIYEQIILALTLMPKATVQCALAP 425          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Celegans
Match: F41E7.2 (pep chromosome:WBcel235:X:10273887:10278261:1 gene:WBGene00009618.1 transcript:F41E7.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F41E7.2)

HSP 1 Score: 109.768 bits (273), Expect = 4.310e-25
Identity = 89/378 (23.54%), Postives = 187/378 (49.47%), Query Frame = 3
Query:  267 SRLSQNTTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLY--LLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGP 1394
            S ++ N+ ++ N       +++   ++ +     G L+ +I  P L+G +++G A+RN P      +IN+ W   LR ++L++I+IR G+ ++ + +K+       L       EA+     +        S   + GF+++ VSPAV +P+++ L+++G+G    I  +V AA   D+V+++  F +    +F+ +      + S     LA I+  +I  ++ W+ P +DN +  F R +++     ++++    + +  P  G +  L +  V+   W +D+   G +  V +   L +++  P LF L+G   D  +++        + + +G  FRL+++    +   F + E++ + +  +PKATVQ AL P
Sbjct:   52 SPVTSNSLNLQNAANEVLHSIISCFMMVVLAVAAGKLVKFIYTPSLIGCMLVGIAMRNVPQFGELFYINEYWQFILRKLSLVVIIIRWGISINVRFIKKNYIFPPILGLGSAFSEALAICFTACVFFDFPLSLGLICGFVVATVSPAVGMPTMIRLKEQGIGTTNNIPDVVPAACCFDNVVSLLIFSVTSSVTFTHDAFFLTMVKSIGAIVLAAIIGCVIGWLLRWF-PKNDNRHTHFARFLVIASPAYAVITSMLILGYAFP--GIVSALCICCVSTTHWREDNP-KGIKVLVHQFDNLWYFVAVPLLFSLVGYTFDFQNMSAENWKTAFIIIAVGSSFRLISAMILSYYGHFNIYEQIILALTLMPKATVQCALAP 425          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Celegans
Match: F41E7.1 (pep chromosome:WBcel235:X:10279599:10282842:1 gene:WBGene00009617.1 transcript:F41E7.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F41E7.1)

HSP 1 Score: 105.145 bits (261), Expect = 1.229e-23
Identity = 105/419 (25.06%), Postives = 188/419 (44.87%), Query Frame = 3
Query:  171 INVFLTVILCFITIGICLYSFDPKDFDIVNCTSRLSQNTTHI----ANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQ-PFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            IN   T IL FI++ I + +   ++F        L+    H+    A N      ++  + +L +       +   ++ PPL G L +G  ++N    +            +R +AL++I++R GL  D   L   + + V +     I E I   I S+F++ +S+  +     IL  VSPAV VP+++  ++K LG  + I   ++A   +D++  +  F +     F+D   +A  IL      + G + GI+LG + W  P SD  +  F R  LL  + I  + G+   K   +G L  L  + ++   W  D+    K   V    + +W  F  P LF  +G   D +++ +  +   I  + IG++ R +        +    KE++ + ++ LP+AT QA L P  L +A
Sbjct:   20 INSITTTILIFISLYISIITLLGENF--------LNPLADHVNPVNATNEDVTVRSIFVIFILLVAGIFAAKISKALRLPPLFGCLALGIIIKNITVFDQFFVFPPFVETMIRKVALVMIIVRWGLATDIHFLYENALMPVTIGLVTAIGEIIAVTIASYFILNISFVMSIFCALILVTVSPAVTVPAMINFKEKQLGSLKRIPENILAICCVDNLFCVILFMVLSSIIFTD-APIATTILLNAGSIVFGCIGGIVLGWILWRFPRSDAPHTQFARITLLGTICIAVVIGTYLIKYSCSGFLAALITSAMSAMQWKADN--KEKLECVESTYKYIWDSFALPLLFICLGMKFDCSTLTWEIVFLCIAVIAIGLLVRTILVMLVTLSSHINFKEQIVVALSLLPRATFQADLAPTLLLMA 427          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Celegans
Match: F57G8.5 (pep chromosome:WBcel235:V:16339024:16341536:1 gene:WBGene00010214.1 transcript:F57G8.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F57G8.5)

HSP 1 Score: 102.834 bits (255), Expect = 5.575e-23
Identity = 119/428 (27.80%), Postives = 191/428 (44.63%), Query Frame = 3
Query:  171 INVFLTVILCFITIGICLYSFDPKDFDIVNCTSRLSQNTTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVY----IKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQ-PFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGP--VALDLAIKNNLPQ 1433
            IN+  T +L F ++ I + S    DF      + L        + NK  K   +  L+L+     GG+        ++ PPL G L +G  +RN   +     I       +R +AL +I+IR GL  D K L   +   V +     I E I   I S  ++ +S+  A     IL  VSPAV VP+++  +++GLG  + I   V+A   +D++  +  F +     F+D   +A  IL      L G + GII+G++ W  P  D  +  F R  LL    I  M G+   K   AG L  L  + +    W  D+    K + V    + +W  F  P LF  +G   D +++++  +   I  + IG++ R L    +   + F +KE+  I ++ LP+AT QA L P  V +     + LP 
Sbjct:   13 INLITTTVLIFASLYIAIISLLGHDF-----LTPLHAIPPGAPSENKTVKSTFIIFLLLF-----GGLFAAKSSNALRLPPLFGCLALGIVIRNVDVLKDFFIIPPFTETMIRKVALAMIVIRWGLATDVKFLYENAVTPVTIGLVTAIGEIIAITIASFLILDISFVMAVFCALILVIVSPAVTVPAMISFKERGLGSSKRIPENVLAVCCVDNLFCVIVFMVLSSIIFTD-APIATTILMNAGSILLGCIGGIIIGLLLWRFPRPDTTHTQFARITLLGTSCIGLMIGTYLVKYSCAGFLAALITSSMCAMKWKTDN--KDKLDCVVSTYKYVWDSFALPLLFICLGLKFDFSTLSWKIVLLCISVICIGLIVRALLVMLTTHFSHFNVKEKAVIALSLLPRATFQADLAPTLVVMATPFPDKLPD 427          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Fly
Match: Nha1 (gene:FBgn0031865 transcript:FBtr0079373)

HSP 1 Score: 238.039 bits (606), Expect = 4.041e-69
Identity = 144/370 (38.92%), Postives = 220/370 (59.46%), Query Frame = 3
Query:  294 IANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVAL 1403
            I  ++    G L GL+VL +    GG LI     P L+GML++G   +N  + ++    +K+ + +LR  AL IIL RAGL ++P+  K++   +++L   P  +EA+  A++SHFL+ L W WAF+LG I++AVSPAVVVP +  L  KG GV +GI TLV+A A +DD L++  FGI     FSD + LA QI   P+  L G+ FG++ G ++   P   +   +  R++LL+   +++++GS      GAG L V+  AFV+   W KD  W+ + NPV+   E+ W +F+P LFGL GA + I  ++   +  G   +  G + R+L +    FG +   KE+ F+ ++W+ KATVQAALGPVAL
Sbjct:  235 IIGDSAAPGGQLFGLVVLTVAANFGGYLISLTTLPRLIGMLLVGILFQNVGWADIDGDFSKV-TAHLRKFALTIILTRAGLEMEPEAFKKVYKTILKLGIIPWCVEAVVMAVMSHFLLDLPWIWAFLLGSIIAAVSPAVVVPCLFRLRTKGYGVAKGIPTLVVAVAGVDDALSVAIFGIISTVMFSD-KGLAYQIAQAPVCILGGLGFGVVWGSLARIFPEKGDAYVVPLRTLLLFTGGLMAIYGSEELGFEGAGPLAVVFSAFVSNLFWCKDG-WDVEDNPVSTAFEIFWMIFEPILFGLTGATIKIRELDSHTVSIGAACIFTGAILRILTTAGIAFGDRLNTKEKFFVGLSWMAKATVQAALGPVAL 601          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Fly
Match: Nha1 (gene:FBgn0031865 transcript:FBtr0079374)

HSP 1 Score: 238.039 bits (606), Expect = 4.800e-69
Identity = 144/370 (38.92%), Postives = 220/370 (59.46%), Query Frame = 3
Query:  294 IANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVAL 1403
            I  ++    G L GL+VL +    GG LI     P L+GML++G   +N  + ++    +K+ + +LR  AL IIL RAGL ++P+  K++   +++L   P  +EA+  A++SHFL+ L W WAF+LG I++AVSPAVVVP +  L  KG GV +GI TLV+A A +DD L++  FGI     FSD + LA QI   P+  L G+ FG++ G ++   P   +   +  R++LL+   +++++GS      GAG L V+  AFV+   W KD  W+ + NPV+   E+ W +F+P LFGL GA + I  ++   +  G   +  G + R+L +    FG +   KE+ F+ ++W+ KATVQAALGPVAL
Sbjct:  242 IIGDSAAPGGQLFGLVVLTVAANFGGYLISLTTLPRLIGMLLVGILFQNVGWADIDGDFSKV-TAHLRKFALTIILTRAGLEMEPEAFKKVYKTILKLGIIPWCVEAVVMAVMSHFLLDLPWIWAFLLGSIIAAVSPAVVVPCLFRLRTKGYGVAKGIPTLVVAVAGVDDALSVAIFGIISTVMFSD-KGLAYQIAQAPVCILGGLGFGVVWGSLARIFPEKGDAYVVPLRTLLLFTGGLMAIYGSEELGFEGAGPLAVVFSAFVSNLFWCKDG-WDVEDNPVSTAFEIFWMIFEPILFGLTGATIKIRELDSHTVSIGAACIFTGAILRILTTAGIAFGDRLNTKEKFFVGLSWMAKATVQAALGPVAL 608          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Fly
Match: Nha2 (gene:FBgn0263390 transcript:FBtr0309100)

HSP 1 Score: 196.438 bits (498), Expect = 9.034e-55
Identity = 132/363 (36.36%), Postives = 205/363 (56.47%), Query Frame = 3
Query:  345 LYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRN-------PVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            L++G  I GIL+ ++  P +LGML  G    N    N   +  + +   LR MAL+ I++ AGLGLD    KRL F+++RL   P I+E    A +++  + + W W   LG +++AVSP VVV  +L+L++  LG++ GI+TL+ A  + +DV+AI  FG+ +   FS   +L  Q+L GP+    G++FG + G +  Y+PS +       R VL  L   +++ GS       AGALG +T AF+   GW ++      +         V K  +L+W   +P  F LIG  ++ N +    +G+G + +L+G +FRL  ++ S +G   + KER +I I+  PKATVQAALGPVALD+A
Sbjct:  152 LFVGAQISGILVTFVHLPDMLGMLFFGVLYANLGLANFEGY--QKFELFLREMALINIMLLAGLGLDGDAFKRLWFMILRLTLLPTIVEVAAIAGLANLTLSMPWLWGIALGLVITAVSPNVVVTVMLKLKEDRLGLNSGIHTLIYAMTTCNDVVAIFMFGVIISVIFSTT-SLTQQVLQGPIGIGIGLVFGYLYGSMLQYLPSRNATYANGLRFVLTILGGTIAVMGSRVIGYTSAGALGCVTTAFIARIGWRREETRLTPQQLQAQQIASVPKRLDLMWKFLKPVSFALIGKEINFNVLQGHVIGYGALLVLVGSLFRLAFAYLSTYGGNLSRKERAYITISGFPKATVQAALGPVALDMA 511          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Fly
Match: Nha2 (gene:FBgn0263390 transcript:FBtr0309101)

HSP 1 Score: 196.438 bits (498), Expect = 5.402e-54
Identity = 132/363 (36.36%), Postives = 205/363 (56.47%), Query Frame = 3
Query:  345 LYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRN-------PVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            L++G  I GIL+ ++  P +LGML  G    N    N   +  + +   LR MAL+ I++ AGLGLD    KRL F+++RL   P I+E    A +++  + + W W   LG +++AVSP VVV  +L+L++  LG++ GI+TL+ A  + +DV+AI  FG+ +   FS   +L  Q+L GP+    G++FG + G +  Y+PS +       R VL  L   +++ GS       AGALG +T AF+   GW ++      +         V K  +L+W   +P  F LIG  ++ N +    +G+G + +L+G +FRL  ++ S +G   + KER +I I+  PKATVQAALGPVALD+A
Sbjct:  282 LFVGAQISGILVTFVHLPDMLGMLFFGVLYANLGLANFEGY--QKFELFLREMALINIMLLAGLGLDGDAFKRLWFMILRLTLLPTIVEVAAIAGLANLTLSMPWLWGIALGLVITAVSPNVVVTVMLKLKEDRLGLNSGIHTLIYAMTTCNDVVAIFMFGVIISVIFSTT-SLTQQVLQGPIGIGIGLVFGYLYGSMLQYLPSRNATYANGLRFVLTILGGTIAVMGSRVIGYTSAGALGCVTTAFIARIGWRREETRLTPQQLQAQQIASVPKRLDLMWKFLKPVSFALIGKEINFNVLQGHVIGYGALLVLVGSLFRLAFAYLSTYGGNLSRKERAYITISGFPKATVQAALGPVALDMA 641          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Zebrafish
Match: SLC9B2 (si:dkey-162b23.4 [Source:ZFIN;Acc:ZDB-GENE-110411-203])

HSP 1 Score: 279.641 bits (714), Expect = 5.894e-86
Identity = 172/378 (45.50%), Postives = 240/378 (63.49%), Query Frame = 3
Query:  300 NNNKC-DKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGM------LIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
               +C   GNL G++ L+I    GG L   I+ P L  +      L+ GF LRN P +  A++I+  WS +LRN+AL +IL++AGL LD K LK+L  V +RL+  P I EA T A++S+ ++GL W W F+LGF+L AV+PAVVVPS+L L ++G G++QGI TL++AA S+DD++AIT F  CLG +F+   ++ L +L GPLE L G + G+ LG    Y PS D  N +  RS L+  LS+ ++FGS    IPGAG L  L LAFV G GW +       +  V  + E  W +FQP LFGLIGA + I+S+  + +  GI  L IG+  RLL +F  V    F +KE++F+ +AW+PKATVQAA+G  ALD+A
Sbjct:  124 TEKECLPGGNLFGIVTLFICSVAGGKLFGRIRLPRLPPVPPLLGMLLAGFILRNIPVVTDAVYIDVRWSSSLRNIALGVILVKAGLELDSKALKKLKAVCLRLSMFPLIFEAATMAVMSYLILGLPWIWGFILGFVLGAVTPAVVVPSMLLLHRQGYGLEQGIPTLLMAACSVDDIIAITCFTTCLGIAFATG-SVWLNVLRGPLEVLGGAVTGVALGFFLHYFPSRDQRNLVLKRSFLVLGLSVFALFGSNVAGIPGAGGLCTLVLAFVAGIGWGR------AKASVEAVVERFWLVFQPLLFGLIGAEIVISSLELTTVFLGIAALFIGLTVRLLVTFIVVLRAGFNLKEKIFVTLAWMPKATVQAAIGSTALDMA 494          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Xenopus
Match: slc9b2 (solute carrier family 9 member B2 [Source:NCBI gene;Acc:100101762])

HSP 1 Score: 286.574 bits (732), Expect = 1.027e-89
Identity = 179/370 (48.38%), Postives = 240/370 (64.86%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLII------GFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            GNL G+L L     +GG LI  IK P L  +  +      GF +RN P I   + I+  WS  LRN+AL IIL+RAGLGLDPK L++L  V +RL+F PC++E+ T A+VSHF++GL  +W FMLGF+L AVSPAVVVPS+L L+K+G GVD+GI TL++AA S DDVLAITGF  CLG +FS    L   I+ G LE + GI  G++ G    Y PS D +N    RS L+  LS+ ++FGS+ F  PG+G L  L +AF+ G GWS D      +  V  +  + W +FQP LFGLIGA + + S+    +G    TL+I ++ R+  SF  V  + F++KE++FI +AW+PKATVQAA+G VALD A
Sbjct:   38 GNLFGILALLFSAALGGKLISLIKIPSLPPLPPLLGMLLAGFLIRNIPVITDQVQIHHKWSAALRNIALAIILVRAGLGLDPKALRKLKAVCLRLSFGPCVVESCTAAVVSHFIMGLPLTWGFMLGFVLGAVSPAVVVPSMLILQKEGFGVDKGIPTLLMAAGSFDDVLAITGFNTCLGMAFSSGSTLN-TIVRGVLEVVVGIAAGLLFGFFLHYFPSKDQENLKGKRSYLILALSVFAVFGSLYFGFPGSGGLCTLVMAFLAGIGWSTD------KTVVEDIIAVSWDIFQPLLFGLIGAEISVVSLKPETVGLCTATLIIALIIRICISFLMVCFSGFSLKEKIFISLAWMPKATVQAAIGSVALDTA 400          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Xenopus
Match: slc9b2 (solute carrier family 9 member B2 [Source:NCBI gene;Acc:100101762])

HSP 1 Score: 286.189 bits (731), Expect = 1.313e-89
Identity = 179/370 (48.38%), Postives = 240/370 (64.86%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLII------GFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            GNL G+L L     +GG LI  IK P L  +  +      GF +RN P I   + I+  WS  LRN+AL IIL+RAGLGLDPK L++L  V +RL+F PC++E+ T A+VSHF++GL  +W FMLGF+L AVSPAVVVPS+L L+K+G GVD+GI TL++AA S DDVLAITGF  CLG +FS    L   I+ G LE + GI  G++ G    Y PS D +N    RS L+  LS+ ++FGS+ F  PG+G L  L +AF+ G GWS D      +  V  +  + W +FQP LFGLIGA + + S+    +G    TL+I ++ R+  SF  V  + F++KE++FI +AW+PKATVQAA+G VALD A
Sbjct:   41 GNLFGILALLFSAALGGKLISLIKIPSLPPLPPLLGMLLAGFLIRNIPVITDQVQIHHKWSAALRNIALAIILVRAGLGLDPKALRKLKAVCLRLSFGPCVVESCTAAVVSHFIMGLPLTWGFMLGFVLGAVSPAVVVPSMLILQKEGFGVDKGIPTLLMAAGSFDDVLAITGFNTCLGMAFSSGSTLN-TIVRGVLEVVVGIAAGLLFGFFLHYFPSKDQENLKGKRSYLILALSVFAVFGSLYFGFPGSGGLCTLVMAFLAGIGWSTD------KTVVEDIIAVSWDIFQPLLFGLIGAEISVVSLKPETVGLCTATLIIALIIRICISFLMVCFSGFSLKEKIFISLAWMPKATVQAAIGSVALDTA 403          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Xenopus
Match: slc9b2 (solute carrier family 9 member B2 [Source:NCBI gene;Acc:100101762])

HSP 1 Score: 288.5 bits (737), Expect = 1.715e-89
Identity = 179/370 (48.38%), Postives = 240/370 (64.86%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLII------GFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            GNL G+L L     +GG LI  IK P L  +  +      GF +RN P I   + I+  WS  LRN+AL IIL+RAGLGLDPK L++L  V +RL+F PC++E+ T A+VSHF++GL  +W FMLGF+L AVSPAVVVPS+L L+K+G GVD+GI TL++AA S DDVLAITGF  CLG +FS    L   I+ G LE + GI  G++ G    Y PS D +N    RS L+  LS+ ++FGS+ F  PG+G L  L +AF+ G GWS D      +  V  +  + W +FQP LFGLIGA + + S+    +G    TL+I ++ R+  SF  V  + F++KE++FI +AW+PKATVQAA+G VALD A
Sbjct:  105 GNLFGILALLFSAALGGKLISLIKIPSLPPLPPLLGMLLAGFLIRNIPVITDQVQIHHKWSAALRNIALAIILVRAGLGLDPKALRKLKAVCLRLSFGPCVVESCTAAVVSHFIMGLPLTWGFMLGFVLGAVSPAVVVPSMLILQKEGFGVDKGIPTLLMAAGSFDDVLAITGFNTCLGMAFSSGSTLN-TIVRGVLEVVVGIAAGLLFGFFLHYFPSKDQENLKGKRSYLILALSVFAVFGSLYFGFPGSGGLCTLVMAFLAGIGWSTD------KTVVEDIIAVSWDIFQPLLFGLIGAEISVVSLKPETVGLCTATLIIALIIRICISFLMVCFSGFSLKEKIFISLAWMPKATVQAAIGSVALDTA 467          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Xenopus
Match: slc9b2 (solute carrier family 9 member B2 [Source:NCBI gene;Acc:100101762])

HSP 1 Score: 286.574 bits (732), Expect = 3.567e-89
Identity = 179/370 (48.38%), Postives = 240/370 (64.86%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLII------GFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            GNL G+L L     +GG LI  IK P L  +  +      GF +RN P I   + I+  WS  LRN+AL IIL+RAGLGLDPK L++L  V +RL+F PC++E+ T A+VSHF++GL  +W FMLGF+L AVSPAVVVPS+L L+K+G GVD+GI TL++AA S DDVLAITGF  CLG +FS    L   I+ G LE + GI  G++ G    Y PS D +N    RS L+  LS+ ++FGS+ F  PG+G L  L +AF+ G GWS D      +  V  +  + W +FQP LFGLIGA + + S+    +G    TL+I ++ R+  SF  V  + F++KE++FI +AW+PKATVQAA+G VALD A
Sbjct:   79 GNLFGILALLFSAALGGKLISLIKIPSLPPLPPLLGMLLAGFLIRNIPVITDQVQIHHKWSAALRNIALAIILVRAGLGLDPKALRKLKAVCLRLSFGPCVVESCTAAVVSHFIMGLPLTWGFMLGFVLGAVSPAVVVPSMLILQKEGFGVDKGIPTLLMAAGSFDDVLAITGFNTCLGMAFSSGSTLN-TIVRGVLEVVVGIAAGLLFGFFLHYFPSKDQENLKGKRSYLILALSVFAVFGSLYFGFPGSGGLCTLVMAFLAGIGWSTD------KTVVEDIIAVSWDIFQPLLFGLIGAEISVVSLKPETVGLCTATLIIALIIRICISFLMVCFSGFSLKEKIFISLAWMPKATVQAAIGSVALDTA 441          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Xenopus
Match: slc9b2 (solute carrier family 9 member B2 [Source:NCBI gene;Acc:100101762])

HSP 1 Score: 287.345 bits (734), Expect = 4.028e-89
Identity = 179/370 (48.38%), Postives = 240/370 (64.86%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLII------GFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            GNL G+L L     +GG LI  IK P L  +  +      GF +RN P I   + I+  WS  LRN+AL IIL+RAGLGLDPK L++L  V +RL+F PC++E+ T A+VSHF++GL  +W FMLGF+L AVSPAVVVPS+L L+K+G GVD+GI TL++AA S DDVLAITGF  CLG +FS    L   I+ G LE + GI  G++ G    Y PS D +N    RS L+  LS+ ++FGS+ F  PG+G L  L +AF+ G GWS D      +  V  +  + W +FQP LFGLIGA + + S+    +G    TL+I ++ R+  SF  V  + F++KE++FI +AW+PKATVQAA+G VALD A
Sbjct:  100 GNLFGILALLFSAALGGKLISLIKIPSLPPLPPLLGMLLAGFLIRNIPVITDQVQIHHKWSAALRNIALAIILVRAGLGLDPKALRKLKAVCLRLSFGPCVVESCTAAVVSHFIMGLPLTWGFMLGFVLGAVSPAVVVPSMLILQKEGFGVDKGIPTLLMAAGSFDDVLAITGFNTCLGMAFSSGSTLN-TIVRGVLEVVVGIAAGLLFGFFLHYFPSKDQENLKGKRSYLILALSVFAVFGSLYFGFPGSGGLCTLVMAFLAGIGWSTD------KTVVEDIIAVSWDIFQPLLFGLIGAEISVVSLKPETVGLCTATLIIALIIRICISFLMVCFSGFSLKEKIFISLAWMPKATVQAAIGSVALDTA 462          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Mouse
Match: Slc9b2 (solute carrier family 9, subfamily B (NHA2, cation proton antiporter 2), member 2 [Source:MGI Symbol;Acc:MGI:2140077])

HSP 1 Score: 285.419 bits (729), Expect = 2.764e-88
Identity = 174/377 (46.15%), Postives = 238/377 (63.13%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLII------GFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQ 1433
            GNL G+++L+     GG L   IKFP L  +  +      GF LRN P IN ++ I   WS +LR++AL +IL+RAGLGLD K L++L  V VRLA  PCI+EA   AI+SHFL+GL W W F+LGF++ AVSPAVVVPS+L L++ G GV +GI TL++AA S DD+LAITGF  CLG +FS    +   I  G LE + G+  G  LG    Y PS D DN ++ R+ L+   +++++F S+ F  PG+G L  L +AF+ G  W+       K++ V K+  + W +FQP LFGLIGA + I S+    +G  + TL I ++ R+L +F  V    F +KE++FI  AWLPKATVQAA+G VALD A  +   Q
Sbjct:  113 GNLFGIIILFYCSITGGKLFGLIKFPTLPPLPPLLGMLLAGFLLRNIPVINDSVRIQHKWSSSLRSIALSVILVRAGLGLDSKALRKLKGVCVRLAMGPCIVEACASAILSHFLMGLPWQWGFILGFVVGAVSPAVVVPSMLLLQEGGYGVGKGIPTLLMAAGSFDDILAITGFNTCLGVAFSTGSTV-FNIFRGILEVVIGVAAGSFLGFFIQYFPSRDQDNLVWKRAFLVLGFAVLAVFSSVYFSFPGSGGLCTLVMAFLAGMRWTD------KKSEVEKVIAVTWDVFQPLLFGLIGAEVSIVSLRAETVGLCVATLSIAVLIRILTTFLMVCFAGFNIKEKIFISFAWLPKATVQAAIGSVALDTARSHGEKQ 482          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Mouse
Match: Slc9b1 (solute carrier family 9, subfamily B (NHA1, cation proton antiporter 1), member 1 [Source:MGI Symbol;Acc:MGI:1921696])

HSP 1 Score: 250.366 bits (638), Expect = 7.841e-75
Identity = 150/370 (40.54%), Postives = 229/370 (61.89%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLL------GMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            GNL GL+V++    +GG ++ +I+ P +       GML+ GF +RN P I   + I   WS  LRN AL IIL+RAGLGLDP+ LK L  V +RL+F PC +EA + A+ SHF++   W W F+LGF+L AVSPAVVVP++L L++ G GV++GI TL++AA+S+DD++AITGF   L   FS    ++  ILS   + L G++ GI++G+   Y PS D +     R+ L+  + I ++ G     + G+G L  L L+F+    W+++      +  + K+    W +FQP LFGL+G  + + S+    +G  + TL + +  R+L++F  +    F  KE++FI ++W+PKATVQA LGP+AL+ A
Sbjct:  144 GNLFGLVVIFYSAFLGGKILEFIRIPVVPPLPPLIGMLLAGFTIRNVPIIYEFVHIPTTWSSALRNTALTIILVRAGLGLDPQALKHLKGVCLRLSFGPCFLEACSAALFSHFIMNFPWQWGFLLGFVLGAVSPAVVVPNMLMLQENGYGVEKGIPTLLVAASSMDDIVAITGFNTFLSIVFSSGSVIS-NILSSLRDVLIGVLVGIVMGVFVQYFPSGDQERLTQRRAFLVLSMCISAVLGCQHIGLHGSGGLVTLVLSFMAAKRWAEE------KVGIQKIVANTWNVFQPLLFGLVGTEVSVESLESKTIGMCLATLGLALSVRILSTFVLMSFANFRFKEKVFIALSWIPKATVQAVLGPLALETA 506          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Mouse
Match: Slc9b2 (solute carrier family 9, subfamily B (NHA2, cation proton antiporter 2), member 2 [Source:MGI Symbol;Acc:MGI:2140077])

HSP 1 Score: 61.6178 bits (148), Expect = 7.298e-11
Identity = 42/97 (43.30%), Postives = 56/97 (57.73%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLGM------LIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAF 593
            GNL G+++L+     GG L   IKFP L  +      L+ GF LRN P IN ++ I   WS +LR++AL +IL+RAGLGLD K  +R      R A 
Sbjct:   21 GNLFGIIILFYCSITGGKLFGLIKFPTLPPLPPLLGMLLAGFLLRNIPVINDSVRIQHKWSSSLRSIALSVILVRAGLGLDSKFCRRCRVPSCRGAL 117          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Mouse
Match: Slc9b1 (solute carrier family 9, subfamily B (NHA1, cation proton antiporter 1), member 1 [Source:MGI Symbol;Acc:MGI:1921696])

HSP 1 Score: 58.9214 bits (141), Expect = 1.695e-10
Identity = 32/74 (43.24%), Postives = 48/74 (64.86%), Query Frame = 3
Query:  744 GLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDN 965
            G GV++GI TL++AA+S+DD++AITGF   L   FS    ++  ILS   + L G++ GI++G+   Y PS D 
Sbjct:    1 GYGVEKGIPTLLVAASSMDDIVAITGFNTFLSIVFSSGSVIS-NILSSLRDVLIGVLVGIVMGVFVQYFPSGDQ 73          
BLAST of Na_H_Exchanger domain-containing protein vs. UniProt/SwissProt
Match: sp|A4IHB9|SL9B2_XENTR (Sodium/hydrogen exchanger 9B2 OS=Xenopus tropicalis OX=8364 GN=slc9b2 PE=2 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 3.746e-88
Identity = 178/370 (48.11%), Postives = 239/370 (64.59%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLII------GFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            GNL G+L L     +GG LI  IK P L  +  +      GF +RN P I   + I+  WS  LRN+AL IIL+RAGLGLDPK L++L  V +RL+F PC++E+ T A+VSHF++G   +W FMLGF+L AVSPAVVVPS+L L+K+G GVD+GI TL++AA S DDVLAITGF  CLG +FS    L   I+ G LE + GI  G++ G    Y PS D +N    RS L+  LS+ ++FGS+ F  PG+G L  L +AF+ G GWS D      +  V  +  + W +FQP LFGLIGA + + S+    +G    TL+I ++ R+  SF  V  + F++KE++FI +AW+PKATVQAA+G VALD A
Sbjct:  121 GNLFGILALLFSAALGGKLISLIKIPSLPPLPPLLGMLLAGFLIRNIPVITDQVQIHHKWSAALRNIALAIILVRAGLGLDPKALRKLKAVCLRLSFGPCVVESCTAAVVSHFIMGFPLTWGFMLGFVLGAVSPAVVVPSMLILQKEGFGVDKGIPTLLMAAGSFDDVLAITGFNTCLGMAFSSGSTLN-TIVRGVLEVVVGIAAGLLFGFFLHYFPSKDQENLKGKRSYLILALSVFAVFGSLYFGFPGSGGLCTLVMAFLAGIGWSTD------KTVVEDIIAVSWDIFQPLLFGLIGAEISVASLKPETVGLCTATLIIALIIRICISFLMVCFSGFSLKEKIFISLAWMPKATVQAAIGSVALDTA 483          
BLAST of Na_H_Exchanger domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5BKR2|SL9B2_MOUSE (Sodium/hydrogen exchanger 9B2 OS=Mus musculus OX=10090 GN=Slc9b2 PE=1 SV=2)

HSP 1 Score: 285.419 bits (729), Expect = 1.933e-87
Identity = 174/377 (46.15%), Postives = 238/377 (63.13%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLII------GFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQ 1433
            GNL G+++L+     GG L   IKFP L  +  +      GF LRN P IN ++ I   WS +LR++AL +IL+RAGLGLD K L++L  V VRLA  PCI+EA   AI+SHFL+GL W W F+LGF++ AVSPAVVVPS+L L++ G GV +GI TL++AA S DD+LAITGF  CLG +FS    +   I  G LE + G+  G  LG    Y PS D DN ++ R+ L+   +++++F S+ F  PG+G L  L +AF+ G  W+       K++ V K+  + W +FQP LFGLIGA + I S+    +G  + TL I ++ R+L +F  V    F +KE++FI  AWLPKATVQAA+G VALD A  +   Q
Sbjct:  113 GNLFGIIILFYCSITGGKLFGLIKFPTLPPLPPLLGMLLAGFLLRNIPVINDSVRIQHKWSSSLRSIALSVILVRAGLGLDSKALRKLKGVCVRLAMGPCIVEACASAILSHFLMGLPWQWGFILGFVVGAVSPAVVVPSMLLLQEGGYGVGKGIPTLLMAAGSFDDILAITGFNTCLGVAFSTGSTV-FNIFRGILEVVIGVAAGSFLGFFIQYFPSRDQDNLVWKRAFLVLGFAVLAVFSSVYFSFPGSGGLCTLVMAFLAGMRWTD------KKSEVEKVIAVTWDVFQPLLFGLIGAEVSIVSLRAETVGLCVATLSIAVLIRILTTFLMVCFAGFNIKEKIFISFAWLPKATVQAAIGSVALDTARSHGEKQ 482          
BLAST of Na_H_Exchanger domain-containing protein vs. UniProt/SwissProt
Match: sp|Q86UD5|SL9B2_HUMAN (Sodium/hydrogen exchanger 9B2 OS=Homo sapiens OX=9606 GN=SLC9B2 PE=1 SV=2)

HSP 1 Score: 281.952 bits (720), Expect = 2.877e-86
Identity = 174/377 (46.15%), Postives = 241/377 (63.93%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILI------VYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQ 1433
            GNL G+++L+    IGG L+           P LLGML+ GF +RN P IN  + I   WS +LR++AL IIL+RAGLGLD K LK+L  V VRL+  PCI+EA T A+++H+L+GL W W F+LGF+L AVSPAVVVPS+L L+  G GV++G+ TL++AA S DD+LAITGF  CLG +FS    +   +L G LE + G+  G +LG    Y PS D D  +  R+ L+  LS++++F S+ F  PG+G L  L +AF+ G GW+ +      +  V K+  + W +FQP LFGLIGA + I S+    +G  + T+ I ++ R+L +F  V    F +KE++FI  AWLPKATVQAA+G VALD A  +   Q
Sbjct:  113 GNLFGIIILFYCAIIGGKLLGLIKLPTLPPLPSLLGMLLAGFLIRNIPVINDNVQIKHKWSSSLRSIALSIILVRAGLGLDSKALKKLKGVCVRLSMGPCIVEACTSALLAHYLLGLPWQWGFILGFVLGAVSPAVVVPSMLLLQGGGYGVEKGVPTLLMAAGSFDDILAITGFNTCLGIAFSTGSTV-FNVLRGVLEVVIGVATGSVLGFFIQYFPSRDQDKLVCKRTFLVLGLSVLAVFSSVHFGFPGSGGLCTLVMAFLAGMGWTSE------KAEVEKIIAVAWDIFQPLLFGLIGAEVSIASLRPETVGLCVATVGIAVLIRILTTFLMVCFAGFNLKEKIFISFAWLPKATVQAAIGSVALDTARSHGEKQ 482          
BLAST of Na_H_Exchanger domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5R6B8|SL9B2_PONAB (Sodium/hydrogen exchanger 9B2 OS=Pongo abelii OX=9601 GN=SLC9B2 PE=2 SV=1)

HSP 1 Score: 281.952 bits (720), Expect = 3.266e-86
Identity = 174/377 (46.15%), Postives = 241/377 (63.93%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILI------VYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQ 1433
            GNL G+++L+    IGG L+           P LLGML+ GF +RN P IN  + I   WS +LR++AL IIL+RAGLGLD K LK+L  V VRL+  PCI+EA T A+++H+L+GL W W F+LGF+L AVSPAVVVPS+L L+  G GV++G+ TL++AA S DD+LAITGF  CLG +FS    +   +L G LE + G+  G +LG    Y PS D D  +  R+ L+  LS++++F S+ F  PG+G L  L +AF+ G GW+ +      +  V K+  + W +FQP LFGLIGA + I S+    +G  + T+ I ++ R+L +F  V    F +KE++FI  AWLPKATVQAA+G VALD A  +   Q
Sbjct:  113 GNLFGIIILFYCAIIGGKLLGLIKLPTLPPLPSLLGMLLAGFLIRNIPVINDNVQIKHKWSSSLRSIALSIILVRAGLGLDSKALKKLKGVCVRLSMGPCIVEACTSALLAHYLLGLPWQWGFILGFVLGAVSPAVVVPSMLLLQGGGYGVEKGVPTLLMAAGSFDDILAITGFNTCLGIAFSTGSTV-FNVLRGVLEVVIGVATGSVLGFFIQYFPSCDQDKLVCKRTFLVLGLSVLAVFSSVHFGFPGSGGLCTLVMAFLAGMGWTSE------KAEVEKIIAVAWDIFQPLLFGLIGAEVSIASLRPETVGLCVATVGIAVLIRILTTFLMVCFAGFNLKEKIFISFAWLPKATVQAAIGSVALDTARSHGEKQ 482          
BLAST of Na_H_Exchanger domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4ZJI4|SL9B1_HUMAN (Sodium/hydrogen exchanger 9B1 OS=Homo sapiens OX=9606 GN=SLC9B1 PE=2 SV=2)

HSP 1 Score: 254.603 bits (649), Expect = 4.563e-76
Identity = 164/428 (38.32%), Postives = 245/428 (57.24%), Query Frame = 3
Query:  147 ITCPPRLFINVFLTVILCFITIGICLYSFDPKDFDIVNCTSRLSQNTTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLII------GFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            I+CP R  +NV        IT G+ L+        ++ C       T  I  +     GNL GL +++    IGG ++  I+ P +  +  +      GF +RN P+IN  + +   WS  LR++AL IILIRAGLGLDP+ L+ L  V  RLA  PC++EA   A+ SHF++   W WAF+LGF+L AVSPAVVVP ++ L++ G GV++GI TL++AA+S+DD+LAITGF  CL   FS    L   I S        ++ GI+LG    Y PS D       R  L+  + + ++ GS    + G+G L  L L+F+ G  WS++      +  V K+   +W +FQP LFGL+GA + ++S+  + +G  + TL + +  R+L ++  +    F+ KE++FI +AW+PKATVQA LGP+AL+ A
Sbjct:   56 ISCPLRGVLNVI-------ITNGVILF--------VIWCM------TWSILGSEALPGGNLFGLFIIFYSAIIGGKILQLIRIPLVPPLPPLLGMLLAGFTIRNVPFINEHVHVPNTWSSILRSIALTIILIRAGLGLDPQALRHLKVVCFRLAVGPCLMEASAAAVFSHFIMKFPWQWAFLLGFVLGAVSPAVVVPYMMVLQENGYGVEEGIPTLLMAASSMDDILAITGFNTCLSIVFSSGGILNNAIAS-IRNVCISLLAGIVLGFFVRYFPSEDQKKLTLKRGFLVLTMCVSAVLGSQRIGLHGSGGLCTLVLSFIAGTKWSQE------KMKVQKIITTVWDIFQPLLFGLVGAEVSVSSLESNIVGISVATLSLALCVRILTTYLLMCFAGFSFKEKIFIALAWMPKATVQAVLGPLALETA 455          
BLAST of Na_H_Exchanger domain-containing protein vs. TrEMBL
Match: A0A2C9K2F1 (Na_H_Exchanger domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106078694 PE=4 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 1.237e-113
Identity = 197/378 (52.12%), Postives = 262/378 (69.31%), Query Frame = 3
Query:  294 IANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDW-NGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNN 1424
            +        GNL  LLVL++ C  GG +   I+ PPLLGMLI+G  L N PYIN+A  I+  W   LR +AL +IL RAGLGLDPK LKRLSFVV+RLAF PC+ EA  +AI SH ++G  W W FMLGF++SAVSPAV+VPSVL L ++  G+++GI TLVIAA+S+DD+LAITGFG+ LG +FS   ++   +  GPLE L+G+ +GI+ G++ WYIP   +   + +RSVLL  + ++++FGSI     GAG L  LT+ FV    W   S+W    +NPV ++  +LW +FQPFLFGLIG+ +D+  +++  +G GI  L+IG+VFR+  SF SVF T    KERLF+ +AWLPKATVQAA+G VA DLA KNN
Sbjct:  105 VTGEEALPGGNLFALLVLFVACWSGGYVARLIRLPPLLGMLIVGGVLGNVPYINLARDIHSSWVFTLRQIALTVILTRAGLGLDPKALKRLSFVVLRLAFLPCLTEATVDAIASHLILGFPWQWGFMLGFVISAVSPAVIVPSVLSLGERCYGIEKGIPTLVIAASSVDDILAITGFGVLLGITFSTG-DIVWTLFKGPLEVLSGVTYGIVGGVILWYIPQKTSKLQLLFRSVLLMFMGLMAIFGSIKLHWSGAGPLAALTVPFVAAVRWR--SEWKESSKNPVEEVLGVLWMIFQPFLFGLIGSEVDVMKLDYDVIGLGIAVLVIGLVFRISVSFLSVFFTNLNYKERLFVAMAWLPKATVQAAIGTVAFDLAKKNN 479          
BLAST of Na_H_Exchanger domain-containing protein vs. TrEMBL
Match: V3ZDI2 (Na_H_Exchanger domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_210172 PE=4 SV=1)

HSP 1 Score: 351.673 bits (901), Expect = 1.211e-110
Identity = 201/368 (54.62%), Postives = 251/368 (68.21%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNN 1424
            GNL  L  L+I C  GG L   I  P LLGMLI+G  L N PYINVA  I+ LWS   R +AL +ILIRAGLGLDPK LK+LSFVV+RLAF+PC++E +T+ +VSHFL+GL W +A MLGF+L+AVSPAVVVPS+L L  +G GVD+GI TLVIAAAS+DDVLAITGFG+ +G +FS   NL   +  GPLEAL GI +G+I GI+ W+IP   + N    R  LL +  +  +FGS A    GAG LG LT+ FV  F W ++      R+P+     +LW +FQP LFGLIGA + I  I    +G GI TL IG+  R++ SF +V  T+  +KE+ FIP AWLPKATVQAA+G VALD A   N
Sbjct:   80 GNLFALCTLFIACWCGGYLFNLINLPSLLGMLIVGGMLGNVPYINVARDIHTLWSIGARQIALAVILIRAGLGLDPKALKKLSFVVIRLAFSPCLMETLTDGLVSHFLLGLPWEFALMLGFVLAAVSPAVVVPSLLNLSDRGYGVDKGIPTLVIAAASVDDVLAITGFGVLIGIAFSSG-NLVWTLFKGPLEALIGICYGVIAGIILWFIPQKSSKNLHLLRCTLLMVGGLFVLFGSRAAGYAGAGPLGCLTMPFVAAFKWRQE------RDPIESAVGVLWMIFQPLLFGLIGAQVKIEEIEIQTVGLGIATLFIGLAIRMVTSFVAVQRTELNLKEKFFIPFAWLPKATVQAAIGGVALDTATHLN 440          
BLAST of Na_H_Exchanger domain-containing protein vs. TrEMBL
Match: A0A1S3HIN3 (uncharacterized protein LOC106154882 OS=Lingula unguis OX=7574 GN=LOC106154882 PE=4 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 2.717e-110
Identity = 203/430 (47.21%), Postives = 279/430 (64.88%), Query Frame = 3
Query:  135 MKIKITCPPRLFINVFLTVILCFITIGICLYSFDPKDFDIVNCTSRLSQNTTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNN 1424
            M+  + CPP   +   +T  L  I +   L++                     I  +     GN  GL+VL++ C +GG L+  I+ PPLLGMLI+G  LRN PYI+VA  I K WS ++R++AL++ILI+A LGLDPK L+RLS VV RLAF PC  EA++ A+  HFL+G  W W+FMLGF++SAVSPAVVVPS+L L+++GLGVD+GI T  +A+ S+++V+AI+ FG+ LG +FS   +LA  I+ GPLEAL G+++G+I G++ WY+P   +   + +R+ L+    + ++FGS A K PGAGALG LT+AFV   GW +   W    NPV K    +W +FQP LFGLIGA +DI  +N   +G G+  L IG+  R +    +V  T F  KERLF+PIAWLPKATVQAA+G VALD A +NN
Sbjct:  133 MRHALMCPPHGKLGRVVTSKLTLILLWAVLWA---------------------ITRDEALPGGNFFGLIVLFLACKLGGFLVSKIRLPPLLGMLIVGCLLRNVPYIDVAKDIKKEWSSSIRSIALVVILIKAALGLDPKALRRLSHVVARLAFIPCAFEAVSGAVSGHFLLGFPWDWSFMLGFVMSAVSPAVVVPSMLHLQEQGLGVDKGIPTAAVASGSVENVVAISAFGVVLGIAFSKG-DLAFSIIRGPLEALTGVIYGVIGGLMCWYLPHIKHRRQVSFRTFLVTSGGLFALFGSGAAKFPGAGALGCLTMAFVASLGWRRQG-WTSS-NPVAKSIGKMWLIFQPLLFGLIGAEIDITKLNGGTVGIGMGVLGIGLAVRFVGCVLAVVRTDFNFKERLFVPIAWLPKATVQAAIGSVALDTARRNN 538          

HSP 2 Score: 120.939 bits (302), Expect = 1.136e-24
Identity = 71/182 (39.01%), Postives = 106/182 (58.24%), Query Frame = 3
Query:  135 MKIKITCPPRLFINVFLTVILCFITIGICLYSFDPKDFDIVNCTSRLSQNTTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLG 680
            +K  + CPP      +LT+I+  + +   L++                     I  +N    GNL GLL+L I   +GG +   I+ P LLGML++G AL+N PYI+ A  I++ WS  +R++AL +IL++A LGLD + L++ S  V++LAF PC+ EAI EA  +HFL+G  W W+FMLG
Sbjct:  856 LKYALMCPPHGHTGRYLTLIVSVLLLWGVLWA---------------------ITGDNALPGGNLFGLLILLICAQLGGNVAELIRLPSLLGMLLVGVALKNIPYISFARDIDRHWSVAIRSIALAVILLKAALGLDSRALRKSSASVLKLAFLPCLAEAIIEATAAHFLLGFPWDWSFMLG 1016          
BLAST of Na_H_Exchanger domain-containing protein vs. TrEMBL
Match: A0A2R2MLF0 (sodium/hydrogen exchanger 9B2 OS=Lingula unguis OX=7574 GN=LOC106152153 PE=4 SV=1)

HSP 1 Score: 360.147 bits (923), Expect = 5.687e-110
Identity = 208/368 (56.52%), Postives = 273/368 (74.18%), Query Frame = 3
Query:  318 KGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKN 1421
            KGN+ GL+VL + C + G  +  I  P LLGML+IGFAL+NTPYI+VA  IN+ WS  LR+MAL++IL+RAGLGLDP+ L++LS VV+RLAFTPC++EA T A  +H L+G    W FMLGF+L AV+PAVVVPS+L L++KG G D+GI TLV+AAASIDDVLAIT FG+ LG +FS   ++A+ I+ GPLEA+ G+++G+I GI+ WY P   + +  FYR++LL L  + ++FGS + ++PGAGALG LT+ FV    W K+  W     PVTK    LW LFQP LFGLIGA ++I+S+  + +G G+ TL IG+  R++ASF  VFGT+F  KER FIP AWLPKATVQAA+GPVALD A +N
Sbjct:  148 KGNIFGLVVLVVCCLLAGAAVELIHLPALLGMLVIGFALKNTPYIDVAKNINQEWSAVLRSMALVVILLRAGLGLDPQALRKLSCVVIRLAFTPCMVEAATVAAATHLLLGFPVEWGFMLGFVLGAVTPAVVVPSMLSLQEKGYGGDKGITTLVVAAASIDDVLAITAFGVLLGIAFSTG-DIAVTIVRGPLEAVLGVVYGVIAGIIVWYFPHKKHKHLKFYRTLLLLLGGLFAVFGSNSAQLPGAGALGCLTMPFVAALRWRKEG-WVEDNCPVTKNLGRLWVLFQPLLFGLIGAEIEISSLQANTVGLGVATLCIGLFTRMVASFLVVFGTEFNWKERFFIPFAWLPKATVQAAIGPVALDTARRN 513          

HSP 2 Score: 170.244 bits (430), Expect = 7.003e-41
Identity = 87/160 (54.37%), Postives = 110/160 (68.75%), Query Frame = 3
Query:  942 WYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKN 1421
            WY P   + +  FYR++LL L  + ++FGS + ++PGAGALG LT+ FV    W K+  W     PVTK    LW LFQP LFGLIGA +DI+S+  S +G G+ TL IG+  R++ASF  VFGT+F  KER FIP AWLPKATVQAA+GPVALD A +N
Sbjct:  664 WYFPHKKHKHLKFYRTLLLLLGGLFAVFGSNSAQLPGAGALGCLTMPFVAALRWRKEG-WVEDNCPVTKHLGRLWVLFQPLLFGLIGAEIDISSLQASTVGLGVATLCIGLFTRMVASFLVVFGTEFNWKERFFIPFAWLPKATVQAAIGPVALDTARRN 822          
BLAST of Na_H_Exchanger domain-containing protein vs. TrEMBL
Match: A0A1S3IET7 (sodium/hydrogen exchanger 9B2 OS=Lingula unguis OX=7574 GN=LOC106163637 PE=4 SV=1)

HSP 1 Score: 347.821 bits (891), Expect = 4.480e-108
Identity = 191/441 (43.31%), Postives = 276/441 (62.59%), Query Frame = 3
Query:  129 NIMKIKITCPPRLFINVFLTVILCFITIGICLYSFDPKDFDIVNCTSRLSQNTTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQHIIDQG 1451
            + +K    CPP   +     ++   + +  CL++                     +        GN   +LVL I CTIGG +    + PPL GML+IGF LRN PYI++A  I   W+ +LR+ AL+++L+RAG+GLDP  LKRLS VV+R A  PC +EA   A+ SH+L+   W W FML F+L+AVSPAVVVPS+L ++++ LG+D+GI TL IAA SI+ V+AI+ FG+ LG +FS  + LAL I+ GPLEAL G+++GI+LG++ WY+P   + + +F+R+ L++  S+ + FGS A K+ GAGALG L +AFV   GW +   W+  +NPV  +    W +FQP LFGL+GA + +  +    +G G+  L IG+  RL+ SFF+VFGT   MKE++F+ I+W PKA+VQAA+GPVA D A   N    ++  G
Sbjct:  142 DKLKHAFLCPPHGLVAKMAVLVTSAVMLWACLWA---------------------VTGKEALPGGNFFSILVLLICCTIGGYVSQLCRLPPLFGMLVIGFCLRNIPYIDIAKHIQPAWASSLRSAALVVLLVRAGIGLDPVALKRLSCVVIRFAAIPCFVEAAAVAVPSHWLLNFGWDWCFMLAFVLAAVSPAVVVPSMLHVQEERLGLDKGIPTLAIAACSINAVIAISAFGVFLGIAFSTGE-LALTIVRGPLEALLGVVYGIVLGVLLWYVPHRHSKSIVFFRTFLVFGGSLFAYFGSKAAKLSGAGALGSLAIAFVAAQGWRRQG-WSNDKNPVGAVMAKFWIIFQPLLFGLMGAEVKVEDLQGGNIGMGLAVLFIGLFLRLVVSFFTVFGTDLNMKEKIFMAISWFPKASVQAAIGPVAYDTAKAYNAGPEVLALG 559          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Cavefish
Match: si:dkey-162b23.4 (sodium/hydrogen exchanger 9B2 [Source:NCBI gene;Acc:103047018])

HSP 1 Score: 273.863 bits (699), Expect = 7.747e-84
Identity = 168/377 (44.56%), Postives = 234/377 (62.07%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLII------GFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQ 1433
            GNL G++ +++     G L+  I+ P L  +  +      G  LRN P +  A++I+  WS +LRN+AL +IL+RAGLGLD   LK+L  V  R+A  PC+IEA T A++S+ L+GL W W F+LGF+L AVSPAV+VPS+L L+K+G G +QGI +L++AA S DD+LAITGF  CLG +F+        +L G LE L G+  G+  G    Y PS D  +    RS LL  L++ ++FGS     PG+G L  L LA + G GW K       + PV ++   +W +FQP LFGLIGA + I++++ +++G GI TLLI I  R+  +F  V    F  KE+LFI +AWLPKATVQAA+G  ALD+A      Q
Sbjct:  125 GNLFGIVSVFLCALTAGKLVELIRLPNLPPVPPLLGMLLAGVLLRNIPVVTEAVYIDYRWSASLRNIALAVILVRAGLGLDAAALKKLKAVCARVAIMPCVIEASTVALISYCLMGLPWIWGFILGFVLGAVSPAVLVPSMLLLQKQGYGAEQGIPSLLMAACSFDDILAITGFTTCLGIAFATGSTW-FNVLRGGLEVLGGMAAGVAFGFFLRYFPSRDQKDLPLKRSFLLLGLAVFAVFGSNVAGFPGSGGLCTLILALIAGMGWRK------AKVPVEEIVGQVWDVFQPLLFGLIGAEITISTLDPNSVGLGIATLLICITVRVFVTFVMVLCAGFNKKEKLFISLAWLPKATVQAAIGSTALDVARSKQDSQ 494          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000046911.1 (sodium/hydrogen exchanger 9B2-like [Source:NCBI gene;Acc:103038743])

HSP 1 Score: 246.514 bits (628), Expect = 2.470e-74
Identity = 171/369 (46.34%), Postives = 240/369 (65.04%), Query Frame = 3
Query:  324 NLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFAL------RNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            NL GL+VL++    GG L+  I+ P L  +  +   L      RN PY++ A++I++ WS  LR++AL IIL RAGLGL+P  L+RL  V VR+A  PC  EA T A++SHFL+GL W W F+LGF+L+AVSPAVVVPS+L L++ G GV +GI TL++AA S DD+LAITGF  CLG +F       L +  G LE + GI+ G +LGI+  + PS D ++ +  RS LL  LS+ S+F S    + GAG L  L L+F+ G        W+ K+ PV  +    W +FQP LFGLIGA + I++++ + +G G+  L +G+V R+L +F +V    F +KE++FI +AWLPKATVQAA+G  ALD+A
Sbjct:   51 NLFGLVVLFLSAVCGGKLVGMIQLPTLPPLPPLLGMLLMGLVLRNVPYVSEAVYIDQKWSSALRSVALAIILTRAGLGLNPAALRRLKAVCVRVAVGPCTTEACTVAVISHFLMGLPWIWGFILGFVLAAVSPAVVVPSMLLLQQSGYGVQKGIPTLLMAAGSFDDILAITGFTTCLGMAFGTGSTW-LSLGKGVLEVVVGIVAGGVLGILLHFFPSDDQEDLVLRRSSLLLGLSVFSVFASHTAGLGGAGGLCTLVLSFIAGL------SWDTKKAPVAAVVGRFWDVFQPMLFGLIGAEITISTLSPNTVGLGLAALCVGVVIRVLVTFAAVLFAGFNLKEKIFISLAWLPKATVQAAIGSTALDMA 412          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000004545.2 (sodium/hydrogen exchanger 9B2-like [Source:NCBI gene;Acc:103038743])

HSP 1 Score: 233.032 bits (593), Expect = 2.731e-69
Identity = 170/369 (46.07%), Postives = 238/369 (64.50%), Query Frame = 3
Query:  324 NLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFAL------RNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            NL GL+VL++    GG L+  I+ P L  +  +   L      RN PY++ A++I++ WS  LR++AL IIL RAGLGL+P  L+RL  V VR+A  PC  EA T A++SHFL+GL W W F+LGF+L+AVSPAVVVPS+L L++ G GV +GI TL++AA S DD+LAITGF  CLG +F       L +  G LE + GI+ G +LGI+  + PS D D  +  RS LL  LS+ S+F S    + GAG L  L L+F+ G        W+ K+  +  +    W +FQP LFGLIGA + I++++ + +G G+  L +G+V R+L +F +V    F +KE++FI +AWLPKATVQAA+G  ALD+A
Sbjct:   41 NLFGLVVLFLSAVCGGKLVGMIQLPTLPPLPPLLGMLLMGLVLRNVPYVSEAVYIDQKWSSALRSVALAIILTRAGLGLNPA-LRRLKAVCVRVAVGPCTTEACTVAVISHFLMGLPWIWGFILGFVLAAVSPAVVVPSMLLLQQSGYGVQKGIPTLLMAAGSFDDILAITGFTTCLGMAFGTGSTW-LSLGKGVLEVVVGIVAGGVLGILLHFFPSDDQDLVL-RRSSLLLGLSVFSVFASHTAGLGGAGGLCTLVLSFIAGL------SWDTKKVKIAAVVGRFWDVFQPMLFGLIGAEITISTLSPNTVGLGLAALCVGVVIRVLVTFAAVLFAGFNLKEKIFISLAWLPKATVQAAIGSTALDMA 400          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Nematostella
Match: EDO30249 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1B1])

HSP 1 Score: 287.345 bits (734), Expect = 1.655e-90
Identity = 175/380 (46.05%), Postives = 249/380 (65.53%), Query Frame = 3
Query:  294 IANNNKCDKGNLLGLLVLYIGCTIGGILIVYIK---FPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNN 1424
            I  +     GNL G+ ++ +    GG +   +     P LLGMLI+GF LRN P I+VA  I+K WS  L ++AL++IL R+GL LDP  L+RL F  VRLAF PCI EA+T A+V  +++ + W W F LGF+L AVSPAVVVP +L L+ KG GV+QGI TLV+AA+S DDVLAI+ FG+ +G +FS   NL   I  GP+E + GI+ GI++G+V WY+P++   N +  R VLL   +++S+FG  A +  GAGALGVL++A + G GW  D     ++  V++   +LW  FQP LFGLIGA +    ++ S +G  I  L IG++ R++ +   + G   T+KE++F+ IAWLPKATVQAA+G ++LD+A +  
Sbjct:   35 ITGHEMLPGGNLFGIFIILVCAAFGGFITTRVSCGVLPSLLGMLIVGFLLRNVPGIDVAKHIDKKWSATLGSIALVVILARSGLELDPGALRRLKFTCVRLAFGPCITEAVTVAVVVRYVLDMPWLWGFQLGFVLGAVSPAVVVPQLLVLQAKGYGVEQGIPTLVMAASSCDDVLAISLFGVFVGIAFSKG-NLYFNIFRGPIELIMGIVIGILVGVVCWYLPNNQETNRLGNRFVLLAAFALLSVFGCNAAEFSGAGALGVLSMATIAGHGWGDD-----EKVAVSRAMAVLWEFFQPLLFGLIGAEVTWQYMDVSLVGRCIGALCIGLLVRMMITGVLMAGNNLTLKEKVFVAIAWLPKATVQAAIGSMSLDIARERG 408          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Nematostella
Match: EDO43896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX30])

HSP 1 Score: 273.863 bits (699), Expect = 7.702e-86
Identity = 159/367 (43.32%), Postives = 239/367 (65.12%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIV---YIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLA 1412
            GN+  + V+ I  +  G+L+    Y++ PPLLGML+ G  LRN PYI+ A  I+K WS  LR++AL +IL+R+GLGL+  VL++  F V+RLAF PC  E +T A+++ +++G+ W WAF LGF+ +AVS AVV+P++LE ++K  G ++GI TLV+AAAS D+VL I+GFG+C+G SF    NL   I   P+E L G+ FG+ +G + W+ P+   +     R ++L   S++++FGS A +  GAGAL  L ++ +  +GW K       + P+ + T LLW  F+P LFGL+GA + I+ ++   +G GI  L   +V R L ++ +V       KE++FI IAWLPKATVQAA+G ++LD A
Sbjct:   49 GNIFAIFVVIICASFFGMLVKLVPYLQLPPLLGMLVAGLVLRNVPYIDFAKHIDKKWSSTLRSIALAVILVRSGLGLNTDVLQKCKFTVMRLAFIPCTFEVVTAAVMASYILGMKWQWAFQLGFVQAAVSLAVVIPALLEFQEKFYGTNKGIPTLVMAAASFDNVLCISGFGVCIGLSFHSG-NLVFNIFRAPIEVLIGLAFGVFMGFLCWWFPNKTEERVSRSRFLILLGGSMLAVFGSKAAQFAGAGALAALIMSTLAAYGWGKQG-----KAPIAQATALLWMFFEPLLFGLVGAEVSIDYLDKRLVGIGIGILASSLVVRTLITYLTVTQNNLNRKEKMFIAIAWLPKATVQAAIGSISLDTA 409          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Nematostella
Match: EDO42678 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S114])

HSP 1 Score: 240.736 bits (613), Expect = 2.984e-74
Identity = 151/320 (47.19%), Postives = 210/320 (65.62%), Query Frame = 3
Query:  294 IANNNKCDKGNLLGLLVLYIGCTIGGILIVYIK---FPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALG 1244
            I  +     GNL G+ ++ +    GG +   +     P LLGMLI+GF LRN P I+VA  I+K WS  LR++AL++IL R+GL LDP  L+RL F  VRLAF PCI EA+T A+V  +++ + W W F LGF+LSAVSPAVVVP +L L+ KG GV+QGI TLV+AA+S DDVLAI+ FG+ +G +FS   NL   I  GP+E + GI+ GI++G+V WY+P++   N +  R VLL   +++S+FG  A +  GAGALGVL++A + G GW  D     ++  V++   +LW  FQP LFGLIGA +    ++ S +G
Sbjct:   26 ITGHEMLPGGNLFGIFIILMCAAFGGFITTRVSCGVLPSLLGMLIVGFLLRNVPGIDVAKHIDKKWSATLRSIALVVILARSGLELDPGALRRLKFTCVRLAFGPCITEAVTVAVVVRYVLDMPWLWGFQLGFVLSAVSPAVVVPQLLVLQAKGYGVEQGIPTLVMAASSCDDVLAISLFGVFVGIAFSKG-NLYFNIFRGPIELIMGIVIGILVGVVCWYLPNNQETNRLGNRFVLLAAFALLSVFGCNAAEFSGAGALGVLSMATIAGHGWGDD-----EKAAVSRAMAVLWEFFQPLLFGLIGAEVTWEYMDVSLVG 339          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Nematostella
Match: EDO30251 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1B5])

HSP 1 Score: 235.343 bits (599), Expect = 2.375e-72
Identity = 148/320 (46.25%), Postives = 208/320 (65.00%), Query Frame = 3
Query:  294 IANNNKCDKGNLLGLLVLYIGCTIGGILIVYIK---FPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALG 1244
            I  +     GNL G+ ++ +    GG +   +     P LLGMLI+GF L+N P I+VA  I+K WS  LR++AL++IL R+GL LDP  L+RL F  VRLAF PCI EA+T A+V  +++ + W W F LGF+L+AVSPAVVVP +L L+ KG GV+ GI TLV+AA+S DDVLAI+ FG  +G +FS   NL   I  GP+E + GI+ GI++G+V WY+P++   N +  R VLL   +++S+FG  A +  GAGALGVL++A + G GW  D     ++  V++   +LW  FQP LFGLIGA +    ++ S +G
Sbjct:   13 ITGHEMLPCGNLFGIFIILVCAAFGGFITTRVSCGVLPSLLGMLIVGFLLKNAPGIDVAKHIDKKWSATLRSIALVVILARSGLELDPGALRRLKFTCVRLAFGPCITEAVTVAVVVRYVLDMPWLWGFQLGFVLAAVSPAVVVPQLLVLQAKGYGVEHGIPTLVMAASSCDDVLAISLFGEFVGIAFSKG-NLYFNIFRGPIELIMGIVIGILVGVVCWYLPNNQETNRLGNRFVLLVAFALLSVFGCNAAEFSGAGALGVLSMATIAGHGWGDD-----EKVAVSRAMAVLWEFFQPLLFGLIGAEVTWQYMDVSLVG 326          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000034921.1 (sodium/hydrogen exchanger 9B2-like [Source:NCBI gene;Acc:101155059])

HSP 1 Score: 271.552 bits (693), Expect = 1.039e-83
Identity = 172/374 (45.99%), Postives = 242/374 (64.71%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFAL------RNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNN 1424
            GNL G+++L+I   +GG L+  I+ P L     +   L      RN PYI  A+FI+  WS  LRN+AL +IL RAGLGLDP  L+RL  V VR+A  PC +EA   A+VSHFL+GL W+WAF+LGF+LSAVSPAVVVPS+L L+++GLGV++GI TL++AA S+D +LAITGF  CLG +FS      + IL G LE + G++ G+++G      PS+D ++ +  R+++L  LS+ S+F S      GAG+L  L  +F    GW  +      + PV  +    W LFQP LFGLIGA + I++++ S +G G+  + +G++ RL  +F  V    F +KE+LFI +AWLPKATVQAA+G  ALD+A +  
Sbjct:   61 GNLFGIIILFICSVLGGKLVGMIQLPTLPPFPPLLGMLLAGLLLRNVPYITTAVFIDTRWSAALRNIALSVILTRAGLGLDPSALQRLKAVCVRVAVGPCTVEASVVAVVSHFLLGLPWTWAFILGFVLSAVSPAVVVPSMLLLQREGLGVEKGIPTLLMAAGSLDGILAITGFSTCLGIAFSTGSTW-MTILQGLLEVVGGVISGLVVGFFLCLFPSNDQEDLVLGRTLMLLGLSVFSVFFSHVVGFSGAGSLCTLVHSFCAALGWKSE------KAPVAAMVGRSWDLFQPLLFGLIGAEITISTLSPSTVGLGVACISLGLLVRLFVTFLLVHHAGFNLKEKLFIAVAWLPKATVQAAIGSKALDMAREEG 427          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Medaka
Match: si:dkey-162b23.4 (sodium/hydrogen exchanger 9B2 [Source:NCBI gene;Acc:101158668])

HSP 1 Score: 273.092 bits (697), Expect = 1.837e-83
Identity = 179/383 (46.74%), Postives = 247/383 (64.49%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLG------MLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQHIIDQG 1451
            GNL G+ VL+I   +GG L+  I+ P L        ML++G  LRN P +  A+ I+  WSG+LRN+AL +IL RAGLGLDPK LK+L  V VR+A  PC++EA T A+VSHFL+GL W W F+LGF+L+AVSPAVVVPS+L L+K+G GV++GI TL++AA S DD+LAITGF  CLG +F+        +L G LE   G + GI+LGI+  Y PS D    +  RS L+  LS+ ++FGS     PG+G L  L LAF+          W  ++  V ++    W +FQP LFGLIGA + ++ +   A+G GI +LLI ++ R+L ++  V    F  +E++FI +AW+PKATVQAA+G  ALD+A + N   H+I  G
Sbjct:  139 GNLFGITVLFICAVVGGKLVTLIRLPKLPPFPPLLGMLLMGLTLRNIPVVTDAMHIDFRWSGSLRNIALAVILARAGLGLDPKALKKLKAVCVRVAAGPCLVEACTTALVSHFLMGLPWVWGFILGFVLAAVSPAVVVPSMLLLQKQGYGVEKGIPTLLMAAGSFDDILAITGFTTCLGMAFATGST-GYNLLRGVLEVTGGTVAGILLGILIQYFPSVDQKYVVMKRSFLVLGLSVFAVFGSDVAGFPGSGGLCTLLLAFLA------GLGWGAEKARVEEVVGWAWDVFQPLLFGLIGAEIRLSELEGHAVGLGIASLLIALLVRVLFTYVCVLFADFNTREKVFIALAWIPKATVQAAIGSKALDMA-RVNGDSHLIQNG 513          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000040276.1 (sodium/hydrogen exchanger 9B2-like [Source:NCBI gene;Acc:101155059])

HSP 1 Score: 270.396 bits (690), Expect = 2.273e-83
Identity = 173/383 (45.17%), Postives = 243/383 (63.45%), Query Frame = 3
Query:  294 IANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFAL------RNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNN 1424
            I        GNL G+++L+I   +GG L+  I+ P L     +   L      RN PYI  A+FI+  WS  LRN+AL +IL RAGLGLDP  L+RL  V VR+A  PC +EA   A+VSHFL+GL W+WAF+LGF+LSAVSPAVVVPS+L L+++GLGV++GI TL++AA S+D +LAITGF  CLG +FS      + IL G LE + G++ G+++G      PS+D ++ +  R+++L  LS+ S+F S      GAG+L  L  +F    GW  +      + PV  +    W LFQP LFGLIGA + I++++ S +G G+  + +G++ RL  +F  V    F +KE+LFI +AWLPKATVQAA+G  ALD+A +  
Sbjct:   43 ITGRECLPGGNLFGIIILFICSVLGGKLVGMIQLPTLPPFPPLLGMLLAGLLLRNVPYITTAVFIDTRWSAALRNIALSVILTRAGLGLDPSALQRLKAVCVRVAVGPCTVEASVVAVVSHFLLGLPWTWAFILGFVLSAVSPAVVVPSMLLLQREGLGVEKGIPTLLMAAGSLDGILAITGFSTCLGIAFSTGSTW-MTILQGLLEVVGGVISGLVVGFFLCLFPSNDQEDLVLGRTLMLLGLSVFSVFFSHVVGFSGAGSLCTLVHSFCAALGWKSE------KAPVAAMVGRSWDLFQPLLFGLIGAEITISTLSPSTVGLGVACISLGLLVRLFVTFLLVHHAGFNLKEKLFIAVAWLPKATVQAAIGSKALDMAREEG 418          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Medaka
Match: si:dkey-162b23.4 (sodium/hydrogen exchanger 9B2 [Source:NCBI gene;Acc:101158668])

HSP 1 Score: 273.092 bits (697), Expect = 2.392e-83
Identity = 179/383 (46.74%), Postives = 247/383 (64.49%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLG------MLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQHIIDQG 1451
            GNL G+ VL+I   +GG L+  I+ P L        ML++G  LRN P +  A+ I+  WSG+LRN+AL +IL RAGLGLDPK LK+L  V VR+A  PC++EA T A+VSHFL+GL W W F+LGF+L+AVSPAVVVPS+L L+K+G GV++GI TL++AA S DD+LAITGF  CLG +F+        +L G LE   G + GI+LGI+  Y PS D    +  RS L+  LS+ ++FGS     PG+G L  L LAF+          W  ++  V ++    W +FQP LFGLIGA + ++ +   A+G GI +LLI ++ R+L ++  V    F  +E++FI +AW+PKATVQAA+G  ALD+A + N   H+I  G
Sbjct:  139 GNLFGITVLFICAVVGGKLVTLIRLPKLPPFPPLLGMLLMGLTLRNIPVVTDAMHIDFRWSGSLRNIALAVILARAGLGLDPKALKKLKAVCVRVAAGPCLVEACTTALVSHFLMGLPWVWGFILGFVLAAVSPAVVVPSMLLLQKQGYGVEKGIPTLLMAAGSFDDILAITGFTTCLGMAFATGST-GYNLLRGVLEVTGGTVAGILLGILIQYFPSVDQKYVVMKRSFLVLGLSVFAVFGSDVAGFPGSGGLCTLLLAFLA------GLGWGAEKARVEEVVGWAWDVFQPLLFGLIGAEIRLSELEGHAVGLGIASLLIALLVRVLFTYVCVLFADFNTREKVFIALAWIPKATVQAAIGSKALDMA-RVNGDSHLIQNG 513          
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Medaka
Match: si:dkey-162b23.4 (sodium/hydrogen exchanger 9B2 [Source:NCBI gene;Acc:101158668])

HSP 1 Score: 273.092 bits (697), Expect = 2.392e-83
Identity = 179/383 (46.74%), Postives = 247/383 (64.49%), Query Frame = 3
Query:  321 GNLLGLLVLYIGCTIGGILIVYIKFPPLLG------MLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQHIIDQG 1451
            GNL G+ VL+I   +GG L+  I+ P L        ML++G  LRN P +  A+ I+  WSG+LRN+AL +IL RAGLGLDPK LK+L  V VR+A  PC++EA T A+VSHFL+GL W W F+LGF+L+AVSPAVVVPS+L L+K+G GV++GI TL++AA S DD+LAITGF  CLG +F+        +L G LE   G + GI+LGI+  Y PS D    +  RS L+  LS+ ++FGS     PG+G L  L LAF+          W  ++  V ++    W +FQP LFGLIGA + ++ +   A+G GI +LLI ++ R+L ++  V    F  +E++FI +AW+PKATVQAA+G  ALD+A + N   H+I  G
Sbjct:  139 GNLFGITVLFICAVVGGKLVTLIRLPKLPPFPPLLGMLLMGLTLRNIPVVTDAMHIDFRWSGSLRNIALAVILARAGLGLDPKALKKLKAVCVRVAAGPCLVEACTTALVSHFLMGLPWVWGFILGFVLAAVSPAVVVPSMLLLQKQGYGVEKGIPTLLMAAGSFDDILAITGFTTCLGMAFATGST-GYNLLRGVLEVTGGTVAGILLGILIQYFPSVDQKYVVMKRSFLVLGLSVFAVFGSDVAGFPGSGGLCTLLLAFLA------GLGWGAEKARVEEVVGWAWDVFQPLLFGLIGAEIRLSELEGHAVGLGIASLLIALLVRVLFTYVCVLFADFNTREKVFIALAWIPKATVQAAIGSKALDMA-RVNGDSHLIQNG 513          
BLAST of Na_H_Exchanger domain-containing protein vs. Planmine SMEST
Match: SMESG000005979.1 (SMESG000005979.1)

HSP 1 Score: 864.374 bits (2232), Expect = 0.000e+0
Identity = 499/501 (99.60%), Postives = 500/501 (99.80%), Query Frame = 3
Query:  135 MKIKITCPPRLFINVFLTVILCFITIGICLYSFDPKDFDIVNCTSRLSQNTTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFIXXXXXXXXXXXXXXXXXKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQHIIDQGDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNEADVVKLKTIATSETKFSSTDEK 1637
            MKIKITCPPRLFINVFLTVILCFITIGICLYSFDPKDFDIVNCTSRLSQNTTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFILSAVSPAVVVPSVLELEKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPS DNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFV+GFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQHIIDQGDLILAIAAMAILITAPIGAALISLLAPLLLQKSLKSSLNEADVVKLKTIATSETKFSSTDEK
Sbjct:    1 MKIKITCPPRLFINVFLTVILCFITIGICLYSFDPKDFDIVNCTSRLSQNTTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFALRNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVRLAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFILSAVSPAVVVPSVLELEKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILSGPLEALAGIMFGIILGIVSWYIPSFDNDNFIFYRSVLLYLLSIVSMFGSIAFKIPGAGALGVLTLAFVSGFGWSKDSDWNGKRNPVTKLTELLWWLFQPFLFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKERLFIPIAWLPKATVQAALGPVALDLAIKNNLPQHIIDQGDLILAIAAMAILITAPIGAALISLLAPLLLQKSLKSSLNEADVVKLKTIATSETKFSSTDEK 501          
The following BLAST results are available for this feature:
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC9B21.118e-8847.37solute carrier family 9 member B2 [Source:HGNC Sym... [more]
SLC9B25.991e-8746.15solute carrier family 9 member B2 [Source:HGNC Sym... [more]
SLC9B25.991e-8746.15solute carrier family 9 member B2 [Source:HGNC Sym... [more]
SLC9B19.502e-7738.32solute carrier family 9 member B1 [Source:HGNC Sym... [more]
SLC9B14.519e-7237.65solute carrier family 9 member B1 [Source:HGNC Sym... [more]
back to top
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
F41E7.24.310e-2523.54pep chromosome:WBcel235:X:10273692:10278261:1 gene... [more]
F41E7.24.310e-2523.54pep chromosome:WBcel235:X:10273888:10278261:1 gene... [more]
F41E7.24.310e-2523.54pep chromosome:WBcel235:X:10273887:10278261:1 gene... [more]
F41E7.11.229e-2325.06pep chromosome:WBcel235:X:10279599:10282842:1 gene... [more]
F57G8.55.575e-2327.80pep chromosome:WBcel235:V:16339024:16341536:1 gene... [more]
back to top
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Nha14.041e-6938.92gene:FBgn0031865 transcript:FBtr0079373[more]
Nha14.800e-6938.92gene:FBgn0031865 transcript:FBtr0079374[more]
Nha29.034e-5536.36gene:FBgn0263390 transcript:FBtr0309100[more]
Nha25.402e-5436.36gene:FBgn0263390 transcript:FBtr0309101[more]
back to top
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SLC9B25.894e-8645.50si:dkey-162b23.4 [Source:ZFIN;Acc:ZDB-GENE-110411-... [more]
back to top
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc9b21.027e-8948.38solute carrier family 9 member B2 [Source:NCBI gen... [more]
slc9b21.313e-8948.38solute carrier family 9 member B2 [Source:NCBI gen... [more]
slc9b21.715e-8948.38solute carrier family 9 member B2 [Source:NCBI gen... [more]
slc9b23.567e-8948.38solute carrier family 9 member B2 [Source:NCBI gen... [more]
slc9b24.028e-8948.38solute carrier family 9 member B2 [Source:NCBI gen... [more]
back to top
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Slc9b22.764e-8846.15solute carrier family 9, subfamily B (NHA2, cation... [more]
Slc9b17.841e-7540.54solute carrier family 9, subfamily B (NHA1, cation... [more]
Slc9b27.298e-1143.30solute carrier family 9, subfamily B (NHA2, cation... [more]
Slc9b11.695e-1043.24solute carrier family 9, subfamily B (NHA1, cation... [more]
back to top
BLAST of Na_H_Exchanger domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A4IHB9|SL9B2_XENTR3.746e-8848.11Sodium/hydrogen exchanger 9B2 OS=Xenopus tropicali... [more]
sp|Q5BKR2|SL9B2_MOUSE1.933e-8746.15Sodium/hydrogen exchanger 9B2 OS=Mus musculus OX=1... [more]
sp|Q86UD5|SL9B2_HUMAN2.877e-8646.15Sodium/hydrogen exchanger 9B2 OS=Homo sapiens OX=9... [more]
sp|Q5R6B8|SL9B2_PONAB3.266e-8646.15Sodium/hydrogen exchanger 9B2 OS=Pongo abelii OX=9... [more]
sp|Q4ZJI4|SL9B1_HUMAN4.563e-7638.32Sodium/hydrogen exchanger 9B1 OS=Homo sapiens OX=9... [more]
back to top
BLAST of Na_H_Exchanger domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9K2F11.237e-11352.12Na_H_Exchanger domain-containing protein OS=Biomph... [more]
V3ZDI21.211e-11054.62Na_H_Exchanger domain-containing protein OS=Lottia... [more]
A0A1S3HIN32.717e-11047.21uncharacterized protein LOC106154882 OS=Lingula un... [more]
A0A2R2MLF05.687e-11056.52sodium/hydrogen exchanger 9B2 OS=Lingula unguis OX... [more]
A0A1S3IET74.480e-10843.31sodium/hydrogen exchanger 9B2 OS=Lingula unguis OX... [more]
back to top
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:dkey-162b23.47.747e-8444.56sodium/hydrogen exchanger 9B2 [Source:NCBI gene;Ac... [more]
ENSAMXT00000046911.12.470e-7446.34sodium/hydrogen exchanger 9B2-like [Source:NCBI ge... [more]
ENSAMXT00000004545.22.731e-6946.07sodium/hydrogen exchanger 9B2-like [Source:NCBI ge... [more]
back to top
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO302491.655e-9046.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO438967.702e-8643.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426782.984e-7447.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO302512.375e-7246.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Na_H_Exchanger domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000034921.11.039e-8345.99sodium/hydrogen exchanger 9B2-like [Source:NCBI ge... [more]
si:dkey-162b23.41.837e-8346.74sodium/hydrogen exchanger 9B2 [Source:NCBI gene;Ac... [more]
ENSORLT00000040276.12.273e-8345.17sodium/hydrogen exchanger 9B2-like [Source:NCBI ge... [more]
si:dkey-162b23.42.392e-8346.74sodium/hydrogen exchanger 9B2 [Source:NCBI gene;Ac... [more]
si:dkey-162b23.42.392e-8346.74sodium/hydrogen exchanger 9B2 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Na_H_Exchanger domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000005979.10.000e+099.60SMESG000005979.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031547 ID=SMED30031547|Name=Na_H_Exchanger domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1825bp
TTAAAATGAGTTAATTATTATATTTAGATTATTAGTTATTGTAATAATGT
AGAAATATTTTTCTATTGATATCAAATCACGGGAGTAATTAATATATATT
TTGTTTTAATTATACATTTTTAATATCCAATATAATGAAAATTAAGATAA
CTTGTCCACCACGTTTATTTATCAATGTATTTCTTACTGTGATATTATGC
TTTATTACAATCGGCATATGTCTATATTCATTTGATCCGAAAGATTTTGA
CATAGTTAATTGTACATCTAGATTAAGTCAAAATACAACTCATATAGCTA
ATAATAATAAATGCGATAAAGGTAATCTTTTGGGATTACTTGTTTTATAC
ATTGGATGCACTATTGGGGGAATTTTGATAGTTTATATTAAATTTCCTCC
TTTGCTTGGGATGCTAATTATTGGTTTTGCATTGAGAAATACTCCTTATA
TAAACGTTGCGATTTTTATTAATAAATTATGGTCTGGAAATTTACGAAAT
ATGGCTTTAATGATAATTTTAATTCGAGCTGGTCTTGGATTAGATCCTAA
AGTGTTAAAAAGGCTGAGTTTCGTTGTAGTTAGATTAGCATTTACACCAT
GTATCATTGAAGCGATAACTGAAGCAATAGTGTCTCATTTCCTGATTGGA
TTGTCTTGGAGTTGGGCATTTATGTTGGGATTTATTCTTTCTGCTGTGTC
ACCAGCTGTTGTCGTTCCAAGTGTTTTAGAATTAGAAAAAAAAGGCCTTG
GTGTAGACCAAGGAATCAATACTCTAGTAATAGCTGCAGCATCTATTGAT
GACGTCCTTGCAATTACCGGATTTGGAATTTGTCTGGGATTTTCGTTTTC
TGACAATCAAAATTTAGCTTTACAAATACTTAGTGGTCCACTTGAAGCTT
TAGCTGGAATAATGTTTGGAATAATTCTCGGCATTGTGTCGTGGTATATT
CCATCTTCTGACAATGACAATTTTATCTTTTATCGATCGGTTTTATTGTA
TTTACTTTCAATCGTGTCAATGTTCGGCAGCATCGCTTTCAAAATACCTG
GCGCAGGAGCTCTAGGGGTTTTAACACTTGCATTTGTTACAGGATTTGGC
TGGAGTAAGGATTCAGATTGGAATGGGAAACGTAATCCAGTAACCAAGCT
AACAGAATTATTATGGTGGCTTTTCCAGCCTTTCTTATTTGGTCTGATCG
GGGCCGGTTTAGATATTAATTCCATCAACTTCAGTGCTCTAGGTTTTGGA
ATTGTAACATTACTTATTGGAATCGTTTTTCGATTGCTTGCAAGCTTTTT
TTCGGTTTTTGGAACTAAATTCACTATGAAAGAACGATTATTTATTCCGA
TTGCATGGTTACCAAAAGCCACCGTACAAGCAGCTCTTGGTCCAGTGGCT
TTAGATTTAGCAATTAAGAATAATTTACCTCAGCATATCATTGACCAAGG
AGACTTAATATTAGCAATCGCAGCGATGGCCATACTTATCACTGCACCAA
TTGGTGCTGCTCTAATATCTCTATTAGCACCGCTCTTGTTACAGAAATCG
CTGAAGTCATCCTTGAATGAAGCTGATGTTGTCAAACTGAAAACGATTGC
CACGAGTGAAACCAAATTTTCATCAACTGATGAAAAATAATTATTATTTT
TATGGTTGTCATAACATTTATATTTTTGAGGTTTTAGAAATTATTTAGAT
TTTTATATTGATTTTTCGAAGTGAAATTAAAGCTTTAATTTTGTTTTTGT
TTAATTGATTAAATGCAAGATCATGGAATGTTCATTGATTTTTTTTTAAT
TGATTTAAATTATGTATTTGTGACG
back to top

protein sequence of SMED30031547-orf-1

>SMED30031547-orf-1 ID=SMED30031547-orf-1|Name=SMED30031547-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=502bp
MKIKITCPPRLFINVFLTVILCFITIGICLYSFDPKDFDIVNCTSRLSQN
TTHIANNNKCDKGNLLGLLVLYIGCTIGGILIVYIKFPPLLGMLIIGFAL
RNTPYINVAIFINKLWSGNLRNMALMIILIRAGLGLDPKVLKRLSFVVVR
LAFTPCIIEAITEAIVSHFLIGLSWSWAFMLGFILSAVSPAVVVPSVLEL
EKKGLGVDQGINTLVIAAASIDDVLAITGFGICLGFSFSDNQNLALQILS
GPLEALAGIMFGIILGIVSWYIPSSDNDNFIFYRSVLLYLLSIVSMFGSI
AFKIPGAGALGVLTLAFVTGFGWSKDSDWNGKRNPVTKLTELLWWLFQPF
LFGLIGAGLDINSINFSALGFGIVTLLIGIVFRLLASFFSVFGTKFTMKE
RLFIPIAWLPKATVQAALGPVALDLAIKNNLPQHIIDQGDLILAIAAMAI
LITAPIGAALISLLAPLLLQKSLKSSLNEADVVKLKTIATSETKFSSTDE
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR038770Na+/solute_symporter_sf
IPR006153Cation/H_exchanger
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
GO:0006812cation transport
GO:0006810transport
GO:0006811ion transport
GO:0006814sodium ion transport
GO:0015992proton transport
GO:1902600hydrogen ion transmembrane transport
Vocabulary: molecular function
TermDefinition
GO:0015299solute:proton antiporter activity
GO:0015297antiporter activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005739mitochondrion
GO:0016020membrane
GO:0031966mitochondrial membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006153Cation/H+ exchangerPFAMPF00999Na_H_Exchangercoord: 72..457
e-value: 1.4E-24
score: 86.6
IPR038770Sodium/solute symporter superfamilyGENE3DG3DSA:1.20.1530.20coord: 61..475
e-value: 4.6E-21
score: 77.1
NoneNo IPR availablePANTHERPTHR31102:SF1SI:DKEY-162B23.4coord: 5..491
NoneNo IPR availablePANTHERPTHR31102FAMILY NOT NAMEDcoord: 5..491
NoneNo IPR availableTMHMMTMhelixcoord: 306..323
NoneNo IPR availableTMHMMTMhelixcoord: 371..393
NoneNo IPR availableTMHMMTMhelixcoord: 342..361
NoneNo IPR availableTMHMMTMhelixcoord: 90..112
NoneNo IPR availableTMHMMTMhelixcoord: 442..464
NoneNo IPR availableTMHMMTMhelixcoord: 211..233
NoneNo IPR availableTMHMMTMhelixcoord: 63..85
NoneNo IPR availableTMHMMTMhelixcoord: 405..427
NoneNo IPR availableTMHMMTMhelixcoord: 11..33
NoneNo IPR availableTMHMMTMhelixcoord: 176..198
NoneNo IPR availableTMHMMTMhelixcoord: 144..166
NoneNo IPR availableTMHMMTMhelixcoord: 253..275
NoneNo IPR availableTMHMMTMhelixcoord: 280..302