Choline O-acetyltransferase

Overview
NameCholine O-acetyltransferase
Smed IDSMED30031525
Length (bp)2388
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Choline O-acetyltransferase (SMED30031525) t-SNE clustered cells

Violin plots show distribution of expression levels for Choline O-acetyltransferase (SMED30031525) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Choline O-acetyltransferase (SMED30031525) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Choline O-acetyltransferase (SMED30031525) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031525

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 40

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
cholinergic neuronSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
cholinergic neuronSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:24415944
Scimone et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:23318641
Chen et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
ventral nerve cordSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:23318641
Chen et al., 2013
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:24992682
Vásquez-Doorman et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30031525SMESG000051357.1 SmedASXL_012349SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:25558068
Reuter et al., 2015
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:25725068
Owen et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
nervous systemSMED30031525SMESG000051357.1 dd_Smed_v4_11968_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031525SMESG000051357.1 dd_Smed_v4_11968_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031525SMESG000051357.1 dd_Smed_v4_11968_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031525SMESG000051357.1 dd_Smed_v4_11968_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031525SMESG000051357.1 dd_Smed_v4_11968_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031525SMESG000051357.1 dd_Smed_v4_6208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031525SMESG000051357.1 dd_Smed_v4_6208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031525SMESG000051357.1 dd_Smed_v4_6208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031525SMESG000051357.1 dd_Smed_v4_6208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031525SMESG000051357.1 dd_Smed_v4_6208_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031525SMESG000051357.1 Contig50723newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031525SMESG000051357.1 Contig50723uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031525SMESG000051357.1 Contig53667uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031525SMESG000051357.1 Contig53667newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031525SMESG000051357.1 Contig3741newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031525SMESG000051357.1 Contig3741uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031525SMESG000005261.1 SMESG000005262.1 Contig3741newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031525SMESG000005261.1 SMESG000005262.1 Contig3741uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:21566185
Wagner et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:21566185
Wagner et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
ventral nerve cordSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:21566185
Wagner et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
cholinergic neuronSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:21566185
Wagner et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30031525SMESG000051357.1 dd_Smed_v6_11968_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30031525SMESG000051357.1 dd_Smed_v6_6208_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30031525SMESG000051357.1 OX_Smed_1.0.16021ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30031525SMESG000051357.1 OX_Smed_1.0.22138ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
neuronSMED30031525SMESG000051357.1 dd_Smed_v6_11968_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30031525SMESG000051357.1 dd_Smed_v6_11968_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30031525SMESG000051357.1 dd_Smed_v6_6208_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031525SMESG000051357.1 FG310880ncbi_smed_estsPMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Choline O-acetyltransferase vs. Ensembl Human
Match: CHAT (choline O-acetyltransferase [Source:HGNC Symbol;Acc:HGNC:1912])

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 274/613 (44.70%), Postives = 391/613 (63.78%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTE-EVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMT---ADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL-----TSNLELAKNRKAVK 1960
            YL  +  +V+ E + K++ +V++FG PGG+GE LQ KLLE  ++  NWV++ WL DMYL N LALP+NSSP ++F +QHF    +QLRFAA+LI+G+L YK ++D   +P D A     GQP CM+QYY LFSSYR PG T+D L    +    + EH+IVAC NQFFVL++  +  R SE DL+ QLR+IV++A +E      +G+LT+  R +WA  R  L+ D TN+ S++MIE+ I ++C+D         P  VEL+      + + ALQLLHG G   NGANRWYDK++QFV+  DG CG+  EHS  +GI +++  EH+L ++ +  SR+L R  SV +L  P++L +         ++ + ++++ +  NLD  + ++  +G+ F K    SPD+FIQ+ALQL  Y++H+ LVPTYESASIRRF  GRVDNIR+A+  AL +  ++T   A  PAS  EK++LL+ A+  QT   +  I G  +DNHLL L+E A  M  E+ E+F D+TYL SN+F LSTSQVPT  + F CYG VV +GYGA YNP   +I+  IS +  C +T +  FA+ ++ES  +M  L      T +  LA   KA +
Sbjct:   28 YLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASLISGVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMIERCICLVCLDA--------PGGVELS------DTHRALQLLHGGGYSKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHVTQ-SSRKLIRADSVSELPAPRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPAS--EKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATR 623          
BLAST of Choline O-acetyltransferase vs. Ensembl Human
Match: CHAT (choline O-acetyltransferase [Source:HGNC Symbol;Acc:HGNC:1912])

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 274/613 (44.70%), Postives = 391/613 (63.78%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTE-EVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMT---ADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL-----TSNLELAKNRKAVK 1960
            YL  +  +V+ E + K++ +V++FG PGG+GE LQ KLLE  ++  NWV++ WL DMYL N LALP+NSSP ++F +QHF    +QLRFAA+LI+G+L YK ++D   +P D A     GQP CM+QYY LFSSYR PG T+D L    +    + EH+IVAC NQFFVL++  +  R SE DL+ QLR+IV++A +E      +G+LT+  R +WA  R  L+ D TN+ S++MIE+ I ++C+D         P  VEL+      + + ALQLLHG G   NGANRWYDK++QFV+  DG CG+  EHS  +GI +++  EH+L ++ +  SR+L R  SV +L  P++L +         ++ + ++++ +  NLD  + ++  +G+ F K    SPD+FIQ+ALQL  Y++H+ LVPTYESASIRRF  GRVDNIR+A+  AL +  ++T   A  PAS  EK++LL+ A+  QT   +  I G  +DNHLL L+E A  M  E+ E+F D+TYL SN+F LSTSQVPT  + F CYG VV +GYGA YNP   +I+  IS +  C +T +  FA+ ++ES  +M  L      T +  LA   KA +
Sbjct:   28 YLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASLISGVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMIERCICLVCLDA--------PGGVELS------DTHRALQLLHGGGYSKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHVTQ-SSRKLIRADSVSELPAPRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPAS--EKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATR 623          
BLAST of Choline O-acetyltransferase vs. Ensembl Human
Match: CHAT (choline O-acetyltransferase [Source:HGNC Symbol;Acc:HGNC:1912])

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 274/613 (44.70%), Postives = 391/613 (63.78%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTE-EVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMT---ADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL-----TSNLELAKNRKAVK 1960
            YL  +  +V+ E + K++ +V++FG PGG+GE LQ KLLE  ++  NWV++ WL DMYL N LALP+NSSP ++F +QHF    +QLRFAA+LI+G+L YK ++D   +P D A     GQP CM+QYY LFSSYR PG T+D L    +    + EH+IVAC NQFFVL++  +  R SE DL+ QLR+IV++A +E      +G+LT+  R +WA  R  L+ D TN+ S++MIE+ I ++C+D         P  VEL+      + + ALQLLHG G   NGANRWYDK++QFV+  DG CG+  EHS  +GI +++  EH+L ++ +  SR+L R  SV +L  P++L +         ++ + ++++ +  NLD  + ++  +G+ F K    SPD+FIQ+ALQL  Y++H+ LVPTYESASIRRF  GRVDNIR+A+  AL +  ++T   A  PAS  EK++LL+ A+  QT   +  I G  +DNHLL L+E A  M  E+ E+F D+TYL SN+F LSTSQVPT  + F CYG VV +GYGA YNP   +I+  IS +  C +T +  FA+ ++ES  +M  L      T +  LA   KA +
Sbjct:   64 YLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASLISGVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMIERCICLVCLDA--------PGGVELS------DTHRALQLLHGGGYSKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHVTQ-SSRKLIRADSVSELPAPRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPAS--EKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATR 659          
BLAST of Choline O-acetyltransferase vs. Ensembl Human
Match: CHAT (choline O-acetyltransferase [Source:HGNC Symbol;Acc:HGNC:1912])

HSP 1 Score: 535.798 bits (1379), Expect = 0.000e+0
Identity = 274/613 (44.70%), Postives = 391/613 (63.78%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTE-EVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMT---ADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL-----TSNLELAKNRKAVK 1960
            YL  +  +V+ E + K++ +V++FG PGG+GE LQ KLLE  ++  NWV++ WL DMYL N LALP+NSSP ++F +QHF    +QLRFAA+LI+G+L YK ++D   +P D A     GQP CM+QYY LFSSYR PG T+D L    +    + EH+IVAC NQFFVL++  +  R SE DL+ QLR+IV++A +E      +G+LT+  R +WA  R  L+ D TN+ S++MIE+ I ++C+D         P  VEL+      + + ALQLLHG G   NGANRWYDK++QFV+  DG CG+  EHS  +GI +++  EH+L ++ +  SR+L R  SV +L  P++L +         ++ + ++++ +  NLD  + ++  +G+ F K    SPD+FIQ+ALQL  Y++H+ LVPTYESASIRRF  GRVDNIR+A+  AL +  ++T   A  PAS  EK++LL+ A+  QT   +  I G  +DNHLL L+E A  M  E+ E+F D+TYL SN+F LSTSQVPT  + F CYG VV +GYGA YNP   +I+  IS +  C +T +  FA+ ++ES  +M  L      T +  LA   KA +
Sbjct:   28 YLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASLISGVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMIERCICLVCLDA--------PGGVELS------DTHRALQLLHGGGYSKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHVTQ-SSRKLIRADSVSELPAPRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPAS--EKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATR 623          
BLAST of Choline O-acetyltransferase vs. Ensembl Human
Match: CHAT (choline O-acetyltransferase [Source:HGNC Symbol;Acc:HGNC:1912])

HSP 1 Score: 535.413 bits (1378), Expect = 8.345e-180
Identity = 274/613 (44.70%), Postives = 391/613 (63.78%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTE-EVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMT---ADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL-----TSNLELAKNRKAVK 1960
            YL  +  +V+ E + K++ +V++FG PGG+GE LQ KLLE  ++  NWV++ WL DMYL N LALP+NSSP ++F +QHF    +QLRFAA+LI+G+L YK ++D   +P D A     GQP CM+QYY LFSSYR PG T+D L    +    + EH+IVAC NQFFVL++  +  R SE DL+ QLR+IV++A +E      +G+LT+  R +WA  R  L+ D TN+ S++MIE+ I ++C+D         P  VEL+      + + ALQLLHG G   NGANRWYDK++QFV+  DG CG+  EHS  +GI +++  EH+L ++ +  SR+L R  SV +L  P++L +         ++ + ++++ +  NLD  + ++  +G+ F K    SPD+FIQ+ALQL  Y++H+ LVPTYESASIRRF  GRVDNIR+A+  AL +  ++T   A  PAS  EK++LL+ A+  QT   +  I G  +DNHLL L+E A  M  E+ E+F D+TYL SN+F LSTSQVPT  + F CYG VV +GYGA YNP   +I+  IS +  C +T +  FA+ ++ES  +M  L      T +  LA   KA +
Sbjct:  146 YLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASLISGVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMIERCICLVCLDA--------PGGVELS------DTHRALQLLHGGGYSKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHVTQ-SSRKLIRADSVSELPAPRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPAS--EKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATR 741          
BLAST of Choline O-acetyltransferase vs. Ensembl Celegans
Match: cha-1 (Choline O-acetyltransferase [Source:UniProtKB/Swiss-Prot;Acc:P32756])

HSP 1 Score: 342.043 bits (876), Expect = 3.716e-107
Identity = 201/569 (35.33%), Postives = 319/569 (56.06%), Query Frame = 2
Query:  248 LQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFD--HEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAE-SEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGL----KEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPT---LKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTS 1924
            LQ +LLE +++  NW    WL +MY++  +  P+NS+PG +FPK  F+ +++ +++ A L  G+L+YK +ID + +  +++T  +K Q  CMEQY R+ S YR PGV +D   T I +   +  +EH++V C NQ F+L    +    S  D+  QL +I  +++ ++     +G     PR   A   Q +L    N KS E ++ ++F++C+D   P+ +   +++ +++   ++ V      L G GS   G NRWYD T+Q V+S+ G  GL  EHS AEGI +I + E  + Y ++    ++   + V ++  PK L ++    +  ++ +  +    LA+ L++ +L + +FG+D  K   +SPD FIQL +QL HYK H  LV TYESAS+RRF  GRVDNIRA +  AL+W T+M A    S + K+ L + A+  Q KV L+ I G+GVDNHL  L    +E       +I  LF D  + E  +F LSTSQV T   + D ++ YGAVV  GYG  YN   + +I A + +   P T    F + L  +  ++  LL++
Sbjct:   67 LQEQLLEIAEKSPNWATKFWLPEMYMRVRMPTPVNSNPGYIFPKVKFETKEDHIKYTALLTRGLLEYKNLIDTKQVCREKSTGAQKLQ-MCMEQYDRVLSCYREPGVGED---TQIRKQKTNDGNEHVLVMCRNQTFLLHSRINGALVSYADVEYQLAQIEEISKINQNNTANIGASGVGPRDNAALFWQDMLTVEQNSKSYEWVKSALFVVCLDMEDPIDYGKNDTMSISEKE-KEFVARGYSTLTGHGSSKFGLNRWYDATIQLVVSSSGVNGLCIEHSTAEGIVIINMAETAIRYAQKYFKSKMV-WNDVRNV-HPKSLTWHFSENSRNILKKQAEVFDELANELELEVLIFNEFGKDSIKNWRVSPDGFIQLIMQLAHYKTHGHLVSTYESASVRRFGAGRVDNIRANTQEALEWVTAM-ASKKESKERKLELFKKAVLKQVKVTLENISGYGVDNHLCALFCLAREREETTGEDIPSLFLDPLWSEVMRFPLSTSQVTTSLDIPDCYLTYGAVVRDGYGCPYNIQPDRVIFAPTAFRSDPRTDLQHFKKSLAGAMRDVKELLSN 627          
BLAST of Choline O-acetyltransferase vs. Ensembl Celegans
Match: B0395.3 (pep chromosome:WBcel235:X:16035055:16039514:-1 gene:WBGene00007175.1 transcript:B0395.3.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0395.3)

HSP 1 Score: 311.612 bits (797), Expect = 7.767e-96
Identity = 192/594 (32.32%), Postives = 311/594 (52.36%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEF---GKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERP-SEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            +LD    + + +++++TK +V +F     P     KLQ  L + +    NW+   WL   YL     LP+ +SPG++FPK  +  E+ QL +AA +    + +        L  D A  +    P  M QY  LF + R P V  DE+    +      +HI+V  N   F +++  S E+P S   +  QL ++V  +++     V GI+++  R KWA V   L  D  N KS+E +EKS+F++C+DK       + E  E ++           Q LHG GS+ N +NRW+DKT+QFVI  +G  G+ YEH+ AEG  V  L++ I D  +   +  +T  +      P ++L+ + D   ++ I+++ + + ++A++LDI    ++ +G++FPK+  +SPDSFIQ+A QL  Y+IH  L PTYE+A++R+F+ GR +NIR+ +  A  +   M +  P    E    L  A     K  +D +   G+D HLL  K  A E N+   E+F    Y + N F++STSQVPT     MC+G      YG  YNP +  +   IS +     T +  FA++L+++  +M S++
Sbjct:   37 FLDFAQALQSKKEFQETKQIVNDFVVKDLP-----KLQELLQKRADALPNWLTPWWLNIAYLAARTPLPVVTSPGVMFPKFDYNTEEGQLEYAAKISQAAVHFYLRAKNNQLKPDMAGKS----PLDMSQYQFLFGTTRVPKVGVDEIRYGCDYKE-KLQHILVIRNGHLFRVQVLDSNEQPLSIFAITQQLAKVVSESQTPNPHPV-GIVSSDSRDKWANVYSSLKKDNNNAKSLEAVEKSLFVVCLDKASEPPVGYTEKDEQSR-----------QALHGGGSKVNSSNRWFDKTIQFVIGTNGYTGMTYEHTPAEGPPVGALMDFICDQFDA--NTFITEGTPSNS--PVQRLDISTDEEINKRIAKSSKNMDSIAEDLDIVAFTFKPYGKNFPKSSKISPDSFIQMAYQLAFYRIHSSLPPTYETATLRKFTEGRTENIRSPNTAAASFVKKMVSKPPTPVSEIYDALVHATNSHKKYTMDCMDAAGMDRHLLAWKLIATENNLPTPEIFGSNIYQQLNHFQVSTSQVPTRHFIQMCFGPSALDCYGICYNPQETELHFMISTFKSYGSTSSKKFAKELQKALIDMKSVI 604          
BLAST of Choline O-acetyltransferase vs. Ensembl Celegans
Match: B0395.3 (pep chromosome:WBcel235:X:16035063:16039231:-1 gene:WBGene00007175.1 transcript:B0395.3.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:B0395.3)

HSP 1 Score: 311.612 bits (797), Expect = 7.767e-96
Identity = 192/594 (32.32%), Postives = 311/594 (52.36%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEF---GKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERP-SEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            +LD    + + +++++TK +V +F     P     KLQ  L + +    NW+   WL   YL     LP+ +SPG++FPK  +  E+ QL +AA +    + +        L  D A  +    P  M QY  LF + R P V  DE+    +      +HI+V  N   F +++  S E+P S   +  QL ++V  +++     V GI+++  R KWA V   L  D  N KS+E +EKS+F++C+DK       + E  E ++           Q LHG GS+ N +NRW+DKT+QFVI  +G  G+ YEH+ AEG  V  L++ I D  +   +  +T  +      P ++L+ + D   ++ I+++ + + ++A++LDI    ++ +G++FPK+  +SPDSFIQ+A QL  Y+IH  L PTYE+A++R+F+ GR +NIR+ +  A  +   M +  P    E    L  A     K  +D +   G+D HLL  K  A E N+   E+F    Y + N F++STSQVPT     MC+G      YG  YNP +  +   IS +     T +  FA++L+++  +M S++
Sbjct:   37 FLDFAQALQSKKEFQETKQIVNDFVVKDLP-----KLQELLQKRADALPNWLTPWWLNIAYLAARTPLPVVTSPGVMFPKFDYNTEEGQLEYAAKISQAAVHFYLRAKNNQLKPDMAGKS----PLDMSQYQFLFGTTRVPKVGVDEIRYGCDYKE-KLQHILVIRNGHLFRVQVLDSNEQPLSIFAITQQLAKVVSESQTPNPHPV-GIVSSDSRDKWANVYSSLKKDNNNAKSLEAVEKSLFVVCLDKASEPPVGYTEKDEQSR-----------QALHGGGSKVNSSNRWFDKTIQFVIGTNGYTGMTYEHTPAEGPPVGALMDFICDQFDA--NTFITEGTPSNS--PVQRLDISTDEEINKRIAKSSKNMDSIAEDLDIVAFTFKPYGKNFPKSSKISPDSFIQMAYQLAFYRIHSSLPPTYETATLRKFTEGRTENIRSPNTAAASFVKKMVSKPPTPVSEIYDALVHATNSHKKYTMDCMDAAGMDRHLLAWKLIATENNLPTPEIFGSNIYQQLNHFQVSTSQVPTRHFIQMCFGPSALDCYGICYNPQETELHFMISTFKSYGSTSSKKFAKELQKALIDMKSVI 604          
BLAST of Choline O-acetyltransferase vs. Ensembl Celegans
Match: cpt-2 (Carnitine Palmitoyl Transferase [Source:UniProtKB/TrEMBL;Acc:G5ECS9])

HSP 1 Score: 184.882 bits (468), Expect = 3.172e-49
Identity = 169/623 (27.13%), Postives = 266/623 (42.70%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSK--RKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIID------------------------VRGLPVDRATHNR---KGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEI-TTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKK--------LEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFD 1900
            RYL     V++ + + KT+  +  F      G KLQ  LLE  K  R  +++++ W  DMYL+  + + +N +P M++         +QL  A NL       K  +D                         + LP   +       K  P  M QY  LF   R P   KD L  + ++     +H +       + + I     +    +D++  L  I+   +    E  +G LT+L R  WA  R  L  +  N + ++ I+  +F +C+D     T  H   V+               LL G     +  NRW+DK  Q +I A+G   +N+EHS  +G+AV+RL+E      E  K        S  D   PK         LE+ +       IS+A+++  +   +LD   + ++   RD  K   +SPDS +QLA+Q+  Y ++K  VPTYES S   F  GR + +R+A+  A +  T    +    D  +++   S   +Q  ++ +   G G D HLLGLK  A  ++    + F+D  Y     F LSTS + T    F  +G VV+ G+G  YN   N +   IS      D  A  F+  L +S D
Sbjct:   56 RYLASSKAVLSPDVFAKTEATIRSF--EANEGPKLQEALLEYDKAHRDTSYISEPWF-DMYLRARVPVAVNYNPFMMYAPDPNPKFNDQLTRATNLAISYARIKRSLDENLLGPEVFHMNPKKSDTKLFRTVCKTLPPSLSWFGAVAFKAFPLDMSQYKSLFCGSRIPKKEKDMLYLDASQ-----KHFVAFYKGHPYAVRIFDDDGKLLDAEDVHASLAWILSNGKEAAPESSIGSLTSLDRDSWAEARVELE-NAGNGEYLKKIDGGLFAICLDDLK--TEEHKRLVQ--------------SLLIGD----DARNRWFDKCFQTIIDANGQATINFEHSWGDGVAVLRLME------ESFKDTNKNHFVSPDDT--PKSHNPAHVQALEFKLTDSLKSKISDAQKKHVSANSDLDFATMEFEGLNRDLIKKTKLSPDSVMQLAIQMAFYSLYKEFVPTYESCSTAAFLKGRTECMRSAT-SATRAATLAILEENRKDVRQLLTDCSTQHFQ--LVKEASMGQGYDRHLLGLKITAQRLSQPTPDFFQDPGYTRMGHFVLSTSTLSTDTIVFGGFGPVVQDGFGIGYNVVPNKLGAVISSNKSKRDAAA--FSNALYKSLD 636          
BLAST of Choline O-acetyltransferase vs. Ensembl Celegans
Match: F41E7.6 (pep chromosome:WBcel235:X:10307137:10310466:-1 gene:WBGene00009622.1 transcript:F41E7.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F41E7.6)

HSP 1 Score: 183.726 bits (465), Expect = 3.600e-49
Identity = 160/615 (26.02%), Postives = 282/615 (45.85%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDH--EHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGI--LTALPRRKWAAVRQHLLLDLTNKKSMEM---IEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPK---KLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEM-----NMEISELFKDKTYLES---NQFRLSTSQVPTLKDAFMCYGAVV---EHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSN 1927
            +YL  + P+V  ++ E    L  +F      G+ LQ  L E +   +NW+ D W  D YL N  +L +  + G V PK    N+  Q+  A+++I  ++ Y ++I    + V ++    +G  + M Q Y LF++ R P + KD +      +       H+I+ CN   + LE  T+ E     +++     + R+ ES +T     I  LT+L R  WA +R+ ++ +  + +++E+   ++ ++F  C+        N  E V L K  I              GS  N    + DK +  ++  DG   L  EH   + I++    +   D  +  +        +    + P    K+E+ +    SQ ISEA+++   L+   ++ +  Y  FG  + K   +  D+ IQ+ALQ+ + K H  L PTYE+AS R F  GR + +R+ +    K+ T+   +  A+++   +L   A      +M    +G G+D H  GL++A   +     ++EI  L   K++  S     F LSTS +   ++   C+G VV   + GYG  Y  +K S    IS W D   T  D F + L+ S + + +++ +N
Sbjct:   26 KYLKSLVPIVPKDELETITTLANDFASSQN-GQILQRFLKEKTISSKNWLEDWWY-DAYLTNRDSL-LTQNMGAVVPKFSV-NDSSQIESASHIIHHLMSYWSLIRQEKIEVTKS----RGNSWDMNQDYNLFNACRVPALPKDRIKRYFRTEAEGKCPSHVIILCNGHVWKLE--TTCENSKFLNIFEIQNALKRIKESSRTSVECSIVQLTSLGRDNWAQIRESMIQN--SNRNVELFHDVDSAVF--CLTLSDDFVENESEVVRLMKYSI-------------FGSPLNA---YCDKNLNIIVLRDGKTCLQAEHGNVDAISLFAPCDFAADQFQLNRKLSKKSSQNKSSSMQPVMPVKIEFLLTGSVSQKISEAERDFYFLSSKTNVNVYHYTNFGATYCKQRTLYADTIIQIALQMAYLKTHNKLAPTYETASTRMFYHGRTETVRSLTTDMEKYLTA--CENSATNETLKLLFFDAYNSHNTLMDAAREGKGIDRHFYGLRKAQTAIQSYGKSVEIPFL-DHKSFSASGGNGNFLLSTSFLGYHENG--CFGYVVPMCKDGYGTFYRINKTSFTFTISNWLD-DATNGDEFRENLEYSLNFIKNVILTN 604          
BLAST of Choline O-acetyltransferase vs. Ensembl Fly
Match: ChAT (gene:FBgn0000303 transcript:FBtr0089368)

HSP 1 Score: 462.611 bits (1189), Expect = 2.718e-152
Identity = 251/612 (41.01%), Postives = 358/612 (58.50%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKD-ELATNINRDPFDHEHIIVACNNQFFVLEITTSAE-RPSEKDLYNQLRRIVRLAESEKTEEV-VGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELT----KAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKW----CTSMTADTP-----------ASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            Y+  + P+ T    E+TK L+ +F  P GIG +L   LL+  + ++NW    WL +MY+   + LPINS+PGMVFP + F+   +   FAA L+ GIL ++ ++D   LP++RA    K QP CM QYYRL  S R PGV +D +   +  R   +  H++V C NQ + + +  S   + SE ++ +Q+  ++  A     + V VG+LTA PR  WA  R+ L  D  N++++E+IE +  +LC+D+P+   FN       T    +AG RD  N A +++HG GSEYN  NRW+DKTMQ +I  DG  GL YEHS +EGIAV++L+E I   +EE              L PP++LE+++        ++A + +    D+LD Y+ RYQ +G+ F K+  +SPD +IQLALQL HYK++  LV TYESAS RRF  GRVD IRAAS  AL+W    C    A+ P              D    L R A+  QT+VM+  I G+G+D  LLGL+EA++E+  E+ ELFKD++Y+ S  F LSTSQV    D+FM YG V   GYG +YNPH   I+  +S +  C DT A  +A+ L++S D M  LL
Sbjct:  103 YIRALEPITTPAQLERTKELIRQFSAPQGIGARLHQYLLDKREAEDNWAYYYWLNEMYMDIRIPLPINSNPGMVFPPRRFKTVHDVAHFAARLLDGILSHREMLDSGELPLERAASREKNQPLCMAQYYRLLGSCRRPGVKQDSQFLPSRERLNDEDRHVVVICRNQMYCVVLQASDRGKLSESEIASQILYVLSDAPCLPAKPVPVGLLTAEPRSTWARDREMLQEDERNQRNLELIETAQVVLCLDEPLAGNFNARGFTGATPTVHRAGDRDETNMAHEMIHGGGSEYNSGNRWFDKTMQLIICTDGTWGLCYEHSCSEGIAVVQLLEKIYKKIEEHPDEDNGLPQH--HLPPPERLEWHVGPQLQLRFAQASKSVDKCIDDLDFYVYRYQSYGKTFIKSCQVSPDVYIQLALQLAHYKLYGRLVATYESASTRRFLHGRVDCIRAASTEALEWAKAMCQGEGANVPLESDREDEEESRKKDHLRELFRCAVARQTEVMVKNILGNGIDIPLLGLREASIEVTGEMHELFKDESYIISQCFLLSTSQVACSTDSFMGYGPVTPRGYGCSYNPHPEQIVFCVSAFYSCEDTSASRYAKSLQDSLDIMRDLL 712          
BLAST of Choline O-acetyltransferase vs. Ensembl Fly
Match: ChAT (gene:FBgn0000303 transcript:FBtr0089367)

HSP 1 Score: 461.455 bits (1186), Expect = 8.687e-152
Identity = 252/619 (40.71%), Postives = 359/619 (58.00%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKD-ELATNINRDPFDHEHIIVACNNQFFVLEITTSAE-RPSEKDLYNQLRRIVRLAESEKTEEV-VGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELT----KAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKW----CTSMTADTPA------------------SDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            Y+  + P+ T    E+TK L+ +F  P GIG +L   LL+  + ++NW    WL +MY+   + LPINS+PGMVFP + F+   +   FAA L+ GIL ++ ++D   LP++RA    K QP CM QYYRL  S R PGV +D +   +  R   +  H++V C NQ + + +  S   + SE ++ +Q+  ++  A     + V VG+LTA PR  WA  R+ L  D  N++++E+IE +  +LC+D+P+   FN       T    +AG RD  N A +++HG GSEYN  NRW+DKTMQ +I  DG  GL YEHS +EGIAV++L+E I   +EE              L PP++LE+++        ++A + +    D+LD Y+ RYQ +G+ F K+  +SPD +IQLALQL HYK++  LV TYESAS RRF  GRVD IRAAS  AL+W    C    A+ P                   S D    L R A+  QT+VM+  I G+G+D  LLGL+EA++E+  E+ ELFKD++Y+ S  F LSTSQV    D+FM YG V   GYG +YNPH   I+  +S +  C DT A  +A+ L++S D M  LL
Sbjct:  103 YIRALEPITTPAQLERTKELIRQFSAPQGIGARLHQYLLDKREAEDNWAYYYWLNEMYMDIRIPLPINSNPGMVFPPRRFKTVHDVAHFAARLLDGILSHREMLDSGELPLERAASREKNQPLCMAQYYRLLGSCRRPGVKQDSQFLPSRERLNDEDRHVVVICRNQMYCVVLQASDRGKLSESEIASQILYVLSDAPCLPAKPVPVGLLTAEPRSTWARDREMLQEDERNQRNLELIETAQVVLCLDEPLAGNFNARGFTGATPTVHRAGDRDETNMAHEMIHGGGSEYNSGNRWFDKTMQLIICTDGTWGLCYEHSCSEGIAVVQLLEKIYKKIEEHPDEDNGLPQH--HLPPPERLEWHVGPQLQLRFAQASKSVDKCIDDLDFYVYRYQSYGKTFIKSCQVSPDVYIQLALQLAHYKLYGRLVATYESASTRRFLHGRVDCIRAASTEALEWAKAMCQGEGANVPLESDREDEEESRKVKFSIYSKDHLRELFRCAVARQTEVMVKNILGNGIDIPLLGLREASIEVTGEMHELFKDESYIISQCFLLSTSQVACSTDSFMGYGPVTPRGYGCSYNPHPEQIVFCVSAFYSCEDTSASRYAKSLQDSLDIMRDLL 719          
BLAST of Choline O-acetyltransferase vs. Ensembl Fly
Match: CRAT (gene:FBgn0037440 transcript:FBtr0347005)

HSP 1 Score: 328.176 bits (840), Expect = 9.974e-102
Identity = 200/603 (33.17%), Postives = 324/603 (53.73%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEI-TTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFA-SQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNR 1948
            R++  V P++T E++++ K +  EF K  G   +LQ  L E   +++NW+A  WL+  YL     + +  SPGM FPKQ+F++ +  + + A +I G+ ++  ++    +P+ +   N         Q+ ++F + R P    DE+  N      D ++++V   N F+ L+I +   +  +   L  QL  IV L E++      GILT   R  WA   ++L+    N+ +++ I+ ++F + +D          E   L +    D +   L L+HG GS+ N  NRW DKT+Q V++ +GN G  YEHS AEG  +  ++++++  M+E  S      S   D  P +K++++  + +  + ++ A++ +  LAD L + +L++  FG+DF K   + PDSF+Q+ALQL  YK+H      YESA +R F  GR + IR+ S  +L +  +M  D   +D E+   LR A+          +QG GVD HLLGLK  A+E +  I E FK   +++S+ FR+STSQV T  DAFM YG   + GY   YNP  N II+AIS W  CP T    F + L++SF EM ++L  N    K++
Sbjct:   64 RFMTTVEPLLTPEEFQRQKGITSEFLKKQG--RELQLLLEETGSKEKNWLAHRWLKAAYLTYRDPVTVFVSPGMTFPKQNFRDSRAFVDYTARVIYGLGEFNDMVHANKIPIVKMGKNELDN----SQFGKVFGTCRIPRRGTDEIVYNP-----DSDYVVVIYKNHFYQLKIYSKEGKLIAAPCLAAQLENIV-LKETQ-VGVPYGILTTDSRDNWAEAYEYLVETPGNRDALKTIQGALFTVSLD----------EGTILKEGEETDEL--ILSLIHGSGSKINSGNRWMDKTIQLVVNPNGNVGFTYEHSPAEGQPIAMMMDYVVQKMKEDPS---FGQSGSQDFAPAQKIQFSSSNKSLEKSLNVAQENVDKLADALQMKVLKFNGFGKDFIKKQRLGPDSFVQMALQLAFYKMHSEPPAQYESAHLRIFDGGRTETIRSCSNESLAFSRAMQ-DPNVTDQERAAKLREAVVSHQTYAKLALQGKGVDRHLLGLKLMALEHSKPIPEFFKSPGFVKSSHFRMSTSQVATKYDAFMGYGPATDDGYACCYNPRDNDIILAISAWRHCPITDHLKFVKTLEQSFFEMKNVLEKNPPETKSK 637          
BLAST of Choline O-acetyltransferase vs. Ensembl Fly
Match: CRAT (gene:FBgn0037440 transcript:FBtr0110774)

HSP 1 Score: 328.176 bits (840), Expect = 1.757e-101
Identity = 200/603 (33.17%), Postives = 324/603 (53.73%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEI-TTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFA-SQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNR 1948
            R++  V P++T E++++ K +  EF K  G   +LQ  L E   +++NW+A  WL+  YL     + +  SPGM FPKQ+F++ +  + + A +I G+ ++  ++    +P+ +   N         Q+ ++F + R P    DE+  N      D ++++V   N F+ L+I +   +  +   L  QL  IV L E++      GILT   R  WA   ++L+    N+ +++ I+ ++F + +D          E   L +    D +   L L+HG GS+ N  NRW DKT+Q V++ +GN G  YEHS AEG  +  ++++++  M+E  S      S   D  P +K++++  + +  + ++ A++ +  LAD L + +L++  FG+DF K   + PDSF+Q+ALQL  YK+H      YESA +R F  GR + IR+ S  +L +  +M  D   +D E+   LR A+          +QG GVD HLLGLK  A+E +  I E FK   +++S+ FR+STSQV T  DAFM YG   + GY   YNP  N II+AIS W  CP T    F + L++SF EM ++L  N    K++
Sbjct:   83 RFMTTVEPLLTPEEFQRQKGITSEFLKKQG--RELQLLLEETGSKEKNWLAHRWLKAAYLTYRDPVTVFVSPGMTFPKQNFRDSRAFVDYTARVIYGLGEFNDMVHANKIPIVKMGKNELDN----SQFGKVFGTCRIPRRGTDEIVYNP-----DSDYVVVIYKNHFYQLKIYSKEGKLIAAPCLAAQLENIV-LKETQ-VGVPYGILTTDSRDNWAEAYEYLVETPGNRDALKTIQGALFTVSLD----------EGTILKEGEETDEL--ILSLIHGSGSKINSGNRWMDKTIQLVVNPNGNVGFTYEHSPAEGQPIAMMMDYVVQKMKEDPS---FGQSGSQDFAPAQKIQFSSSNKSLEKSLNVAQENVDKLADALQMKVLKFNGFGKDFIKKQRLGPDSFVQMALQLAFYKMHSEPPAQYESAHLRIFDGGRTETIRSCSNESLAFSRAMQ-DPNVTDQERAAKLREAVVSHQTYAKLALQGKGVDRHLLGLKLMALEHSKPIPEFFKSPGFVKSSHFRMSTSQVATKYDAFMGYGPATDDGYACCYNPRDNDIILAISAWRHCPITDHLKFVKTLEQSFFEMKNVLEKNPPETKSK 656          
BLAST of Choline O-acetyltransferase vs. Ensembl Fly
Match: CRAT (gene:FBgn0037440 transcript:FBtr0081734)

HSP 1 Score: 328.176 bits (840), Expect = 2.218e-101
Identity = 200/603 (33.17%), Postives = 324/603 (53.73%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEI-TTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFA-SQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNR 1948
            R++  V P++T E++++ K +  EF K  G   +LQ  L E   +++NW+A  WL+  YL     + +  SPGM FPKQ+F++ +  + + A +I G+ ++  ++    +P+ +   N         Q+ ++F + R P    DE+  N      D ++++V   N F+ L+I +   +  +   L  QL  IV L E++      GILT   R  WA   ++L+    N+ +++ I+ ++F + +D          E   L +    D +   L L+HG GS+ N  NRW DKT+Q V++ +GN G  YEHS AEG  +  ++++++  M+E  S      S   D  P +K++++  + +  + ++ A++ +  LAD L + +L++  FG+DF K   + PDSF+Q+ALQL  YK+H      YESA +R F  GR + IR+ S  +L +  +M  D   +D E+   LR A+          +QG GVD HLLGLK  A+E +  I E FK   +++S+ FR+STSQV T  DAFM YG   + GY   YNP  N II+AIS W  CP T    F + L++SF EM ++L  N    K++
Sbjct:   88 RFMTTVEPLLTPEEFQRQKGITSEFLKKQG--RELQLLLEETGSKEKNWLAHRWLKAAYLTYRDPVTVFVSPGMTFPKQNFRDSRAFVDYTARVIYGLGEFNDMVHANKIPIVKMGKNELDN----SQFGKVFGTCRIPRRGTDEIVYNP-----DSDYVVVIYKNHFYQLKIYSKEGKLIAAPCLAAQLENIV-LKETQ-VGVPYGILTTDSRDNWAEAYEYLVETPGNRDALKTIQGALFTVSLD----------EGTILKEGEETDEL--ILSLIHGSGSKINSGNRWMDKTIQLVVNPNGNVGFTYEHSPAEGQPIAMMMDYVVQKMKEDPS---FGQSGSQDFAPAQKIQFSSSNKSLEKSLNVAQENVDKLADALQMKVLKFNGFGKDFIKKQRLGPDSFVQMALQLAFYKMHSEPPAQYESAHLRIFDGGRTETIRSCSNESLAFSRAMQ-DPNVTDQERAAKLREAVVSHQTYAKLALQGKGVDRHLLGLKLMALEHSKPIPEFFKSPGFVKSSHFRMSTSQVATKYDAFMGYGPATDDGYACCYNPRDNDIILAISAWRHCPITDHLKFVKTLEQSFFEMKNVLEKNPPETKSK 661          
BLAST of Choline O-acetyltransferase vs. Ensembl Zebrafish
Match: chata (choline O-acetyltransferase a [Source:NCBI gene;Acc:100170938])

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 269/590 (45.59%), Postives = 380/590 (64.41%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAE-SEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL 1915
            YL  +  +V  + + KTK +VE+FG PGG+GE LQ KLLE S++K NWV D WLEDMYL N LALP+NSSP MVF KQ+F+ + + LRFAANLI+G+L+YK +ID R LPV+ A     G P CM+QY ++F+SYR PG   D L    +    + EHIIVAC NQFFVL++  +  R +EKDLY QL RI ++A+  E+ +  +G+LT+  R +WA  R  L+ D TN+ S++MIE+ + ++C+D+      N              + N AL +LHG G++ NG NRWYDK MQFVI ADG CG+  EHS  EGI +++  E++L YM    S +L R +S+ +L  P++L +         +S +   ++ L  NLD+ + ++  +G++F K   MSPD+++Q+ALQ T Y+ H  LVPTYESASIRRF  GRVDNIR+++  AL +  +M + +  +D EK+ LL +A++ QT   +  I G  +DNHLLGL+E A E+ +E  ELF D TY  S  F LSTSQVPT ++ F CYG VV +GYGA YNP  + I+  +S + +C +T +D+F + L+    EM  L
Sbjct:   33 YLTCMGHLVPEDQFRKTKAVVEKFGAPGGVGETLQKKLLERSEQKANWVYDYWLEDMYLNNRLALPVNSSPVMVFHKQNFKGQSDVLRFAANLISGVLEYKALIDGRALPVEHARGQLAGTPLCMDQYNKVFTSYRLPGTKTDTLVAQKSTVMPEPEHIIVACKNQFFVLDVMVNFRRLNEKDLYTQLERIRKMADIEEERQPPIGLLTSDGRTQWAEARNILIKDSTNRDSLDMIERCLCLVCLDEETATELN--------------DSNRALLMLHGGGTDKNGGNRWYDKPMQFVIGADGCCGVVCEHSPFEGIVLVQCSEYLLRYMRGSPS-KLVRAASMSELPAPRRLRWKCSPDIQTFLSASADRLQKLVKNLDMNVHKFTGYGKEFIKRQKMSPDAYVQVALQFTFYRCHGRLVPTYESASIRRFQEGRVDNIRSSTPEALAFVKAMASGSKITDAEKMELLWTAIKAQTNYTILAITGMAIDNHLLGLREIAKELKLEKPELFSDTTYATSIHFTLSTSQVPTTEEMFCCYGPVVPNGYGACYNPQTDHILFCVSSFRECAETSSDLFVKTLEGCLKEMQDL 607          
BLAST of Choline O-acetyltransferase vs. Ensembl Zebrafish
Match: chata (choline O-acetyltransferase a [Source:NCBI gene;Acc:100170938])

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 269/590 (45.59%), Postives = 380/590 (64.41%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAE-SEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL 1915
            YL  +  +V  + + KTK +VE+FG PGG+GE LQ KLLE S++K NWV D WLEDMYL N LALP+NSSP MVF KQ+F+ + + LRFAANLI+G+L+YK +ID R LPV+ A     G P CM+QY ++F+SYR PG   D L    +    + EHIIVAC NQFFVL++  +  R +EKDLY QL RI ++A+  E+ +  +G+LT+  R +WA  R  L+ D TN+ S++MIE+ + ++C+D+      N              + N AL +LHG G++ NG NRWYDK MQFVI ADG CG+  EHS  EGI +++  E++L YM    S +L R +S+ +L  P++L +         +S +   ++ L  NLD+ + ++  +G++F K   MSPD+++Q+ALQ T Y+ H  LVPTYESASIRRF  GRVDNIR+++  AL +  +M + +  +D EK+ LL +A++ QT   +  I G  +DNHLLGL+E A E+ +E  ELF D TY  S  F LSTSQVPT ++ F CYG VV +GYGA YNP  + I+  +S + +C +T +D+F + L+    EM  L
Sbjct:   33 YLTCMGHLVPEDQFRKTKAVVEKFGAPGGVGETLQKKLLERSEQKANWVYDYWLEDMYLNNRLALPVNSSPVMVFHKQNFKGQSDVLRFAANLISGVLEYKALIDGRALPVEHARGQLAGTPLCMDQYNKVFTSYRLPGTKTDTLVAQKSTVMPEPEHIIVACKNQFFVLDVMVNFRRLNEKDLYTQLERIRKMADIEEERQPPIGLLTSDGRTQWAEARNILIKDSTNRDSLDMIERCLCLVCLDEETATELN--------------DSNRALLMLHGGGTDKNGGNRWYDKPMQFVIGADGCCGVVCEHSPFEGIVLVQCSEYLLRYMRGSPS-KLVRAASMSELPAPRRLRWKCSPDIQTFLSASADRLQKLVKNLDMNVHKFTGYGKEFIKRQKMSPDAYVQVALQFTFYRCHGRLVPTYESASIRRFQEGRVDNIRSSTPEALAFVKAMASGSKITDAEKMELLWTAIKAQTNYTILAITGMAIDNHLLGLREIAKELKLEKPELFSDTTYATSIHFTLSTSQVPTTEEMFCCYGPVVPNGYGACYNPQTDHILFCVSSFRECAETSSDLFVKTLEGCLKEMQDL 607          
BLAST of Choline O-acetyltransferase vs. Ensembl Zebrafish
Match: crata (carnitine O-acetyltransferase a [Source:ZFIN;Acc:ZDB-GENE-040927-17])

HSP 1 Score: 446.047 bits (1146), Expect = 5.086e-147
Identity = 238/592 (40.20%), Postives = 354/592 (59.80%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKD-LYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            RYL  + P+V  E+   T+ L+E+F KPGG+GE+LQ  L   + +  NW++D WL+  YL   + + ++SSPG+V P+  F + + Q+R+AA LIAG+LD+K++ID   LP++       G+P CM QYY++ SS R PG TK +   N   D     HI V  N QFFVL++  S   P   D +Y QL +I   +  +  +E +GILT+  R  W     +L+ D TNK+S+  I+KSIF +C+D P+P      + +  T+AG+        Q+LHG GS +N  NRW+DKT+QF+I  DG CGL YEH+ AEG  ++ +++H+++YM++ +  R    + +  L  P+KL +NI     + I +AKQ +  +  +LD+ +  +  FG++FPK+  MSPD+FIQ+ALQL +Y+I+K   PTYESAS+R F LGR D IR+AS  +  +  +M  D    + EK+ LL  A++         I+G  +D HLLGLK  A+E    + E+F D +Y  +  + LSTSQVP   D  MC+G VV  GYG  YNP    I  A+S +  C DT A   AQ L+++  +M +LL
Sbjct:   41 RYLAALDPIVDPEELNHTRKLLEDFQKPGGVGERLQKGLESRAAKLNNWLSDWWLQTAYLDYRMPVVVHSSPGVVLPRMEFSDRQGQMRYAAKLIAGVLDFKSMIDNETLPLEYL----GGKPLCMHQYYQVLSSCRIPG-TKRDTVVNYAMDKRPSTHITVVHNFQFFVLDVYNSDGTPLTVDQIYIQLEKIWN-SSLQTNKEPIGILTSNHRNSWGKAYNNLIKDKTNKESVRAIQKSIFTVCLDAPMP---RASDDMYRTRAGV--------QMLHGGGSRWNSGNRWFDKTLQFIIGEDGTCGLIYEHAPAEGPPIVSILDHVVEYMKKSEMVR----TPMVPLRMPQKLRFNITPEIKKDIEDAKQNMNIMVHDLDLRVNVFTHFGKNFPKSQKMSPDAFIQMALQLAYYRIYKRCCPTYESASLRMFRLGRTDTIRSASSDSASFVKAMD-DPVKHNTEKVALLDKAVKAHRSYTDMAIRGQAIDRHLLGLKLQAIEDLAALPEIFMDTSYAVALHYNLSTSQVPAKTDCVMCFGPVVPDGYGVCYNPMDTHINFAVSAFNSCQDTNAVRLAQGLEDALLDMRTLL 610          
BLAST of Choline O-acetyltransferase vs. Ensembl Zebrafish
Match: crata (carnitine O-acetyltransferase a [Source:ZFIN;Acc:ZDB-GENE-040927-17])

HSP 1 Score: 446.432 bits (1147), Expect = 5.164e-147
Identity = 238/592 (40.20%), Postives = 354/592 (59.80%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKD-LYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            RYL  + P+V  E+   T+ L+E+F KPGG+GE+LQ  L   + +  NW++D WL+  YL   + + ++SSPG+V P+  F + + Q+R+AA LIAG+LD+K++ID   LP++       G+P CM QYY++ SS R PG TK +   N   D     HI V  N QFFVL++  S   P   D +Y QL +I   +  +  +E +GILT+  R  W     +L+ D TNK+S+  I+KSIF +C+D P+P      + +  T+AG+        Q+LHG GS +N  NRW+DKT+QF+I  DG CGL YEH+ AEG  ++ +++H+++YM++ +  R    + +  L  P+KL +NI     + I +AKQ +  +  +LD+ +  +  FG++FPK+  MSPD+FIQ+ALQL +Y+I+K   PTYESAS+R F LGR D IR+AS  +  +  +M  D    + EK+ LL  A++         I+G  +D HLLGLK  A+E    + E+F D +Y  +  + LSTSQVP   D  MC+G VV  GYG  YNP    I  A+S +  C DT A   AQ L+++  +M +LL
Sbjct:   54 RYLAALDPIVDPEELNHTRKLLEDFQKPGGVGERLQKGLESRAAKLNNWLSDWWLQTAYLDYRMPVVVHSSPGVVLPRMEFSDRQGQMRYAAKLIAGVLDFKSMIDNETLPLEYL----GGKPLCMHQYYQVLSSCRIPG-TKRDTVVNYAMDKRPSTHITVVHNFQFFVLDVYNSDGTPLTVDQIYIQLEKIWN-SSLQTNKEPIGILTSNHRNSWGKAYNNLIKDKTNKESVRAIQKSIFTVCLDAPMP---RASDDMYRTRAGV--------QMLHGGGSRWNSGNRWFDKTLQFIIGEDGTCGLIYEHAPAEGPPIVSILDHVVEYMKKSEMVR----TPMVPLRMPQKLRFNITPEIKKDIEDAKQNMNIMVHDLDLRVNVFTHFGKNFPKSQKMSPDAFIQMALQLAYYRIYKRCCPTYESASLRMFRLGRTDTIRSASSDSASFVKAMD-DPVKHNTEKVALLDKAVKAHRSYTDMAIRGQAIDRHLLGLKLQAIEDLAALPEIFMDTSYAVALHYNLSTSQVPAKTDCVMCFGPVVPDGYGVCYNPMDTHINFAVSAFNSCQDTNAVRLAQGLEDALLDMRTLL 623          
BLAST of Choline O-acetyltransferase vs. Ensembl Zebrafish
Match: crata (carnitine O-acetyltransferase a [Source:ZFIN;Acc:ZDB-GENE-040927-17])

HSP 1 Score: 446.432 bits (1147), Expect = 5.164e-147
Identity = 238/592 (40.20%), Postives = 354/592 (59.80%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKD-LYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            RYL  + P+V  E+   T+ L+E+F KPGG+GE+LQ  L   + +  NW++D WL+  YL   + + ++SSPG+V P+  F + + Q+R+AA LIAG+LD+K++ID   LP++       G+P CM QYY++ SS R PG TK +   N   D     HI V  N QFFVL++  S   P   D +Y QL +I   +  +  +E +GILT+  R  W     +L+ D TNK+S+  I+KSIF +C+D P+P      + +  T+AG+        Q+LHG GS +N  NRW+DKT+QF+I  DG CGL YEH+ AEG  ++ +++H+++YM++ +  R    + +  L  P+KL +NI     + I +AKQ +  +  +LD+ +  +  FG++FPK+  MSPD+FIQ+ALQL +Y+I+K   PTYESAS+R F LGR D IR+AS  +  +  +M  D    + EK+ LL  A++         I+G  +D HLLGLK  A+E    + E+F D +Y  +  + LSTSQVP   D  MC+G VV  GYG  YNP    I  A+S +  C DT A   AQ L+++  +M +LL
Sbjct:   54 RYLAALDPIVDPEELNHTRKLLEDFQKPGGVGERLQKGLESRAAKLNNWLSDWWLQTAYLDYRMPVVVHSSPGVVLPRMEFSDRQGQMRYAAKLIAGVLDFKSMIDNETLPLEYL----GGKPLCMHQYYQVLSSCRIPG-TKRDTVVNYAMDKRPSTHITVVHNFQFFVLDVYNSDGTPLTVDQIYIQLEKIWN-SSLQTNKEPIGILTSNHRNSWGKAYNNLIKDKTNKESVRAIQKSIFTVCLDAPMP---RASDDMYRTRAGV--------QMLHGGGSRWNSGNRWFDKTLQFIIGEDGTCGLIYEHAPAEGPPIVSILDHVVEYMKKSEMVR----TPMVPLRMPQKLRFNITPEIKKDIEDAKQNMNIMVHDLDLRVNVFTHFGKNFPKSQKMSPDAFIQMALQLAYYRIYKRCCPTYESASLRMFRLGRTDTIRSASSDSASFVKAMD-DPVKHNTEKVALLDKAVKAHRSYTDMAIRGQAIDRHLLGLKLQAIEDLAALPEIFMDTSYAVALHYNLSTSQVPAKTDCVMCFGPVVPDGYGVCYNPMDTHINFAVSAFNSCQDTNAVRLAQGLEDALLDMRTLL 623          
BLAST of Choline O-acetyltransferase vs. Ensembl Xenopus
Match: CHAT (choline O-acetyltransferase [Source:NCBI gene;Acc:100485221])

HSP 1 Score: 526.168 bits (1354), Expect = 6.995e-178
Identity = 278/612 (45.42%), Postives = 393/612 (64.22%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEV---VGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMT-ADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL-LTSNLELAKNRKAVKVQD 1969
            YL  +  +VT E Y+K+K +V+ F  PGG GE LQ KLLE  ++ ENW+   WL+DMYL N L LP+NSSP ++F + +F++  +QLRFAANLI+G+LDYKT++D + LPVD A     GQP CM+QYY LFSSYR PG  KD L    +    + EHIIVACNNQFFVL++  +  R SE DL+ QL +I R+A++E  EE+   +G+LT+  R +WA  R+ L+ D TN+ S++MIE+ + I+C+D P  +  N              + N ALQLLHG G   NG NRWYDK MQFV+ +DG CG   EHS  +GI +++  EH+L YM+    ++L R  SV +L  P++L +         ++ +  +++ + +NLD  + +++ +G++F K   MSPD+FIQ+ALQL  Y+ H+ LVPTYESASIRRF +GRVDNIR+++  AL +  +M   +T  ++ EK+  LR+A++ QT+  +  I G  +DNHLL L+E A E   E+ ELF+D+ YL SN+F LSTSQVPT  + F CYG VV +GYG  YNP    I+  +S + DC DT +  FA+ ++ES   M  L L  N E+    K  K Q+
Sbjct:   32 YLKCMKHLVTEEQYQKSKAVVDAFMMPGGEGETLQEKLLERREKMENWIHLYWLDDMYLNNRLPLPVNSSPAVIFARHNFRDTNDQLRFAANLISGVLDYKTMLDSQALPVDFARGQLSGQPMCMKQYYGLFSSYRLPGTIKDTLVAQESTIMPEPEHIIVACNNQFFVLDVVINFRRLSEGDLFTQLCKIDRMAKNE--EEMLPPIGLLTSDGRAEWAHARETLMKDSTNRDSLDMIERCMCIVCLDAPTKMELN--------------DTNRALQLLHGGGIGRNGGNRWYDKPMQFVVGSDGVCGTICEHSPFDGIVLVQCTEHLLKYMKN-SPKKLVRADSVSELPAPRRLRWKCSPEIQGHLASSANKLQRIVNNLDFIVYKFKNYGKEFIKKQRMSPDAFIQVALQLAFYRCHRKLVPTYESASIRRFQMGRVDNIRSSTAEALAFVNAMVDGETTVTNIEKMEYLRAAIKSQTEYTIQAITGMAIDNHLLALRELAQEHFKELPELFRDEMYLTSNRFILSTSQVPTTMEMFCCYGPVVPNGYGCCYNPQPEHILFCVSSFHDCKDTSSSKFAKAVEESLLAMGDLCLKCNCEVQTPVKEKKAQN 626          
BLAST of Choline O-acetyltransferase vs. Ensembl Xenopus
Match: CHAT (choline O-acetyltransferase [Source:NCBI gene;Acc:100485221])

HSP 1 Score: 524.628 bits (1350), Expect = 1.563e-177
Identity = 278/611 (45.50%), Postives = 392/611 (64.16%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEV---VGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL-LTSNLELAKNRKAVKVQD 1969
            YL  +  +VT E Y+K+K +V+ F  PGG GE LQ KLLE  ++ ENW+   WL+DMYL N L LP+NSSP ++F + +F++  +QLRFAANLI+G+LDYKT++D + LPVD A     GQP CM+QYY LFSSYR PG  KD L    +    + EHIIVACNNQFFVL++  +  R SE DL+ QL +I R+A++E  EE+   +G+LT+  R +WA  R+ L+ D TN+ S++MIE+ + I+C+D P  +  N              + N ALQLLHG G   NG NRWYDK MQFV+ +DG CG   EHS  +GI +++  EH+L YM+    ++L R  SV +L  P++L +         ++ +  +++ + +NLD  + +++ +G++F K   MSPD+FIQ+ALQL  Y+ H+ LVPTYESASIRRF +GRVDNIR+++  AL +  +M  D   ++ EK+  LR+A++ QT+  +  I G  +DNHLL L+E A E   E+ ELF+D+ YL SN+F LSTSQVPT  + F CYG VV +GYG  YNP    I+  +S + DC DT +  FA+ ++ES   M  L L  N E+    K  K Q+
Sbjct:   17 YLKCMKHLVTEEQYQKSKAVVDAFMMPGGEGETLQEKLLERREKMENWIHLYWLDDMYLNNRLPLPVNSSPAVIFARHNFRDTNDQLRFAANLISGVLDYKTMLDSQALPVDFARGQLSGQPMCMKQYYGLFSSYRLPGTIKDTLVAQESTIMPEPEHIIVACNNQFFVLDVVINFRRLSEGDLFTQLCKIDRMAKNE--EEMLPPIGLLTSDGRAEWAHARETLMKDSTNRDSLDMIERCMCIVCLDAPTKMELN--------------DTNRALQLLHGGGIGRNGGNRWYDKPMQFVVGSDGVCGTICEHSPFDGIVLVQCTEHLLKYMKN-SPKKLVRADSVSELPAPRRLRWKCSPEIQGHLASSANKLQRIVNNLDFIVYKFKNYGKEFIKKQRMSPDAFIQVALQLAFYRCHRKLVPTYESASIRRFQMGRVDNIRSSTAEALAFVNAMV-DGETTNIEKMEYLRAAIKSQTEYTIQAITGMAIDNHLLALRELAQEHFKELPELFRDEMYLTSNRFILSTSQVPTTMEMFCCYGPVVPNGYGCCYNPQPEHILFCVSSFHDCKDTSSSKFAKAVEESLLAMGDLCLKCNCEVQTPVKEKKAQN 609          
BLAST of Choline O-acetyltransferase vs. Ensembl Xenopus
Match: CHAT (choline O-acetyltransferase [Source:NCBI gene;Acc:100485221])

HSP 1 Score: 492.656 bits (1267), Expect = 2.099e-165
Identity = 269/611 (44.03%), Postives = 370/611 (60.56%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEV---VGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL-LTSNLELAKNRKAVKVQD 1969
            YL  +  +VT E Y+K+K +V+ F  PGG GE LQ KLLE  ++ ENW+   WL+DMYL N L LP+NSSP ++F + +F++  +QLRFAANLI+G+LDYKT++D + LPVD A     GQP CM+QYY LFSSYR PG  KD L    +    + EHIIVACNNQFFVL++  +  R SE DL+ QL +I R+A++E  EE+   +G+LT+  R +WA  R+ L+ D TN+ S++MIE+ + I+C+D P  +  N              + N ALQLLHG G   NG NRWYDK MQFV+ +DG CG   EHS  +GI +++  EH+L YM+    ++L R  SV +L  P++L +         ++ +  +++ + +NLD  + +++ +G++F K   MSPD+FIQ+ALQL  Y+ H+ LVPTYESASIRRF +GRVDNIR   I A                                    I G  +DNHLL L+E A E   E+ ELF+D+ YL SN+F LSTSQVPT  + F CYG VV +GYG  YNP    I+  +S + DC DT +  FA+ ++ES   M  L L  N E+    K  K Q+
Sbjct:   23 YLKCMKHLVTEEQYQKSKAVVDAFMMPGGEGETLQEKLLERREKMENWIHLYWLDDMYLNNRLPLPVNSSPAVIFARHNFRDTNDQLRFAANLISGVLDYKTMLDSQALPVDFARGQLSGQPMCMKQYYGLFSSYRLPGTIKDTLVAQESTIMPEPEHIIVACNNQFFVLDVVINFRRLSEGDLFTQLCKIDRMAKNE--EEMLPPIGLLTSDGRAEWAHARETLMKDSTNRDSLDMIERCMCIVCLDAPTKMELN--------------DTNRALQLLHGGGIGRNGGNRWYDKPMQFVVGSDGVCGTICEHSPFDGIVLVQCTEHLLKYMKN-SPKKLVRADSVSELPAPRRLRWKCSPEIQGHLASSANKLQRIVNNLDFIVYKFKNYGKEFIKKQRMSPDAFIQVALQLAFYRCHRKLVPTYESASIRRFQMGRVDNIRLLKIFA------------------------------------ITGMAIDNHLLALRELAQEHFKELPELFRDEMYLTSNRFILSTSQVPTTMEMFCCYGPVVPNGYGCCYNPQPEHILFCVSSFHDCKDTSSSKFAKAVEESLLAMGDLCLKCNCEVQTPVKEKKAQN 580          
BLAST of Choline O-acetyltransferase vs. Ensembl Xenopus
Match: CHAT (choline O-acetyltransferase [Source:NCBI gene;Acc:100485221])

HSP 1 Score: 492.656 bits (1267), Expect = 2.445e-165
Identity = 269/611 (44.03%), Postives = 370/611 (60.56%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEV---VGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL-LTSNLELAKNRKAVKVQD 1969
            YL  +  +VT E Y+K+K +V+ F  PGG GE LQ KLLE  ++ ENW+   WL+DMYL N L LP+NSSP ++F + +F++  +QLRFAANLI+G+LDYKT++D + LPVD A     GQP CM+QYY LFSSYR PG  KD L    +    + EHIIVACNNQFFVL++  +  R SE DL+ QL +I R+A++E  EE+   +G+LT+  R +WA  R+ L+ D TN+ S++MIE+ + I+C+D P  +  N              + N ALQLLHG G   NG NRWYDK MQFV+ +DG CG   EHS  +GI +++  EH+L YM+    ++L R  SV +L  P++L +         ++ +  +++ + +NLD  + +++ +G++F K   MSPD+FIQ+ALQL  Y+ H+ LVPTYESASIRRF +GRVDNIR   I A                                    I G  +DNHLL L+E A E   E+ ELF+D+ YL SN+F LSTSQVPT  + F CYG VV +GYG  YNP    I+  +S + DC DT +  FA+ ++ES   M  L L  N E+    K  K Q+
Sbjct:   29 YLKCMKHLVTEEQYQKSKAVVDAFMMPGGEGETLQEKLLERREKMENWIHLYWLDDMYLNNRLPLPVNSSPAVIFARHNFRDTNDQLRFAANLISGVLDYKTMLDSQALPVDFARGQLSGQPMCMKQYYGLFSSYRLPGTIKDTLVAQESTIMPEPEHIIVACNNQFFVLDVVINFRRLSEGDLFTQLCKIDRMAKNE--EEMLPPIGLLTSDGRAEWAHARETLMKDSTNRDSLDMIERCMCIVCLDAPTKMELN--------------DTNRALQLLHGGGIGRNGGNRWYDKPMQFVVGSDGVCGTICEHSPFDGIVLVQCTEHLLKYMKN-SPKKLVRADSVSELPAPRRLRWKCSPEIQGHLASSANKLQRIVNNLDFIVYKFKNYGKEFIKKQRMSPDAFIQVALQLAFYRCHRKLVPTYESASIRRFQMGRVDNIRLLKIFA------------------------------------ITGMAIDNHLLALRELAQEHFKELPELFRDEMYLTSNRFILSTSQVPTTMEMFCCYGPVVPNGYGCCYNPQPEHILFCVSSFHDCKDTSSSKFAKAVEESLLAMGDLCLKCNCEVQTPVKEKKAQN 586          
BLAST of Choline O-acetyltransferase vs. Ensembl Xenopus
Match: CHAT (choline O-acetyltransferase [Source:NCBI gene;Acc:100485221])

HSP 1 Score: 488.034 bits (1255), Expect = 4.358e-163
Identity = 265/612 (43.30%), Postives = 378/612 (61.76%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEV---VGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMT-ADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL-LTSNLELAKNRKAVKVQD 1969
            YL  +  +VT E Y+K+K +V+ F  PGG GE LQ KLLE  ++ ENW+   WL+DMYL N L LP+NSSP ++F + +F++  +QLR+                ++ LPVD A     GQP CM+QYY LFSSYR PG  KD L    +    + EHIIVACNNQFFVL++  +  R SE DL+ QL +I R+A++E  EE+   +G+LT+  R +WA  R+ L+ D TN+ S++MIE+ + I+C+D P  +  N              + N ALQLLHG G   NG NRWYDK MQFV+ +DG CG   EHS  +GI +++  EH+L YM+    ++L R  SV +L  P++L +         ++ +  +++ + +NLD  + +++ +G++F K   MSPD+FIQ+ALQL  Y+ H+ LVPTYESASIRRF +GRVDNIR+++  AL +  +M   +T  ++ EK+  LR+A++ QT+  +  I G  +DNHLL L+E A E   E+ ELF+D+ YL SN+F LSTSQVPT  + F CYG VV +GYG  YNP    I+  +S + DC DT +  FA+ ++ES   M  L L  N E+    K  K Q+
Sbjct:   38 YLKCMKHLVTEEQYQKSKAVVDAFMMPGGEGETLQEKLLERREKMENWIHLYWLDDMYLNNRLPLPVNSSPAVIFARHNFRDTNDQLRYENEAFF----------LQALPVDFARGQLSGQPMCMKQYYGLFSSYRLPGTIKDTLVAQESTIMPEPEHIIVACNNQFFVLDVVINFRRLSEGDLFTQLCKIDRMAKNE--EEMLPPIGLLTSDGRAEWAHARETLMKDSTNRDSLDMIERCMCIVCLDAPTKMELN--------------DTNRALQLLHGGGIGRNGGNRWYDKPMQFVVGSDGVCGTICEHSPFDGIVLVQCTEHLLKYMKN-SPKKLVRADSVSELPAPRRLRWKCSPEIQGHLASSANKLQRIVNNLDFIVYKFKNYGKEFIKKQRMSPDAFIQVALQLAFYRCHRKLVPTYESASIRRFQMGRVDNIRSSTAEALAFVNAMVDGETTVTNIEKMEYLRAAIKSQTEYTIQAITGMAIDNHLLALRELAQEHFKELPELFRDEMYLTSNRFILSTSQVPTTMEMFCCYGPVVPNGYGCCYNPQPEHILFCVSSFHDCKDTSSSKFAKAVEESLLAMGDLCLKCNCEVQTPVKEKKAQN 622          
BLAST of Choline O-acetyltransferase vs. Ensembl Mouse
Match: Chat (choline acetyltransferase [Source:MGI Symbol;Acc:MGI:88392])

HSP 1 Score: 527.709 bits (1358), Expect = 2.053e-178
Identity = 265/594 (44.61%), Postives = 379/594 (63.80%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTE-EVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPAS-DDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTS 1924
            YL  +  +V  E + K++ +V+ FG PGG+GE LQ KLLE  ++  NWV++ WL DMYL N LALP+NSSP ++F +QHFQ+  +QLRFAA+LI+G+L YK ++D + +P D A     GQP CM+QYYRLFSSYR PG T+D L    +    + EH+IVAC NQFFVL++  +  R SE DL+ QLR+IV++A +E      +G+LT+  R +WA  R  LL D TN+ S++MIE+ I ++C+D P                G   + + ALQLLHG G   NGANRWYDK++QFV+  DG CG+  EHS  +GI +++  EH+L +M    +++L R  SV +L  P++L +         ++ + ++++ +  NLD  + ++  +G+ F K    SPD FIQ+ALQL +Y++++ LVPTYESASIRRF  GRVDNIR+A+  AL +  +MT    A    EK+ LL+ A++ QT+  +  I G  +DNHLL L+E A ++  E  E+F D+TYL SN+F LSTSQVPT  + F CYG VV +GYGA YNP   +I   IS +  C +T +  FA+ +  S  +M  L +S
Sbjct:   39 YLQCMQHLVPEEQFRKSQAIVKRFGAPGGLGETLQEKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFQDTNDQLRFAASLISGVLSYKALLDSQSIPTDWAKGQLSGQPLCMKQYYRLFSSYRLPGHTQDTLVAQKSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAKARTVLLKDSTNRDSLDMIERCICLVCLDGP--------------GTGDLSDTHRALQLLHGGGCSLNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHM-MTGNKKLVRADSVSELPAPRRLRWKCSPETQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDGFIQVALQLAYYRLYQRLVPTYESASIRRFQEGRVDNIRSATPEALAFVQAMTDHKAAVLASEKLQLLQRAIQAQTEYTVMAITGMAIDNHLLALRELARDLCKEPPEMFMDETYLMSNRFILSTSQVPTTMEMFCCYGPVVPNGYGACYNPQPEAITFCISSFHGCKETSSVEFAEAVGASLVDMRDLCSS 617          
BLAST of Choline O-acetyltransferase vs. Ensembl Mouse
Match: Crat (carnitine acetyltransferase [Source:MGI Symbol;Acc:MGI:109501])

HSP 1 Score: 436.802 bits (1122), Expect = 1.320e-143
Identity = 240/594 (40.40%), Postives = 356/594 (59.93%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKD-LYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSN 1927
            YL  + P+V+ E++  TK LV+EF   GG+GE+LQ  L   +K+ ENW+++ WL+  YL+    + I SSPG++ PKQ F + + QLRFAA LI G+LD+K++ID   LPV+       GQP CM QYY++ SS R PG  +D +  N  +      HI V  N QFF L++  S   P   D ++ QL +I   +  +  +E VGILT+  R  WA    +L+ D  N++S+  I+KSIF +C+DK VP          ++    R++V  A Q+LHG GS++N  NRW+DKT+QF+++ DG+CG+ YEH+ AEG  ++ L++H+++Y    K   L R S +  L  PKKL +NI       I +AKQ +  +  +LDI +L +  FG+DFPK+  +SPD+FIQ+ALQL +Y+I+     TYESAS+R F LGR D IR+ASI +L +   M  D+   + +K+ LLR A++         I+G   D HLLGLK  A+E  + + ++F D +Y  +  F LSTSQVP   D  M +G VV  GYG  YNP +  I  ++S +  C +T A   A  L+++  +M +LL ++
Sbjct:   29 YLKALQPIVSEEEWAHTKQLVDEFQTSGGVGERLQKGLERRAKKMENWLSEWWLKTAYLQFRQPVVIYSSPGVILPKQDFVDLQGQLRFAAKLIEGVLDFKSMIDNETLPVEFLG----GQPLCMNQYYQILSSCRVPGPKQDSV-VNFLKSKRPPTHITVVHNYQFFELDVYHSDGTPLTSDQIFVQLEKIWN-SSLQSNKEPVGILTSNHRNTWAKAYNNLIKDKVNRESVNSIQKSIFTVCLDKQVP---------RVSDDVYRNHV--AGQMLHGGGSKFNSGNRWFDKTLQFIVAEDGSCGMVYEHAAAEGPPIVALVDHVMEY---TKKPELVR-SPMVPLPMPKKLRFNITPEIKNDIEKAKQNLSIMIQDLDIMMLTFHHFGKDFPKSEKLSPDAFIQVALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASIDSLAFVKGM-GDSTVPEQQKVELLRKAVQAHRAYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMFFGPVVPDGYGICYNPMEAHINFSVSAYNSCAETNAARMAHYLEKALLDMRTLLQNH 600          
BLAST of Choline O-acetyltransferase vs. Ensembl Mouse
Match: Crat (carnitine acetyltransferase [Source:MGI Symbol;Acc:MGI:109501])

HSP 1 Score: 436.802 bits (1122), Expect = 2.574e-143
Identity = 240/594 (40.40%), Postives = 356/594 (59.93%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKD-LYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSN 1927
            YL  + P+V+ E++  TK LV+EF   GG+GE+LQ  L   +K+ ENW+++ WL+  YL+    + I SSPG++ PKQ F + + QLRFAA LI G+LD+K++ID   LPV+       GQP CM QYY++ SS R PG  +D +  N  +      HI V  N QFF L++  S   P   D ++ QL +I   +  +  +E VGILT+  R  WA    +L+ D  N++S+  I+KSIF +C+DK VP          ++    R++V  A Q+LHG GS++N  NRW+DKT+QF+++ DG+CG+ YEH+ AEG  ++ L++H+++Y    K   L R S +  L  PKKL +NI       I +AKQ +  +  +LDI +L +  FG+DFPK+  +SPD+FIQ+ALQL +Y+I+     TYESAS+R F LGR D IR+ASI +L +   M  D+   + +K+ LLR A++         I+G   D HLLGLK  A+E  + + ++F D +Y  +  F LSTSQVP   D  M +G VV  GYG  YNP +  I  ++S +  C +T A   A  L+++  +M +LL ++
Sbjct:   50 YLKALQPIVSEEEWAHTKQLVDEFQTSGGVGERLQKGLERRAKKMENWLSEWWLKTAYLQFRQPVVIYSSPGVILPKQDFVDLQGQLRFAAKLIEGVLDFKSMIDNETLPVEFLG----GQPLCMNQYYQILSSCRVPGPKQDSV-VNFLKSKRPPTHITVVHNYQFFELDVYHSDGTPLTSDQIFVQLEKIWN-SSLQSNKEPVGILTSNHRNTWAKAYNNLIKDKVNRESVNSIQKSIFTVCLDKQVP---------RVSDDVYRNHV--AGQMLHGGGSKFNSGNRWFDKTLQFIVAEDGSCGMVYEHAAAEGPPIVALVDHVMEY---TKKPELVR-SPMVPLPMPKKLRFNITPEIKNDIEKAKQNLSIMIQDLDIMMLTFHHFGKDFPKSEKLSPDAFIQVALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASIDSLAFVKGM-GDSTVPEQQKVELLRKAVQAHRAYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMFFGPVVPDGYGICYNPMEAHINFSVSAYNSCAETNAARMAHYLEKALLDMRTLLQNH 621          
BLAST of Choline O-acetyltransferase vs. Ensembl Mouse
Match: Crat (carnitine acetyltransferase [Source:MGI Symbol;Acc:MGI:109501])

HSP 1 Score: 436.802 bits (1122), Expect = 2.574e-143
Identity = 240/594 (40.40%), Postives = 356/594 (59.93%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKD-LYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSN 1927
            YL  + P+V+ E++  TK LV+EF   GG+GE+LQ  L   +K+ ENW+++ WL+  YL+    + I SSPG++ PKQ F + + QLRFAA LI G+LD+K++ID   LPV+       GQP CM QYY++ SS R PG  +D +  N  +      HI V  N QFF L++  S   P   D ++ QL +I   +  +  +E VGILT+  R  WA    +L+ D  N++S+  I+KSIF +C+DK VP          ++    R++V  A Q+LHG GS++N  NRW+DKT+QF+++ DG+CG+ YEH+ AEG  ++ L++H+++Y    K   L R S +  L  PKKL +NI       I +AKQ +  +  +LDI +L +  FG+DFPK+  +SPD+FIQ+ALQL +Y+I+     TYESAS+R F LGR D IR+ASI +L +   M  D+   + +K+ LLR A++         I+G   D HLLGLK  A+E  + + ++F D +Y  +  F LSTSQVP   D  M +G VV  GYG  YNP +  I  ++S +  C +T A   A  L+++  +M +LL ++
Sbjct:   50 YLKALQPIVSEEEWAHTKQLVDEFQTSGGVGERLQKGLERRAKKMENWLSEWWLKTAYLQFRQPVVIYSSPGVILPKQDFVDLQGQLRFAAKLIEGVLDFKSMIDNETLPVEFLG----GQPLCMNQYYQILSSCRVPGPKQDSV-VNFLKSKRPPTHITVVHNYQFFELDVYHSDGTPLTSDQIFVQLEKIWN-SSLQSNKEPVGILTSNHRNTWAKAYNNLIKDKVNRESVNSIQKSIFTVCLDKQVP---------RVSDDVYRNHV--AGQMLHGGGSKFNSGNRWFDKTLQFIVAEDGSCGMVYEHAAAEGPPIVALVDHVMEY---TKKPELVR-SPMVPLPMPKKLRFNITPEIKNDIEKAKQNLSIMIQDLDIMMLTFHHFGKDFPKSEKLSPDAFIQVALQLAYYRIYGQACATYESASLRMFHLGRTDTIRSASIDSLAFVKGM-GDSTVPEQQKVELLRKAVQAHRAYTDRAIRGEAFDRHLLGLKLQAIEDLVSMPDIFMDTSYAIAMHFNLSTSQVPAKTDCVMFFGPVVPDGYGICYNPMEAHINFSVSAYNSCAETNAARMAHYLEKALLDMRTLLQNH 621          
BLAST of Choline O-acetyltransferase vs. Ensembl Mouse
Match: Crot (carnitine O-octanoyltransferase [Source:MGI Symbol;Acc:MGI:1921364])

HSP 1 Score: 243.817 bits (621), Expect = 2.451e-70
Identity = 175/604 (28.97%), Postives = 293/604 (48.51%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQN-----EKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDH--EHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLL-LDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLES---NQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTS 1924
            +YL+ V P    ++Y+KT+ +V++F +  G G++L  KLLE ++ K NW+ + WL   YL   + +P   +   V P  HF++     E  QL   + ++   L+Y  ++    LPV    H     P  M Q+  LFS+ + PG+T+D +      +   H   HI V C  + FV ++       +  +L  QL  I +   +E     +  LT+  R +WA  R++L+ LD  N   +E I+ S+F+  I+   P    H    E ++           ++L G     + + RW DK+   +  A+G  G   +H+  + + ++ +  ++ + + E + R       V D+  P++L + +D      +S+AK +    A +L I    +  FG+   K   + PD+FIQLALQL +Y++H      YE+A  R F  GR + +R+ ++ A++WC SM  D  AS  E+   +  A     K+M D   G G D HLLGL   A E  + + ELF+D  +  S     F LSTS V  L+   +    +V +GYG  Y+   +  +VA S W  CP+T A+   Q +  +F +M  L+ +
Sbjct:   34 KYLESVKPFANEDEYKKTEEIVQKFQE--GAGKRLHQKLLERARGKRNWLEEWWLNVAYLD--VRIPSQLNVNFVGPCPHFEHYWPAREGTQLERGSMMLWHNLNYWQLLRREKLPV----HKSGNTPLDMNQFRMLFSTCKVPGITRDSIMNYFKTESEGHCPTHIAVLCRGRAFVFDVLHEGCLITPPELLRQLTYIHKKCSNEPVGPSIAALTSEERTRWAKAREYLISLDPENLTLLEKIQTSLFVYSIEDSSP----HATPEEYSQV---------FEMLLGG----DPSVRWGDKSYNLISFANGIFGCCCDHAPYDAMVMVNIAHYVDERVLETEGR-WKGSEKVRDIPLPEELVFTVDEKILNDVSQAKAQHLKAASDLQIAASTFTSFGKKLTKEEALHPDTFIQLALQLAYYRLHGRPGCCYETAMTRYFYHGRTETVRSCTVEAVRWCQSMQ-DPSASLLERQQKMLEAFAKHNKMMKDCSHGKGFDRHLLGLLLIAKEEGLPVPELFEDPLFSRSGGGGNFVLSTSLVGYLRVQGVVV-PMVHNGYGFFYHIRDDRFVVACSSWRSCPETDAEKLVQMIFHAFHDMIQLMNT 609          
BLAST of Choline O-acetyltransferase vs. UniProt/SwissProt
Match: sp|P13222|CLAT_PIG (Choline O-acetyltransferase OS=Sus scrofa OX=9823 GN=CHAT PE=1 SV=3)

HSP 1 Score: 548.51 bits (1412), Expect = 0.000e+0
Identity = 272/593 (45.87%), Postives = 389/593 (65.60%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTE-EVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPA-SDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLT 1921
            YL  +  +V  E + +++ +V++FG PGG+GE LQ KLLE  ++  NWV++ WL DMYL N LALP+NSSP ++F +QHFQ+  +QLRFAANLI+G+L YK ++D   +P+D A     GQP CM+QYY LFSSYR PG T+D L    +    + EH+IVAC NQFFVL++  +  R SE DL+ QLR+IVR+A +E      +G+LT+  R +WA  R  L+ D TN+ S++MIE+ I ++C+D         P  +EL+      + N ALQLLHG G   NGANRWYDK++QFV+  DG CG+  EHS  +GI +++  EH+L +M +  S+++ R  SV +L  P++L +        +++ + ++++ +  NLD  + ++  +G+ F K    SPD+FIQ+ALQL  Y++H  LVPTYESASIRRF  GRVDNIR+A+  AL +  ++T    A  D EK++LL+ A+  QT+  +  I G  +DNHLLGL+E A E+  E+ E+F D+TYL SN+F LSTSQVPT  + F CYG VV +GYGA YNP   SI+  IS +  C +T +  FA+ ++ESF EM  L +
Sbjct:   39 YLRCMQHLVPEEQFRRSQAIVQQFGAPGGLGETLQQKLLERQEQTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFQDTNDQLRFAANLISGVLSYKALLDSHSIPIDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQKSSVMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVRMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMIERCICLVCLDA--------PGGMELS------DTNRALQLLHGGGCSKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHMVK-SSKKMVRADSVSELPAPRRLRWKCSPEIQGLLASSAEKLQQIVKNLDFTVYKFDDYGKTFIKQQKCSPDAFIQVALQLAFYRLHGRLVPTYESASIRRFHEGRVDNIRSATPEALHFVKAITDHASAMPDSEKLLLLKDAIRAQTQYTVMAITGMAIDNHLLGLRELAREVCKELPEMFTDETYLMSNRFVLSTSQVPTTMEMFCCYGPVVPNGYGACYNPQPESILFCISSFHGCKETSSTKFAKAVEESFIEMKGLCS 616          
BLAST of Choline O-acetyltransferase vs. UniProt/SwissProt
Match: sp|B2ZGJ1|CLAT_DANRE (Choline O-acetyltransferase OS=Danio rerio OX=7955 GN=chat PE=2 SV=1)

HSP 1 Score: 537.724 bits (1384), Expect = 0.000e+0
Identity = 269/590 (45.59%), Postives = 380/590 (64.41%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAE-SEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL 1915
            YL  +  +V  + + KTK +VE+FG PGG+GE LQ KLLE S++K NWV D WLEDMYL N LALP+NSSP MVF KQ+F+ + + LRFAANLI+G+L+YK +ID R LPV+ A     G P CM+QY ++F+SYR PG   D L    +    + EHIIVAC NQFFVL++  +  R +EKDLY QL RI ++A+  E+ +  +G+LT+  R +WA  R  L+ D TN+ S++MIE+ + ++C+D+      N              + N AL +LHG G++ NG NRWYDK MQFVI ADG CG+  EHS  EGI +++  E++L YM    S +L R +S+ +L  P++L +         +S +   ++ L  NLD+ + ++  +G++F K   MSPD+++Q+ALQ T Y+ H  LVPTYESASIRRF  GRVDNIR+++  AL +  +M + +  +D EK+ LL +A++ QT   +  I G  +DNHLLGL+E A E+ +E  ELF D TY  S  F LSTSQVPT ++ F CYG VV +GYGA YNP  + I+  +S + +C +T +D+F + L+    EM  L
Sbjct:   33 YLTCMGHLVPEDQFRKTKAVVEKFGAPGGVGETLQKKLLERSEQKANWVYDYWLEDMYLNNRLALPVNSSPVMVFHKQNFKGQSDVLRFAANLISGVLEYKALIDGRALPVEHARGQLAGTPLCMDQYNKVFTSYRLPGTKTDTLVAQKSTVMPEPEHIIVACKNQFFVLDVMVNFRRLNEKDLYTQLERIRKMADIEEERQPPIGLLTSDGRTQWAEARNILIKDSTNRDSLDMIERCLCLVCLDEETATELN--------------DSNRALLMLHGGGTDKNGGNRWYDKPMQFVIGADGCCGVVCEHSPFEGIVLVQCSEYLLRYMRGSPS-KLVRAASMSELPAPRRLRWKCSPDIQTFLSASADRLQKLVKNLDMNVHKFTGYGKEFIKRQKMSPDAYVQVALQFTFYRCHGRLVPTYESASIRRFQEGRVDNIRSSTPEALAFVKAMASGSKITDAEKMELLWTAIKAQTNYTILAITGMAIDNHLLGLREIAKELKLEKPELFSDTTYATSIHFTLSTSQVPTTEEMFCCYGPVVPNGYGACYNPQTDHILFCVSSFRECAETSSDLFVKTLEGCLKEMQDL 607          
BLAST of Choline O-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q90YJ9|CLAT_CHICK (Choline O-acetyltransferase OS=Gallus gallus OX=9031 GN=CHAT PE=2 SV=1)

HSP 1 Score: 532.332 bits (1370), Expect = 2.416e-179
Identity = 279/615 (45.37%), Postives = 387/615 (62.93%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEV---VGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPA-SDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL-----TSNLELAKNRKAVKVQ 1966
            YL  +  +V  E + KTK +VE+FG  GG+GE LQ  L E  +   NWV + WL+DMYL N LALP+NSSP ++F +Q+F++  +QLRFAANLI+G+ DYK ++D   LPVD A     GQP CM+QYY LFSSYR PG TKD L    +    + EHIIVACNNQ FVL++  +  R SE DL+ QLR+I ++AE+E  EE+   +G+LT   R +WA  R  L+ D TN+ S++MIE+ I ++C+D    V  N              + N ALQLLHG G   NGANRWYDK MQFV+  DG CG   EHS  +GI +++  EH+L +M+E  S++L R  SV +L  P++L +         ++ + ++++ +  NLD    ++  +G++F K    SPD++IQ+ALQL  Y+ H+ LVPTYESASIRRF  GRVDNIR+A+  A  +  +M  D PA SD EK+   + A+  QT   +  I G  +DNHLLGL+E A E   E+ E+F D+TYL SN+F LSTSQVPT  + F CYG VV +GYGA YNP    I+  IS + DC +T +D+ A+ ++ES  E+  L      ++   LAK  +A +++
Sbjct:   38 YLQCMKHLVPEEQFRKTKSIVEQFGVAGGLGESLQLILEERREETTNWVFNYWLDDMYLNNRLALPVNSSPAIIFARQNFKDVNDQLRFAANLISGVQDYKALLDSHALPVDFARGQLSGQPLCMKQYYGLFSSYRLPGHTKDTLVAQKSCVMPEPEHIIVACNNQLFVLDVGINFRRLSEGDLFTQLRKIAKMAENE--EEMLPPIGLLTTDGRTEWAEARTILMKDSTNRDSLDMIERCICLVCLDGTSGVELN--------------DTNMALQLLHGGGYHKNGANRWYDKPMQFVVGRDGVCGTVCEHSPFDGIVLVQCTEHLLKHMKE-SSKKLLRADSVSELPAPRRLRWKCSPEIQAHLASSAEKLQRIVKNLDFIAYKFVNYGKEFIKKQKTSPDAYIQVALQLAFYRCHRRLVPTYESASIRRFDEGRVDNIRSATAEAFAFVKAMIDDKPALSDSEKMQRFKDAIAAQTNYTILAITGMAIDNHLLGLREVAREHFKELPEIFTDETYLTSNRFILSTSQVPTPMEMFCCYGPVVPNGYGACYNPQPEHILFCISSFKDCKETSSDMLAKAVEESLLEIRDLCNKCSSSTAKSLAKQEEATQLR 635          
BLAST of Choline O-acetyltransferase vs. UniProt/SwissProt
Match: sp|Q03059|CLAT_MOUSE (Choline O-acetyltransferase OS=Mus musculus OX=10090 GN=Chat PE=2 SV=2)

HSP 1 Score: 531.946 bits (1369), Expect = 2.811e-179
Identity = 266/594 (44.78%), Postives = 381/594 (64.14%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTE-EVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPAS-DDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTS 1924
            YL  +  +V  E + K++ +V+ FG PGG+GE LQ KLLE  ++  NWV++ WL DMYL N LALP+NSSP ++F +QHFQ+  +QLRFAA+LI+G+L YK ++D + +P D A     GQP CM+QYYRLFSSYR PG T+D L    +    + EH+IVAC NQFFVL++  +  R SE DL+ QLR+IV++A +E      +G+LT+  R +WA  R  LL D TN+ S++MIE+ I ++C+D P                G   + + ALQLLHG G   NGANRWYDK++QFV+  DG CG+  EHS  +GI +++  EH+L +M    +++L R+ SV +L  P++L +         ++ + ++++ +  NLD  + ++  +G+ F K    SPD FIQ+ALQL +Y++++ LVPTYESASIRRF  GRVDNIR+A+  AL +  +MT    A    EK+ LL+ A++ QT+  +  I G  +DNHLL L+E A ++  E  E+F D+TYL SN+F LSTSQVPT  + F CYG VV +GYGA YNPH  +I   IS +  C +T +  FA+ +  S  +M  L +S
Sbjct:   39 YLQCMQHLVPEEQFRKSQAIVKRFGAPGGLGETLQEKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFQDTNDQLRFAASLISGVLSYKALLDSQSIPTDWAKGQLSGQPLCMKQYYRLFSSYRLPGHTQDTLVAQKSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAKARTVLLKDSTNRDSLDMIERCICLVCLDGP--------------GTGDLSDTHRALQLLHGGGCSLNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHM-MTGNKKLVRVDSVSELPAPRRLRWKCSPETQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDGFIQVALQLAYYRLYQRLVPTYESASIRRFQEGRVDNIRSATPEALAFVQAMTDHKAAVLASEKLQLLQRAIQAQTEYTVMAITGMAIDNHLLALRELARDLCKEPPEMFMDETYLMSNRFILSTSQVPTTMEMFCCYGPVVPNGYGACYNPHAEAITFCISSFHGCKETSSVEFAEAVGASLVDMRDLCSS 617          
BLAST of Choline O-acetyltransferase vs. UniProt/SwissProt
Match: sp|P28329|CLAT_HUMAN (Choline O-acetyltransferase OS=Homo sapiens OX=9606 GN=CHAT PE=1 SV=4)

HSP 1 Score: 535.413 bits (1378), Expect = 4.007e-179
Identity = 274/613 (44.70%), Postives = 391/613 (63.78%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTE-EVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMT---ADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL-----TSNLELAKNRKAVK 1960
            YL  +  +V+ E + K++ +V++FG PGG+GE LQ KLLE  ++  NWV++ WL DMYL N LALP+NSSP ++F +QHF    +QLRFAA+LI+G+L YK ++D   +P D A     GQP CM+QYY LFSSYR PG T+D L    +    + EH+IVAC NQFFVL++  +  R SE DL+ QLR+IV++A +E      +G+LT+  R +WA  R  L+ D TN+ S++MIE+ I ++C+D         P  VEL+      + + ALQLLHG G   NGANRWYDK++QFV+  DG CG+  EHS  +GI +++  EH+L ++ +  SR+L R  SV +L  P++L +         ++ + ++++ +  NLD  + ++  +G+ F K    SPD+FIQ+ALQL  Y++H+ LVPTYESASIRRF  GRVDNIR+A+  AL +  ++T   A  PAS  EK++LL+ A+  QT   +  I G  +DNHLL L+E A  M  E+ E+F D+TYL SN+F LSTSQVPT  + F CYG VV +GYGA YNP   +I+  IS +  C +T +  FA+ ++ES  +M  L      T +  LA   KA +
Sbjct:  146 YLQCMRHLVSEEQFRKSQAIVQQFGAPGGLGETLQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVNSSPAVIFARQHFPGTDDQLRFAASLISGVLSYKALLDSHSIPTDCAKGQLSGQPLCMKQYYGLFSSYRLPGHTQDTLVAQNSSIMPEPEHVIVACCNQFFVLDVVINFRRLSEGDLFTQLRKIVKMASNEDERLPPIGLLTSDGRSEWAEARTVLVKDSTNRDSLDMIERCICLVCLDA--------PGGVELS------DTHRALQLLHGGGYSKNGANRWYDKSLQFVVGRDGTCGVVCEHSPFDGIVLVQCTEHLLKHVTQ-SSRKLIRADSVSELPAPRRLRWKCSPEIQGHLASSAEKLQRIVKNLDFIVYKFDNYGKTFIKKQKCSPDAFIQVALQLAFYRLHRRLVPTYESASIRRFQEGRVDNIRSATPEALAFVRAVTDHKAAVPAS--EKLLLLKDAIRAQTAYTVMAITGMAIDNHLLALRELARAMCKELPEMFMDETYLMSNRFVLSTSQVPTTTEMFCCYGPVVPNGYGACYNPQPETILFCISSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATR 741          
BLAST of Choline O-acetyltransferase vs. TrEMBL
Match: D5MS68 (Choline acetyltransferase OS=Dugesia japonica OX=6161 GN=Djchat PE=2 SV=1)

HSP 1 Score: 1249.19 bits (3231), Expect = 0.000e+0
Identity = 606/682 (88.86%), Postives = 647/682 (94.87%), Query Frame = 2
Query:   20 MAHPVREYVRRISSQNLEQYPEWDXXXXXXXXXXXXXXXXXMRYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNRKAVKVQDSILEESCRSETFLHYAFENQSTTEMGNIKLQD 2065
            MAHPVREYVRRISSQNLEQYPEWDLSKPLPKLPVP+LK TL+RYLDLVAPVV+LEDYEKTK LV+EFGKP GIGE LQAKL ENSK KENWVAD+WLEDMYLKN+LALPINSSPGMVFP+QHFQ+EKEQLRFAANLIAGILDYKTI+DVRGLPVDRATHNRKGQP+CMEQYYRLFSSYRYPG+TKDEL TNINRDPFDHEHIIVACN QFFVLEITTSA+RPSE+DLYNQLRRIVRLAE+EKTEEVVGILTALPR KWA+VRQHLLLD  NKKSMEMIEKSIFILCIDK VPVTFNH ESVELTK GIRDNVNCALQLLHGMGSE+NGANRWYDKTMQFVIS+DGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDL PPKKLE+ ID + S+MISEAKQEIKNLADNLDIYILRYQKFGR+FPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCT+M  D P++DDEKIILLRSAMEWQTKVMLDTI GHGVDNHLLGLKEAAVE+N+EI ELFKDKTYLESN+FRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPH+N I+VAISCWC+CPDTRADVFAQKLKESFDEM  LLTSNLELAKNRKA ++Q+ I+EESCRSE  L++ FE ++  ++GNIKL +
Sbjct:    1 MAHPVREYVRRISSQNLEQYPEWDLSKPLPKLPVPNLKQTLVRYLDLVAPVVSLEDYEKTKNLVQEFGKPNGIGEILQAKLAENSKSKENWVADLWLEDMYLKNSLALPINSSPGMVFPRQHFQSEKEQLRFAANLIAGILDYKTILDVRGLPVDRATHNRKGQPFCMEQYYRLFSSYRYPGITKDELITNINRDPFDHEHIIVACNGQFFVLEITTSADRPSEEDLYNQLRRIVRLAENEKTEEVVGILTALPRSKWASVRQHLLLDSINKKSMEMIEKSIFILCIDKSVPVTFNHSESVELTKVGIRDNVNCALQLLHGMGSEFNGANRWYDKTMQFVISSDGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLAPPKKLEWKIDKYVSEMISEAKQEIKNLADNLDIYILRYQKFGREFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTAMNGDIPSTDDEKIILLRSAMEWQTKVMLDTILGHGVDNHLLGLKEAAVELNIEIPELFKDKTYLESNRFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHQNYIVVAISCWCNCPDTRADVFAQKLKESFDEMRILLTSNLELAKNRKAARIQEIIMEESCRSENLLNHTFEAKTANDIGNIKLHE 682          
BLAST of Choline O-acetyltransferase vs. TrEMBL
Match: A0A3Q0KP43 (Putative choline o-acyltransferase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 818.92 bits (2114), Expect = 0.000e+0
Identity = 410/669 (61.29%), Postives = 508/669 (75.93%), Query Frame = 2
Query:   20 MAHPVREYVRRISSQNLEQYPEWDXXXXXXXXXXXXXXXXXMRYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAE----SEKTEEV---VGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELT----------KAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNRKAVKVQDSI 1975
            M+HP++E+VRR+S+ ++E+YPEWDLSKPLP+LPVPDL  TL RYL L+APVV+ ED+E+TKLLV+EFGKPGG GE+LQ  L E +  K NWV + WL+DMYL N   LPINSSPGMVFP+  F + ++QLRFAA LI+GILDYKTI+D R LP+DRA H++KGQP+CMEQYYRLFSSYRYPG  KD L T   RDPFD EHIIV   +QFFV+++ T+  R SE+D+YNQLRR+ + AE     E   EV   VG LTALPR KWA V +HL  D  N+ +++ I KS+F+LC+DKP+       E+ ++               RD+V+ ALQLLHGMGS +N ANRWYDKTMQF+IS DGNCGLNYEHSVAEGIAV+RLIEHIL YM+E+K  +L R  SVC+L  P++L++N+D  +  MI  A  EI  +AD+LD+YILRY+++GR+FPKTVNMSPDSFIQLALQL HYK+HK LVPTYESAS RRF+L RVDNIRA S+PAL+WC +MT     S DEKI LLR AMEWQT++ML+TI GHGVDNHLLGL++ A+  N E+  +FKD +Y+ESN+FRLSTSQVPT  DAFMCYGAVV +GYGAAYNPH ++I+V ISCW   P+  A  FA+ L  +F EM  L+ SN +LAK      V+ SI
Sbjct:    1 MSHPIKEFVRRLSNLDIERYPEWDLSKPLPRLPVPDLHNTLDRYLRLIAPVVSKEDFERTKLLVKEFGKPGGEGEELQNLLKEYALTKINWVTEWWLDDMYLLNPAPLPINSSPGMVFPRHSFISARQQLRFAAQLISGILDYKTILDTRSLPIDRARHSKKGQPFCMEQYYRLFSSYRYPGKNKDVLVTTTERDPFDPEHIIVIYLDQFFVIDVITNGSRLSEEDIYNQLRRVTQFAEESVAGESEMEVQPRVGALTALPRNKWAEVYEHLCQDPENEGNLKTIAKSMFVLCLDKPIQAVEELDETTDINGFLNETNDSNNLNKRDDVSLALQLLHGMGSSFNAANRWYDKTMQFIISRDGNCGLNYEHSVAEGIAVVRLIEHILQYMKEVKRWKLVRFPSVCELAYPRRLKWNLDDNSKSMIDYALNEIDKIADDLDLYILRYKQYGREFPKTVNMSPDSFIQLALQLAHYKLHKYLVPTYESASTRRFALARVDNIRACSMPALEWCKAMTGQAKCSTDEKIRLLRKAMEWQTEIMLETILGHGVDNHLLGLRQIALTHNKELPNIFKDPSYMESNRFRLSTSQVPTTMDAFMCYGAVVPNGYGAAYNPHPDNIVVVISCWRTNPNNNASKFAEMLDSAFTEMRELVLSNPQLAKQPSNEPVEWSI 669          
BLAST of Choline O-acetyltransferase vs. TrEMBL
Match: A0A4Z2DB67 (Choline O-acetyltransferase OS=Schistosoma japonicum OX=6182 GN=EWB00_002682 PE=3 SV=1)

HSP 1 Score: 813.913 bits (2101), Expect = 0.000e+0
Identity = 410/669 (61.29%), Postives = 507/669 (75.78%), Query Frame = 2
Query:   20 MAHPVREYVRRISSQNLEQYPEWDXXXXXXXXXXXXXXXXXMRYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAE----SEKTEEV---VGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELT----------KAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNRKAVKVQDSI 1975
            M+HP++E+VRR+S+ ++E+YPEWDLSKPLP+LPVPDL  TL RYL L+APVV+ ED+E+TK LVEEFGKP G GEKLQ  L E +K K NWV + WL+DMYL N   LPINSSPGMVFP+  F + ++QLRFAA LI+GILDYKTI+D R LP++RA H++KGQP+CMEQYYRLFSSYRYPG TKD L T   RDPF+ EHIIV   +QFFV+++ T+  R SE+D+YNQLRR+ + AE     E   EV   VG LTALPR KWA V Q L  D  N+ ++++I KS+F+LC+DKP+       E+ ++               RD+V+ ALQLLHGMGS +N ANRWYDKTMQF+IS DGNCGLNYEHSVAEGIAV+RLIEHIL YM+E+K  +L R  SVC+L  P++L++N+D  A  MI  A  EI  +AD+LD+YILRY+++GR+FPKTVNMSPDSFIQLALQL H+K+H  LVPTYESAS RRF+L RVDNIRA S+PAL+WC +MT  T  S DEKI LLR AMEWQT++ML+TI GHGVDNHLLGL++ A+    E+  +FKD +Y+ESN+FRLSTSQVPT  DAFMCYGAVV +GYGAAYNPH ++I+V ISCW   PD  A  FA+ L+ +F EM  L+ SN  LAK      V+ SI
Sbjct:    1 MSHPIKEFVRRLSNLDIERYPEWDLSKPLPRLPVPDLHNTLDRYLRLIAPVVSKEDFERTKQLVEEFGKPDGEGEKLQNLLKEYAKTKVNWVTEWWLDDMYLLNPAPLPINSSPGMVFPRHSFISARQQLRFAAQLISGILDYKTILDTRSLPIERARHSKKGQPFCMEQYYRLFSSYRYPGKTKDVLTTTAERDPFEPEHIIVIYLDQFFVIDVITNGSRLSEEDIYNQLRRVTQFAEESVAGESEMEVQPKVGALTALPRNKWAEVYQRLSQDSENQDNLKVIAKSMFVLCLDKPIIPVEELDETTDINGYLNDINDYNNLNKRDDVSLALQLLHGMGSSFNAANRWYDKTMQFIISRDGNCGLNYEHSVAEGIAVVRLIEHILQYMKEVKRWKLVRFPSVCELAYPRRLKWNLDDNAKSMIDYALNEIDKIADDLDLYILRYEQYGREFPKTVNMSPDSFIQLALQLAHFKLHNYLVPTYESASTRRFALARVDNIRACSMPALEWCKAMTGQTKCSTDEKIRLLRKAMEWQTEIMLETILGHGVDNHLLGLRQIALTHGKELPNIFKDPSYMESNRFRLSTSQVPTTMDAFMCYGAVVPNGYGAAYNPHPDNIVVVISCWRTNPDNNAAEFAKMLQSAFTEMRELVLSNPVLAKQPSNEPVEWSI 669          
BLAST of Choline O-acetyltransferase vs. TrEMBL
Match: A0A3R7D666 (Choline O-acetyltransferase OS=Clonorchis sinensis OX=79923 GN=CHAT PE=3 SV=1)

HSP 1 Score: 813.142 bits (2099), Expect = 0.000e+0
Identity = 405/669 (60.54%), Postives = 505/669 (75.49%), Query Frame = 2
Query:   20 MAHPVREYVRRISSQNLEQYPEWDXXXXXXXXXXXXXXXXXMRYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKT-------EEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPV-PVTFNHPES---------VELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNRKAVKVQDSI 1975
            M HPV+E+VRRIS+ ++EQYPEW+L+ PLP+LPVP LK TL RYL LVAPVV  + YE+TK +VEEFG+PGG GE+LQ  L E ++++ NWV D WL+DMYL N L LPINSSPGMVFP+  F + ++QLRFAA LI+GILDYKTI+D R LP+DRA H+RKGQP CMEQYYRLF+SYRYPG TKD L T  + DPFD EHIIV C +QFFV+E+  +  R SE+D+YNQLRRI + AE   +       +  VG LTALPR +WA + + +  D  N+ +++ I KS+F+LC+D+P+ PV     E+          E      RD+V+ ALQLLHG GS+YN ANRWYDKTMQF++S DGNCGLNYEHSVAEGIAVIRL EHIL+YM+E+K  RL R  SVCDL  PK+LE+N+D     MI++A +EI  +A++LD+YILRY ++GR+FPKTVNMSPDSFIQLALQL HYK+H  LVPTYESAS RRF L RVDNIRA S+PAL+WC +MT  T  + DEKI LLR AMEWQT++ML+TI GHGVDNHLLGL++ A+E + ++ ++F D+TY+E+N+FRLSTSQVPT  DAFMCYGAVV +GYGAAYNPH N I+  ISCW   P+  A  FA+ L  +F EM  L+ SN +LAK      V+ SI
Sbjct:    1 MTHPVKEFVRRISTLDIEQYPEWNLNAPLPRLPVPKLKNTLDRYLRLVAPVVAPDAYERTKQIVEEFGRPGGEGERLQKLLEEFAEKQLNWVTDWWLDDMYLMNPLPLPINSSPGMVFPRHSFISSRQQLRFAAQLISGILDYKTILDTRSLPIDRARHSRKGQPMCMEQYYRLFTSYRYPGKTKDTLVTTSDNDPFDPEHIIVVCLDQFFVMEVIFNGTRLSEEDIYNQLRRITQFAEEAVSGDNDLGVQPRVGALTALPRNEWAEMWERMAKDPQNEANLKAITKSMFVLCLDQPIGPVRELDEEANLNGSIDDLAEAPAEYRRDDVSLALQLLHGFGSKYNAANRWYDKTMQFIVSRDGNCGLNYEHSVAEGIAVIRLTEHILEYMQEVKRWRLVRFPSVCDLAFPKRLEWNLDEKTHGMITKALREIDQIAEDLDLYILRYNEYGREFPKTVNMSPDSFIQLALQLAHYKLHNYLVPTYESASTRRFVLARVDNIRACSMPALEWCKAMTGQTKCTTDEKIRLLRKAMEWQTEIMLETILGHGVDNHLLGLRQIAIEHDGKLPKIFTDETYMEANRFRLSTSQVPTTMDAFMCYGAVVPNGYGAAYNPHPNYIVTVISCWRTNPENSAAKFAEMLTAAFTEMRDLVLSNPQLAKEMSKEPVEWSI 669          
BLAST of Choline O-acetyltransferase vs. TrEMBL
Match: G7Y4F4 (Choline O-acetyltransferase OS=Clonorchis sinensis OX=79923 GN=CLF_100865 PE=3 SV=1)

HSP 1 Score: 811.987 bits (2096), Expect = 0.000e+0
Identity = 405/669 (60.54%), Postives = 505/669 (75.49%), Query Frame = 2
Query:   20 MAHPVREYVRRISSQNLEQYPEWDXXXXXXXXXXXXXXXXXMRYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKT-------EEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPV-PVTFNHPES---------VELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNRKAVKVQDSI 1975
            M HPV+E+VRRIS+ ++EQYPEW+L+ PLP+LPVP LK TL RYL LVAPVV  + YE+TK +VEEFG+PGG GE+LQ  L E ++++ NWV D WL+DMYL N L LPINSSPGMVFP+  F + ++QLRFAA LI+GILDYKTI+D R LP+DRA H+RKGQP CMEQYYRLF+SYRYPG TKD L T  + DPFD EHIIV C +QFFV+E+  +  R SE+D+YNQLRRI + AE   +       +  VG LTALPR +WA + + +  D  N+ +++ I KS+F+LC+D+P+ PV     E+          E      RD+V+ ALQLLHG GS+YN ANRWYDKTMQF++S DGNCGLNYEHSVAEGIAVIRL EHIL+YM+E+K  RL R  SVCDL  PK+LE+N+D     MI++A +EI  +A++LD+YILRY ++GR+FPKTVNMSPDSFIQLALQL HYK+H  LVPTYESAS RRF L RVDNIRA S+PAL+WC +MT  T  + DEKI LLR AMEWQT++ML+TI GHGVDNHLLGL++ A+E + ++ ++F D+TY+E+N+FRLSTSQVPT  DAFMCYGAVV +GYGAAYNPH N I+  ISCW   P+  A  FA+ L  +F EM  L+ SN +LAK      V+ SI
Sbjct:    1 MTHPVKEFVRRISTLDIEQYPEWNLNAPLPRLPVPKLKNTLDRYLRLVAPVVAPDAYERTKQIVEEFGRPGGEGERLQKLLEEFAEKQLNWVTDWWLDDMYLMNPLPLPINSSPGMVFPRHSFISSRQQLRFAAQLISGILDYKTILDTRSLPIDRARHSRKGQPMCMEQYYRLFTSYRYPGKTKDTLVTTSDNDPFDPEHIIVVCLDQFFVMEVIFNGTRLSEEDIYNQLRRITQFAEEAVSGDNDLGVQPRVGALTALPRNEWAEMWERMAKDPQNEANLKAITKSMFVLCLDQPIGPVRELDEEANLNGSIDDLAEAPAEYRRDDVSLALQLLHGFGSKYNAANRWYDKTMQFIVSRDGNCGLNYEHSVAEGIAVIRLTEHILEYMQEVKRWRLVRFPSVCDLAFPKRLEWNLDEKTHGMITKALREIDQIAEDLDLYILRYNEYGREFPKTVNMSPDSFIQLALQLAHYKLHNYLVPTYESASTRRFVLARVDNIRACSMPALEWCKAMTGQTKCTTDEKIRLLRKAMEWQTEIMLETILGHGVDNHLLGLRQIAIEHDGKLPKIFTDETYMEANRFRLSTSQVPTTMDAFMCYGAVVPNGYGAAYNPHPNYIVTVISCWRTNPENSAAKFAEMLTAAFTEMRDLVLSNPQLAKEMSKEPVEWSI 669          
BLAST of Choline O-acetyltransferase vs. Ensembl Cavefish
Match: chata (choline O-acetyltransferase a [Source:NCBI gene;Acc:100170938])

HSP 1 Score: 539.65 bits (1389), Expect = 0.000e+0
Identity = 273/591 (46.19%), Postives = 379/591 (64.13%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTE-EVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMT-ADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL 1915
            YL  +  +VT E + KTK + E+F  PGG+GE L  KLLE  + K NWV D WLEDMYL N LALP+NSSP MVF KQ+F+ + + LRFAA+LI+G+L+YK +ID   LPVD A     G P CMEQYYRLF+SYR PG+  D L    +    + EHIIVAC NQFFVL++  +  R +E DLY QL++I ++A+SE+     +G+LT+  R +WA  R  L+ D TN+ S++MIE+ + ++C+D+   +  N              + N A+ +LHG G   NGANRWYDK MQFV+ ADG CG+  EHS  EGI +++  E++L YM    S +L R +SV +L  P++L +         ++ +  +++ L DNLD+ + ++  +G++F K   MSPD++IQ+ALQ   Y+ H   VPTYESASIRRF  GRVDNIR+++  AL +  +MT   +  +D EK+  LR A++ QT   +  I G G+DNHLLGL+E   E+N+E  E F D+TY+ SNQF LSTSQVPT  + F CYG VV +GYGA YNP  + I+  +S + D P+T +D+F + L E   EM  L
Sbjct:   29 YLKCMRHLVTEEQFNKTKAITEKFASPGGVGELLHKKLLERKEVKANWVYDFWLEDMYLNNRLALPVNSSPAMVFTKQNFRAQSDALRFAAHLISGVLEYKVLIDGHALPVDYARGQLAGTPLCMEQYYRLFTSYRLPGLKTDTLVAQKSSIMPEPEHIIVACKNQFFVLDVVINFRRLNESDLYTQLQKIRKMADSEEERLPPIGLLTSDGRTEWAESRSVLVKDSTNRDSLDMIERCLCLVCLDEACGMELN--------------DTNRAMLMLHGGGKNKNGANRWYDKPMQFVVGADGCCGVVCEHSPFEGIVLVQCTEYLLKYMRGSPS-KLVRAASVSELPAPRRLRWKWSPEIQACLTASADKLQRLVDNLDMNVHKFTGYGKEFIKKQKMSPDAYIQVALQFAFYRCHGRAVPTYESASIRRFQQGRVDNIRSSTPEALAFVKAMTDKKSSLTDAEKLEKLRDAIKAQTNYTILAITGMGIDNHLLGLREICKELNLEKPEFFTDETYIISNQFILSTSQVPTTVEMFCCYGPVVPNGYGACYNPQSDHIMFCVSSFHDSPETSSDMFVKALVECLGEMQDL 604          
BLAST of Choline O-acetyltransferase vs. Ensembl Cavefish
Match: ENSAMXT00000004414.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000119.1:393738:423709:-1 gene:ENSAMXG00000004303.2 transcript:ENSAMXT00000004414.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 504.212 bits (1297), Expect = 1.277e-169
Identity = 263/598 (43.98%), Postives = 376/598 (62.88%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDEL------ATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAE-SEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIR-DNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTAD-TPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL 1915
            YL  V  +V    ++ T+ +VE+FG+PGG+GE LQ  LLE  ++ +NWV D WLEDMYL N LALP+NSSP +VFP+Q+F++  + LR+AA+LI G++ YK ++D R LP D A   + G   CMEQYY LF+SYR PG+ +D L      A N  ++P    HIIVAC NQFFVL +   + R +E DL  QL +I ++AE +E+    +G+LT+  R +WA  R  LL D  N++S+ +IE+ + ++C+D+P                GI+  + N A+ +LHG G + NGANRWYDK+MQFV+ ADG CG+  EHS  EGI +++  E++L ++    S +L+R SSV +L  P++L +        M++ + + +  L  NLD+ +  +  +G++F K   MSPD+++Q+ALQL  Y+ +  +V TYESAS RRF  GRVDNIR+A+  AL +  +MT +  P  D EK+  LR A++ QT      I G G+DNHLLGL+E A E+ ME  E+F DKTY  SNQF LSTSQVPT  D F CYG VV +GYGA YNP    I+  +S + +C  T +    + L+ +  +M  L
Sbjct:   23 YLRYVRHLVPEAQFQNTRTIVEKFGRPGGVGEILQKNLLERREKTQNWVYDYWLEDMYLNNRLALPVNSSPVLVFPQQNFRSRDDSLRYAAHLITGVMAYKDMLDTRSLPQDYARGQQAGTELCMEQYYHLFTSYRRPGLKQDSLITQSSPAANKTQEP---GHIIVACKNQFFVLNLMEKSRRLNESDLLTQLVKISKMAENAEERLPPIGLLTSDGRTEWAQARDALLKDAVNRESLGVIEQCVCVVCLDEPT---------------GIQPTDSNRAMLMLHGGGHDKNGANRWYDKSMQFVVGADGVCGVVCEHSPFEGIVLVQCTEYLLKFLTSSPS-KLSRGSSVTELPTPRRLAWRCSPQVQGMLASSAEHLHRLVKNLDMEVFTFGAYGKEFIKKQKMSPDAYVQVALQLAFYRCNGRVVSTYESASTRRFREGRVDNIRSATPEALSFVKAMTDERAPLQDLEKMERLRRAVDAQTNYTKLAITGLGIDNHLLGLREIAKELKMESPEIFTDKTYHLSNQFILSTSQVPTTVDMFCCYGPVVPNGYGACYNPQSEHILFCVSSFRECSATSSLEMMKALELALVDMRDL 601          
BLAST of Choline O-acetyltransferase vs. Ensembl Cavefish
Match: crata (carnitine O-acetyltransferase [Source:NCBI gene;Acc:103026562])

HSP 1 Score: 446.047 bits (1146), Expect = 1.502e-146
Identity = 240/592 (40.54%), Postives = 356/592 (60.14%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKD-LYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            RYL  + P+V  E+ + TK LV+EF  PGG+GE+LQ  L   + +  NW++D WL+  YL   L + I+SSPG+V P+  F + + Q+R+AA LIAG+LD+K++ID   LP++       G+P CM QYY++ SS R PG TK +   N  R+     HI V  N QFFVL++  S   P   D LY QL +I   +  +  +E +GILT+  R  W     +L+ D TNK+S+  I+KSIF +C+D P+P       S E+ ++        A+Q+LHG GS +N  NRW+DKT+QF+I  DG CG+ YEH+ AEG  ++ LI+H+++Y ++ +  R    + +  L  P+KL +NI     + I EAKQ +  +  +LD+ ++ +  FG++ PK+  MSPD+FIQ+ LQL +Y+++K    TYESAS+R F LGR D IR+ASI +  +  +M  D+   + EK+ LL  A++         I+G  +D HLLGLK  A+E    + ++F D +Y  +N + LSTSQVP   D  MC+G VV  GYG  YNP +  I  A+S +  C DT A   AQ L+++  +M +LL
Sbjct:   86 RYLAALEPIVDSEELQHTKKLVDEFQMPGGVGERLQKGLECRAHKANNWLSDWWLQVAYLDYRLPVVIHSSPGVVLPRLEFNDRQGQMRYAAKLIAGVLDFKSMIDNETLPLEYL----GGKPLCMNQYYQVLSSCRIPG-TKSDSVVNHARNKRPPTHITVVHNYQFFVLDVYNSDCTPLTVDQLYLQLEKIWN-SSLQTNKEPIGILTSNHRNSWGKAYHNLIKDKTNKESVRAIQKSIFTVCLDAPMPRV-----SDEMYRS------RAAVQMLHGGGSRWNSGNRWFDKTLQFIIGEDGTCGVIYEHAPAEGPPIVALIDHVVEYTKKSEMVR----TPMVPLPMPQKLRFNITPEIKRDIEEAKQNMNIMVHDLDVKVIVFPHFGKNVPKSYKMSPDAFIQVGLQLAYYRMYKRCCATYESASLRMFRLGRTDTIRSASIDSANFVKAMD-DSAKQNQEKVTLLEKAVKAHRSYTDIAIRGQAIDRHLLGLKLQAIEDLSALPDIFMDTSYAVANHYNLSTSQVPAKTDCVMCFGPVVPDGYGVCYNPMEQHINFAVSAFNSCADTNAARMAQSLEDALLDMKNLL 655          
BLAST of Choline O-acetyltransferase vs. Ensembl Cavefish
Match: zgc:154046 (carnitine O-acetyltransferase-like [Source:NCBI gene;Acc:103027158])

HSP 1 Score: 422.935 bits (1086), Expect = 4.986e-138
Identity = 224/592 (37.84%), Postives = 347/592 (58.61%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKD-LYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            RYL ++ P+++ E+ E T+ L+ EF + GG+GE+LQ  L   +++ ENW+++ W++  YL + + +   +SPG+V P  HFQ+ + Q+RFAA LIAG+LD+K +ID   LPV+       G+P CM+QYY++ SS R PG  KD +  N         HI +  N QFFVL++  S   P   D +Y QL +I   +  +  +E +GILT+  R  W     +L+ D TNK+S+ MI+KSIF++C+D P+P      + +  +K         A Q+LHG GS +N  NRW+DKT+QF++  DG+CGL YEH+ AEG  ++ L++H++ YM++ +  R    + +  L  P KL +NI     + I +AKQ +  +  +LD+ +L +  +GR + K+  M+ D+FIQ+ALQL +Y+I+    PTYESAS+R F LGR + IR  S  +LK+  +M  +    + EK+ LL  A+          I G  +D HLLGLK   +E    + E+F D +Y  +  F L TS V +  D  M  G +V  GYG  YNP  + I VA++ +  C +T A+  A+ L ++  +M +LL
Sbjct:   54 RYLAMLEPLISEEEMEHTRELMAEFLRRGGVGERLQRGLERRARKTENWLSEWWMQSAYLDSRMPVAAYTSPGVVLPPMHFQDRQGQMRFAAKLIAGVLDFKRMIDNETLPVEYL----GGKPLCMDQYYQVLSSCRLPGPKKDTV-VNYGIGKTSPTHITIVHNFQFFVLDVYNSDGSPLTVDQIYVQLEKIWN-SSLQTNKEPIGILTSNHRNTWGKAYNNLIKDKTNKESVRMIQKSIFLVCLDAPMPRV---SDDIYFSKV--------AAQMLHGGGSRWNSGNRWFDKTLQFIVGEDGSCGLTYEHAPAEGPPIVYLVDHVVAYMKKTEMVR----APMIPLPMPLKLRFNITPEVKKDIEKAKQNMNIMVHDLDVRVLNFSHYGRKYLKSCKMNTDAFIQMALQLAYYRIYNMCCPTYESASLRMFKLGRTEAIRTTSTESLKFVQAMD-NKDKQNSEKLALLEKAITAHRTYTHMAIHGQAIDRHLLGLKMQGIEDLTSLPEIFMDTSYAVAMHFNLFTSMVGSKTDCVMSIGPMVPDGYGVCYNPMDDHINVAVTAFNSCEETNANNLARSLSDALLDMKALL 623          
BLAST of Choline O-acetyltransferase vs. Ensembl Cavefish
Match: zgc:154046 (carnitine O-acetyltransferase-like [Source:NCBI gene;Acc:103027158])

HSP 1 Score: 410.994 bits (1055), Expect = 6.447e-134
Identity = 220/592 (37.16%), Postives = 342/592 (57.77%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKD-LYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            RYL ++ P+++ E+ E T+ L+ EF + GG+GE+LQ  L   +++ ENW+++ W++  YL + + +   +SPG+V P  HFQ+ + Q+RFAA LIAG+LD+K +ID   LPV+       G+P CM+QYY++ SS R PG  KD +  N         HI +  N QFFVL++  S   P   D +Y QL +I   +  +  +E +GILT+  R  W     +L+ D TNK+S+ MI+KSIF++C+D P+P      + +  +K         A Q+LHG GS +N  NRW+DKT+QF++  DG+CGL YEH+ AEG  ++ L++H++ YM++ +  R    + +  L  P KL +NI     + I +AKQ +  +  +LD+ +L +  +GR + K+  M+ D+FIQ+ALQL +Y+I+    PTYESAS+R F LGR + IR  S  +LK+  +M      + D++                  I G  +D HLLGLK   +E    + E+F D +Y  +  F L TS V +  D  M  G +V  GYG  YNP  + I VA++ +  C +T A+  A+ L ++  +M +LL
Sbjct:   41 RYLAMLEPLISEEEMEHTRELMAEFLRRGGVGERLQRGLERRARKTENWLSEWWMQSAYLDSRMPVAAYTSPGVVLPPMHFQDRQGQMRFAAKLIAGVLDFKRMIDNETLPVEYL----GGKPLCMDQYYQVLSSCRLPGPKKDTVV-NYGIGKTSPTHITIVHNFQFFVLDVYNSDGSPLTVDQIYVQLEKIWN-SSLQTNKEPIGILTSNHRNTWGKAYNNLIKDKTNKESVRMIQKSIFLVCLDAPMPRV---SDDIYFSKV--------AAQMLHGGGSRWNSGNRWFDKTLQFIVGEDGSCGLTYEHAPAEGPPIVYLVDHVVAYMKKTEMVR----APMIPLPMPLKLRFNITPEVKKDIEKAKQNMNIMVHDLDVRVLNFSHYGRKYLKSCKMNTDAFIQMALQLAYYRIYNMCCPTYESASLRMFKLGRTEAIRTTSTESLKFVQAMD-----NKDKQ-----------------AIHGQAIDRHLLGLKMQGIEDLTSLPEIFMDTSYAVAMHFNLFTSMVGSKTDCVMSIGPMVPDGYGVCYNPMDDHINVAVTAFNSCEETNANNLARSLSDALLDMKALL 589          
BLAST of Choline O-acetyltransferase vs. Ensembl Sea Lamprey
Match: chata (choline O-acetyltransferase a [Source:NCBI gene;Acc:100170938])

HSP 1 Score: 491.886 bits (1265), Expect = 2.348e-165
Identity = 257/595 (43.19%), Postives = 362/595 (60.84%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTE-EVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPA----SDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL 1915
            RYLD +  +V  E + +TK+LVE FG PGG GE+LQ  L+E   +    V + WL DMYL N + LP+NS+PGMV P+Q F+++ +QLRFAA LI+GILDYK +ID R LP D A     G P CMEQYYRLFSSYR  G  +D L    +    + EHIIVACNN    L +           L+ +  R +  + ++ +  E   I     +  W   +     D TN+ S++ IE+ IF+LC+D       N P    LT   + +N      +LHG G+  N  NRW+DK MQF++  DG CGL YEHS AEGIAV++ +EH+L Y+++   R+L R  SVC+L  P++L + +     + ++ A + + ++ +NLD+ I R+  +G++F K   MSPD+++Q+ALQL HYK H  LV TYESAS+RRF  GRVDNIR+A+  A  +  +MT+         D E++ LL  A++ QT   +  I G  +D H+LGL+E A E++ ++ E+FKD TY++SN F LSTSQ+PT  DAFMCYG VV  GYG +YNP  N  I  IS +   P T ++ F++ L +S DEM +L
Sbjct:   28 RYLDCMRHLVAPEQFRRTKVLVERFGAPGGHGERLQRALVEQKNKTCVQVYEWWLNDMYLDNRVPLPVNSNPGMVLPRQLFRDQADQLRFAARLISGILDYKVVIDARALPQDFARGQLSGHPLCMEQYYRLFSSYRLAGHPRDTLVAPRSTVMPEPEHIIVACNNHSVFLYVLIFVRLFVSLQLFPRSTRTLSCSVNQDSRFEPRNIEKQKKKLTWRKTKTPNPTDSTNRDSLDAIERCIFLLCLDG----AMNRP----LTDVALAEN------MLHGGGARANSGNRWFDKPMQFIVGRDGACGLVYEHSPAEGIAVVQCVEHLLSYIKDTSQRKLLRADSVCELPAPRRLRWKLSPEIHEHLAFAARNLDSVVENLDLLIDRFSGYGKEFIKQQRMSPDAYVQVALQLAHYKCHGRLVSTYESASLRRFQQGRVDNIRSATREAWDFVRAMTSKHAGVLSNEDAERMELLWKAIQAQTDYTILAITGMAIDCHMLGLREIARELDHDLPEVFKDITYVQSNLFALSTSQIPTTMDAFMCYGPVVPDGYGVSYNPKDNHFIFCISSFHSDPTTGSEHFSRALHDSLDEMRAL 608          
BLAST of Choline O-acetyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002015.1 (pep scaffold:Pmarinus_7.0:GL479138:18281:30704:1 gene:ENSPMAG00000001805.1 transcript:ENSPMAT00000002015.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 440.269 bits (1131), Expect = 2.489e-145
Identity = 236/596 (39.60%), Postives = 351/596 (58.89%), Query Frame = 2
Query:  146 RYLDLVAPVVTLED---YEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSE-KDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDL--LPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL 1915
            RY D+VAP+   ED    E T+ L+ EF +PGG+GE LQA L   ++ +ENW++D WL   YL+  L + ++SSPG+V P Q +++   QL FAA LIAG+LDYK ++D   LPV+    +  G+P CM+QYYRLFSS R PG+ +D +  N+ RD +  +HI VA N  F+ +E+  +  +  + ++LY QL+ I R         VVG+LTA  R  WA + Q L  D  ++ S++ +E+S F LC+D P       PE          D    A Q+LHG GS  + ANRW+DKT+QF++   G CGL YEH+ AEG  ++ L++H++ Y E+ + +     S    +    P+ L++++      + +EAK  +  L  NL++    ++ FG+ FPK+  +SPD+FIQ+ LQL +Y+++     TYESAS+R F LGR + IR+ S  +L +  +M  D       K+ L++ A++   +     I G GVD HLLGLK  A+E  + + E++ D TY  +  +RLSTSQVP   D  MC+G VVE GYG  YNP +N I +A+S +  CPDT A   AQ L ++  +M  L
Sbjct:   52 RYADVVAPLAG-EDSTQMEHTRRLLREFAQPGGVGEVLQAGLERRARERENWLSDWWLLTAYLEYRLPVVVHSSPGVVLPHQPYRDAHGQLWFAAQLIAGVLDYKAMVDNESLPVE----HLGGRPLCMDQYYRLFSSCRVPGLPRDSV-RNVARDAYPPKHITVASNAHFYHMEVYGADGKVLDVENLYEQLKNI-RTHSLGLAPGVVGLLTAQDRDSWAKIYQVLTADEKHRGSVDAVERSAFALCLDGP----GQRPE---------WDMSLAAAQMLHGGGSALHSANRWFDKTLQFIVGDGGTCGLIYEHAPAEGPPIVALVDHVVAYCEKSRQQTAPTTSQGAPVHGAEPRHLQFSLSPELLALAAEAKVGLDQLVANLEVECFVFKNFGKGFPKSQKLSPDAFIQIGLQLAYYRLYAQPCATYESASLRMFRLGRTETIRSTSRHSLAFSRAM-GDPNCDRQTKVQLMKKAIQAHREYTTRAITGQGVDRHLLGLKLQALEEGVPLPEIYSDPTYQAAMHYRLSTSQVPARTDCVMCFGPVVEDGYGVCYNPMENHINLAVSAFRSCPDTSAARLAQALHQALLDMQEL 626          
BLAST of Choline O-acetyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002355.1 (pep scaffold:Pmarinus_7.0:GL479051:22504:40466:1 gene:ENSPMAG00000002138.1 transcript:ENSPMAT00000002355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 215.698 bits (548), Expect = 5.360e-64
Identity = 122/298 (40.94%), Postives = 180/298 (60.40%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNR-KGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEI-TTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQ 1033
            RYL ++ P+VT E+ E T+ LV E  +PGG+GE LQ++L    ++ ENW+ D W+   YL+    L + SSPG+V P+Q+F++ + QL+FAA LI+G+LD+K ++D   LP     H    G+P CM QYY++FSS R PG  +D +  N +R      HI VA N  FF L++   + E  +  ++Y QL +I   +  + T+E +GILTA  R +W      LL D  NK+S  +I+KSIF +C+D P+       ES EL+ + +      A Q+LHG GS+ N  NRW+DKT+Q
Sbjct:   38 RYLRVLEPLVTPEELEYTRKLVAELARPGGLGEVLQSRLERKGRKTENWLLDWWVNTAYLECRTPLAVYSSPGVVMPRQNFRDTQGQLKFAAKLISGVLDFKQMLDTNNLP-----HGHFHGKPLCMNQYYQIFSSCRIPGPRRDTIV-NYSRQNNPPTHITVAHNYTFFKLDVYHPNGEILTPGEIYQQLEKIWN-SSIKTTKEPIGILTAEQRHRWGLGLNILLKDKLNKESSRVIQKSIFAVCLDGPMRC-----ESNELSMSQM------AAQILHGGGSKANTGNRWFDKTLQ 317          
BLAST of Choline O-acetyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008936.1 (pep scaffold:Pmarinus_7.0:GL476544:65876:98929:-1 gene:ENSPMAG00000008041.1 transcript:ENSPMAT00000008936.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.468 bits (550), Expect = 4.931e-60
Identity = 173/620 (27.90%), Postives = 292/620 (47.10%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSP-GMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKT-EEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCI-DKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHIL-------DYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLK----------DAFMC---YGAVVEHGYGAAY-NPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLE 1933
            RYL+ V P++  E +E+T+ L  +F     +  KLQ  L   S    N+V+D W E +YL+    + +NS+  GM F   +      Q   A N++  IL Y+  +++  L     T      P C  Q+ R+F++ R PG+  D L  ++N    D +H++V    +FF L +         ++L  Q +RI+    + +T EE +  LTA  R  WA  R        N+ SM+ +E++ F L + D       + PE         R   + +  LLHG        +RW+DK+   V+  +G  G+N EHS A+   V  + E+++        Y  E      T +     L PP++L+++I     +++ ++ +  + LAD++D        FG+ F K    SPD+F+Q+ LQL H++       TYE++  R F  GR + +R+ +  A  +  SM  D   +  E++ L R+AM+   ++ L  + G G+D HL  L   +  + +E S   K+   + S  +RLSTSQ P  +          D   C   +G V + GYG +Y    +N I   IS    CPDT +  F + +++   E+  ++ S ++
Sbjct:  185 RYLESVRPLMDDEKFERTQALATDFQNT--LAPKLQWYLKLKSWWASNYVSDWWEEYIYLRGRGPIMVNSNYYGMDF--LYVTPTSIQAARAGNVVYAILMYRKKLELEEL--QPLTLPNSCIPLCSAQWERMFNTTRIPGIETDTL-QHLN----DSKHLVVYHRGRFFRLWLYHGERLLGPRELQKQFQRILDDPSAPQTGEEKLAALTAGDRVPWAKARHAFFRSGVNRVSMDAVEQAAFFLTLSDDEQGYRPDDPE---------RTLNDYSKSLLHG-----KCYDRWFDKSFSLVVFKNGKTGINAEHSWADAPIVAHMFEYVMVTDALVMGYTAEGNCHGDTEMG----LPPPRRLQWDIPEECQEVVEDSMRVAQALADDVDCCTFAITDFGKGFIKKFRTSPDAFVQVMLQLAHFRDMGKFCLTYEASMTRLFREGRTETVRSCTSEACAFVRSMQ-DPNVTAAERVALFRTAMDKHQRMYLLAMTGLGIDRHLFCLYVVSRYLGLE-SPFLKE---VLSEPWRLSTSQTPLQQTKMFDPNQNPDYVTCGGGFGPVADDGYGVSYIIIGENMINFHISSKNSCPDTDSSRFGRNIRKVLQELKDMIESEMK 770          
BLAST of Choline O-acetyltransferase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010501.1 (pep scaffold:Pmarinus_7.0:GL477503:71677:77001:-1 gene:ENSPMAG00000009512.1 transcript:ENSPMAT00000010501.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 184.496 bits (467), Expect = 2.049e-53
Identity = 97/247 (39.27%), Postives = 144/247 (58.30%), Query Frame = 2
Query: 1187 LP-PKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTS 1924
            LP P KL +NI+    +MI  AK        +LDI    Y+KFG  FPK   +SPD FIQ+A+QL ++++H+ L    ESA+ R F LGR + IR  S+ +L++  +   D   S++EK+  ++ A+E   +     + G  +D HLLGLK  A+E    I ELF D +Y  ++  +LSTSQVP   DA MCYG VV  GYG  YNP  + +  +++    C  T AD+ A +++++  +MH LL+S
Sbjct:    1 LPIPTKLYFNINEEVKRMIESAKFHHDIQVGDLDIQCFVYKKFGNAFPKFHRLSPDGFIQMAIQLAYFRLHRELSVATESATTRMFHLGRTEEIRCTSMESLRFVETFD-DANVSNEEKMQTMKVAVEAHKEYTQWAVNGQAIDRHLLGLKLQAIEDQYNIPELFMDTSYAIASHLKLSTSQVPGSMDAVMCYGPVVPDGYGVCYNPQHDRLNFSVTALNSCSQTHADLMAAEIEKALTDMHELLSS 246          
BLAST of Choline O-acetyltransferase vs. Ensembl Yeast
Match: CAT2 (Carnitine acetyl-CoA transferase; present in both mitochondria and peroxisomes; transfers activated acetyl groups to carnitine to form acetylcarnitine which can be shuttled across membranes [Source:SGD;Acc:S000004506])

HSP 1 Score: 230.335 bits (586), Expect = 5.681e-66
Identity = 167/565 (29.56%), Postives = 285/565 (50.44%), Query Frame = 2
Query:  146 RYLDLVAPVVT-LEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLK-NTLALPINSS--PGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERP-SEKDLYNQLRRIV-RLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCID-KPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIK----SRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTS-MTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYG--AVVEHGYGAAY 1798
            +YL  + P    +E +E+ +LL ++F +   +G  LQ +L E +  K NW+A  W E  YL+ N   +P  S     M  P    + + + L  A  +I+ ++ +   I    LPV+      KG P+CM  +  +F++ R PG  +D   TNI    +++  + +A   +F+ L      ++P SE +++ QL  +V + ++S+     +G LT+LPR +W  V   L+ D  ++ S+E I KS F+LC+D    PVT                + NC     HG     +G NR+YDK++QF+++ +G+ G   EHS  +G   + L  ++   + ++      R++   SS    + P +L + I     + I  A+ + K      D+ +  Y K+G+ F K   MSPD+FIQ  +QL  +K  K  +PTYE+AS R++  GR +  R+ S  +L++ +     D P +  EKI  L+ + +  +  + +   G+GVD H  GLK      + +I  LFKD  +  S+ + +STSQ+ +  + F  YG   V ++G+G AY
Sbjct:   88 KYLQTIRPFCNDVETFERQQLLCKDFSE--HMGPILQDRLKEYANDKRNWMAKFWDEQSYLQYNDPIVPYVSYFYSHMPLPNHLSKIDNDPLIKATAIISTVVKFIEAIKDESLPVEII----KGMPFCMNSFSLMFNTSRLPGKPEDNQDTNIFYSVYENNFVTIAYKGKFYKLMTHDGNDKPLSENEIWRQLYSVVFQGSQSDPKLGGIGSLTSLPRDQWREVHLELMKDPISQDSLETIHKSSFMLCLDLDQSPVTLE------------EKSRNC----WHG-----DGINRFYDKSLQFLVTGNGSSGFLAEHSKMDGTPTLFLNNYVCQQLNKLDVDDFMRKVITPSSTV-AMKPMELPFIITPKIHKAIESAQLQFKETIGEHDLRVWHYNKYGKTFIKRHGMSPDAFIQQVIQLAVFKYLKRQLPTYEAASTRKYFKGRTETGRSVSTASLEFVSKWQNGDVPIA--EKIQALKHSAKEHSTYLKNAANGNGVDRHFFGLKNMLKSNDDQIPPLFKDPLFNYSSTWLISTSQLSS--EYFDGYGWSQVNDNGFGLAY 620          
BLAST of Choline O-acetyltransferase vs. Ensembl Yeast
Match: YAT1 (Outer mitochondrial carnitine acetyltransferase; minor ethanol-inducible enzyme involved in transport of activated acyl groups from the cytoplasm into the mitochondrial matrix; phosphorylated [Source:SGD;Acc:S000000080])

HSP 1 Score: 161.77 bits (408), Expect = 5.203e-42
Identity = 138/504 (27.38%), Postives = 225/504 (44.64%), Query Frame = 2
Query:  404 QLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERP---SEKDLYNQLRRIVRLAESEKTEEV-VGILTALPRRKWAAVRQHLLL--DLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGI--RDNVNCALQLLHGMGSEYNGA--NRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLP-----------------------PKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTV-NMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLK---EAAVEMNMEISELFKDKTYLESNQFRLSTSQV--PTLKDAFMCYGAVVEHGYGAAY 1798
            Q+R AA L   IL +   I    L  D     R   P  M+QY RLF S R P     E + ++  D   H H++     QF+  ++  +   P   + + L   L  I+  AES  +     G+ T   RR W+ +R +L    D TN +++++I+ ++F++C+D    V F   +  ELT++ +     +N          +   G   NRWYDK +Q +++ +G  G+N+EH+  +G  V+RL   I  Y + I S       +V D+                         P+KLE+  D+F    +  A+  I +L    +   L +  +G    KTV   SPD+F+Q   Q+ ++ ++      YE A  + F  GR + IR+ +  +  +  S+  D  ASD  KI LL  A    +++  +  QG G D HL  L        +  +E+  +F+DK++       LSTS    P LK     +G V  +G+G  Y
Sbjct:  121 QVRRAARLTTSILKFIRQIRHGTLRTDTV---RGKTPLSMDQYERLFGSSRIPP-GPGEPSCHLQTDATSH-HVVAMYRGQFYWFDVLDTRNEPIFATPEQLEWNLYSIIMDAESAGSGSAPFGVFTTESRRVWSNIRDYLFHADDCTNWRNLKLIDSALFVVCLDD---VAFAADQQDELTRSMLCGTSTINLDPHQHQPPLNVQTGTCLNRWYDK-LQLIVTKNGKAGINFEHTGVDGHTVLRLATDI--YTDSILSFARGVTKNVVDIFSDDDGKPSSSSLASAAHSANLITIPRKLEWRTDNFLQSSLHFAETRISDLISQYEFVNLDFSNYGASHIKTVFKCSPDAFVQQVFQVAYFALYGRFETVYEPAMTKAFQNGRTEAIRSVTGQSKLFVKSL-LDQDASDATKIQLLHDACTAHSQITRECSQGLGQDRHLYALYCLWNQWYKDKLELPPIFRDKSWTTMQNNVLSTSNCGNPCLKS--FGFGPVTANGFGIGY 610          
BLAST of Choline O-acetyltransferase vs. Ensembl Yeast
Match: YAT2 (Carnitine acetyltransferase; has similarity to Yat1p, which is a carnitine acetyltransferase associated with the mitochondrial outer membrane [Source:SGD;Acc:S000000826])

HSP 1 Score: 74.7146 bits (182), Expect = 3.447e-14
Identity = 103/466 (22.10%), Postives = 182/466 (39.06%), Query Frame = 2
Query:  593 INRDPFDHEHIIVACNNQFFVLEITTSAERP--SEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNH-PESVELTKAGIR---------DNVNC-----ALQLLHGMGSEYNG-ANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCD----LLP----------------------------PKKLEYNID-SFASQMISEAKQEIKNLADNLDIY-ILRYQ-KFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLK-------EAAVEMNMEIS----ELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAY 1798
            I R P D +HI++    Q++ LE+  S  +   +  +L      I++ +   +    +G LT+   R W   R+ L     N+  +  I+ ++F+L +D+    T N   ++ ++++   R          + NC        +++  G +     +RWYDK +Q V++AD    + ++    +G  V+R    I  Y E +   RL R  +  D    L P                            PK +   ID SF++ + +        LAD +  Y I+R     GR   + + + PDS +Q+ALQ+ HY ++  +V   E  S R F   R   I   S   L+ C    + +    D K+       E    ++     G G + H   LK          + ++ + S    +LF++   L  +Q  L  +               V HG+G  Y
Sbjct:  244 IKRHP-DSKHILIISRGQYYTLEVLDSTNKIIYTAAELTTIFNHIIKDSSGIEKSTALGSLTSHSFRNWKYARKRLQKRYPNE--LHRIDSALFVLVLDESQEETTNDGDDTADISQMFNRTITERDKKCTSANCKRVFYGTSIINSKGHQVGSCVSRWYDK-LQLVVTADAKATVIWDSFTCDGSVVLRFTSEI--YTESV--LRLARDVNAGDPQFSLWPNVTQMDPETKKLMTATISADGGGPSEIDPKLVVNKIDWSFSNILNTHVHLSETKLADLISKYDIVRASIPLGRRSAQRLGVKPDSMVQVALQIAHYALYGRMVFGLEPVSTRGFKNSRSSFINIQSQALLELCQLFISSSIDGTD-KLDKFIQTCETHNNMVKHAKSGVGYEKHFNALKYLFKFHDHFGIHLSGDESSAAKDLFENPLVLPFSQPELIVANCGNAATTTFGITPAVPHGFGIGY 700          
BLAST of Choline O-acetyltransferase vs. Ensembl Nematostella
Match: EDO44211 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW64])

HSP 1 Score: 366.696 bits (940), Expect = 5.521e-117
Identity = 202/593 (34.06%), Postives = 325/593 (54.81%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERP-SEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLT 1921
            +YL+ + P++  +D+E T++LV EF K GGIGE LQ KLLE +K+ +NW+A  W    YL   + + INS+P   FPK++F +  + +R++  L+  +L ++ ++D   L +D+  +    +P  M QY   F   R P + +D+            +HI+VA  NQF+ +++     +P  E ++  QL +IV+  E E  E  VG+ T+  R  WA  R  +  D  N+ + +MIE SI +LC+DKP P +   P   E     +     C     +G G EYN  NRW+DK  QF +S DGN G  +EH+ A+G  V R+ + I   M+E K  +  ++    DL  P+K+++N+     Q +  AK  + +   + D  +  YQ +G++F K++ +SPD++ Q++LQL  Y++H  + P +E+ S R+F LGR + IR+ASI   ++  +MT    AS  E+  L+R A+ + +    + + G  VD HLLGLK  AVE  + +  +F D +Y     F+LST QVP   ++++     V  GYG  YNP  N ++ ++S +   P T    FA  ++ S DEM  L T
Sbjct:   43 KYLNAIRPLINDDDFENTQVLVNEFRKKGGIGEILQGKLLERAKKTDNWMAGWWENVKYLDVRVPVVINSNPSWSFPKENFSDRFDFIRYSTRLVRAVLKFRQMVDNDQLSIDKMGN----KPLNMYQYKLFFCGCRVPQLNRDKYYVAAKGQA---KHIVVAHRNQFYSVDVYDGKGQPLGEPEIAAQLLKIVQNTEPE--EPPVGVFTSENRDVWAKERYAMAKDRNNRANFKMIESSICVLCLDKPCPPSTQVPSITECPSDSV---TGCQTLHAYGDGIEYNSLNRWFDKPKQFTVSEDGNSGGCFEHTCADGSTVQRVSDPI---MKERKDYKSIKVKDRSDLAAPQKMKWNLKPSTLQNMETAKDRLDSYVKDTDARLFAYQGYGKNFIKSLKLSPDAWFQISLQLAFYRLHGHVAPAHEAGSTRQFKLGRTETIRSASIATHEFVRAMTRKH-ASRAERYELMRRAINYHSTYTKEALDGKAVDRHLLGLKLTAVESGITLPAIFMDPSYHYFFHFKLSTRQVPLEHESWVVIRPAVPDGYGICYNPQPNKLMYSVSTFNSNPATNPGHFATAMQRSLDEMQLLGT 619          
BLAST of Choline O-acetyltransferase vs. Ensembl Nematostella
Match: EDO44258 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW66])

HSP 1 Score: 359.762 bits (922), Expect = 1.306e-114
Identity = 206/595 (34.62%), Postives = 347/595 (58.32%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERP-SEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSN 1927
            +YL  V P+V  +DYE+TK LV+EF K GG+GE+LQA L E  +  EN+V + W  + +L    ++ IN SPG  FPK+ F N+ +Q+RF+A L+    +++ +ID   L +DR   +    P  M QY       R P   + ++         + +H++V  NNQF+ L++  +  +P +E ++  QL +IV+ +++E  E  VG+LT+  R  WA  R+ L  D  NK+++ +++  I +LC+DKP P     P SV+ +     D+V  A Q LHG G +YN  NRW++K  QF +S +G+ G+ YEHS AE   + RL +++L +  + KS  +    +  +L  PKK+++N+ + + + I +AKQ ++   + +++ +  +Q +G+DF K+  +SPD++ Q++LQL  Y++H  +   YE+A++R+F LGR D+IR+ASIP L++  +M+     S  E+  L+R A+ + +K+  + + G G+D HL  LK A+ E  M++  +F D T+      +LSTSQVP     +  +G +V  GYG  YN   + ++  ++     P T A  FA  LK+S ++M  L T++
Sbjct:   21 KYLAAVRPLVDDKDYERTKSLVDEFRKSGGVGERLQAILKERERTTENYVTE-WWSNNFLSARDSVVINLSPGFTFPKEDFSNKLDQIRFSARLLHNTANFRDMIDNDELSIDRVGDS----PMSMYQYKLFLCGSRIP---RPKIDVYFVAPKGEAKHVVVVHNNQFYSLDVYGTDGKPLNEPEIAAQLLKIVQSSDAE--EPPVGVLTSENRSVWAKEREVLSQDPQNKENLYLLDSCIVVLCLDKPCPPPTQRP-SVDESPI---DSVT-ARQTLHGDGIQYNSLNRWFEKPNQFTVSENGHIGVCYEHSPAEAPTIGRLWDYVLAHKNDYKSIEI----AASNLPAPKKIKWNLKASSLEAIEKAKQRLQRDINAVEVKLFEFQGYGKDFIKSQKLSPDAWFQISLQLAFYRLHGHVAAPYETATVRKFKLGRSDSIRSASIPTLEFVKAMSKSY-TSQAERHNLMREAISYHSKLTKEAMNGQGIDRHLFALKCASQEAGMDLPAVFADPTHKYFFDCKLSTSQVPMPYRCWTLFGPMVTDGYGICYNQLPDRVLYCLTTDDTNPITDAGHFAAVLKKSLNDMQLLATTS 595          
BLAST of Choline O-acetyltransferase vs. Ensembl Nematostella
Match: EDO44257 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RW65])

HSP 1 Score: 347.051 bits (889), Expect = 1.438e-109
Identity = 208/603 (34.49%), Postives = 321/603 (53.23%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERP-SEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDN---IRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLST-------SQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLT 1921
            +YL+ + P++  +D+E T+ LV EF K  GIGE LQ KLLE +K+ +NW+A+ W    YL   + + IN +P   FPK++F +  + +R++  LI  +L ++ +ID   L +D+  +    +P  M QY       R P + +D+            +HI+VA  NQF+ +++  S  +P  E ++  QL +IV+  E E  E  VG+ T+  R  WA  R  +  D  N+ + EMIE SI ILC+DKP P +   P   E     +        Q LHG G EYN  NRW+DK  QF +S DG+CG+ YEH+ AE   V R+ E I   M+E K  +   +    DL  PKK+++N+     Q I  AK  + +   + D+ +  YQ +G++F K++ +SPD++ Q++LQL  Y+      P  E        L  ++N   IR+ASI   ++  +MT+   AS  E+  L+R A+ + +    +T+ G  VD HLLGLK  AVE  + +  +F D +Y     F+LST       SQVP   ++++ +G  V  GYG  YNP  N ++ ++S +   P T    FA  ++ S DEM  L T
Sbjct:   21 KYLNAIRPLINDDDFENTQELVNEFRKKDGIGEILQGKLLEKAKKTDNWMAEWWDNVAYLDVRVPVVINYNPSCTFPKENFSDRFDFIRYSTRLIRTVLKFRQMIDSEQLSIDKIGN----KPLNMYQYKLFLCGCRVPQLNRDKYYVAPKG---QAKHIVVAHRNQFYSVDVYDSKGQPLGEPEIAAQLMKIVQNTEPE--EPPVGVFTSENRDVWAKERYAMAKDRNNRANFEMIESSICILCLDKPCPPSTQVPSITECPSDSV-----TGRQTLHGDGIEYNSLNRWFDKPNQFTVSEDGHCGVCYEHTCAEAPTVGRMWEEI---MKERKDYKSIEVKDRSDLPVPKKMKWNLKPSILQNIETAKDRLDSFVKDTDVRLFSYQGYGKNFIKSLKLSPDAWFQISLQLAFYRSE----PVKECRPTTPLLLFIIENKTPIRSASIATHEFVRAMTSKH-ASRAERYELMRKAINYHSTYTKETLDGKAVDRHLLGLKLTAVESGITLPAIFMDPSYQYFFHFKLSTSQVSPFLSQVPLEHESWVVFGPAVPDGYGICYNPQPNKLMYSVSTFNSNPATNPGHFAAAMQRSLDEMQLLGT 601          
BLAST of Choline O-acetyltransferase vs. Ensembl Nematostella
Match: EDO40580 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6T0])

HSP 1 Score: 252.292 bits (643), Expect = 2.106e-73
Identity = 176/628 (28.03%), Postives = 296/628 (47.13%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSK--RKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIID------------------------VRGLPVDRATHNR---KGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLE-ITTSAERPSEKDLYNQLRRIVRLAESEKTEEV-VGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILD------YMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            RYLD   P++T E Y+ TK + E+F K  G    L A L++  K  +  +++A++W  DMYLK   ++ +N +P M F       + +QL  A N+I   + +K  +D                        +R +P   + +     K  P  M QY RLF S R P   KD+LAT+         H+++    +FFV + +TT     S   +Y  L++I  L + E++ E  +G+LT   R  WA +RQ +     N+++M +I+ +IF +C+D  VP                 D ++ A  +LHG     +G NRW+DK+ Q VI   G   +N+EH+  +G+AV+R    +         +    +R +T  S++      +KL   +     + ++ A++    +  +LD+  L    FG++  K+  +SPD+F+QLA Q+  Y+     VPTYES S   F  GR + IR AS P +    +      A  DE +  +R A  W  K+  +   G G D HL  L+  A     +  ++F+D+ Y   N+  LSTS + +       +G V+  G G  Y    + +   ++C+    D R   F + ++ S ++MH+++
Sbjct:   75 RYLDSQKPLLTPEQYQYTKNITEKFQKQEG--PALHADLIKKDKMNKHTSYIAELWY-DMYLKERNSIVLNHNPFMCFIDDPKPEQNDQLIRATNIIYSAMRFKNALDDLTLEPDIFHLNPKKSDTDWFKNIIRFVPGSLSWYGAFLVKAFPLDMSQYGRLFCSTRIPHPGKDKLATHEGA-----RHMLIMHKGKFFVFDTLTTDGNIVSTSTIYENLKQI--LNDPEQSPEFPIGLLTTDERETWARLRQAITAIPANQEAMRLIDSAIFTICLDDEVP----------------SDPMHLARIMLHG-----DGGNRWFDKSFQLVICKQGTSAVNFEHAWGDGVAVLRFFNEVFKDTTTRPALTADAARGMTGESTL------RKLHITLTPEIERGVAAAQKRFNKVTGDLDMDTLEITDFGKNHLKSKKVSPDAFMQLAFQMAIYRQLGHFVPTYESCSTAAFRHGRTETIRPASNPTVACSEAFNTAHRAGVDEMMDRIRKATAWHAKLTKEAAMGQGFDRHLFALRTIATAAGQK-PDIFEDEAYSRINRIYLSTSTLSSPAILLGGFGPVIPEGLGVGYAIFDDRLGCNVTCYKGGADVRG--FLECVRTSINDMHAVM 662          
BLAST of Choline O-acetyltransferase vs. Ensembl Nematostella
Match: EDO38455 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCT1])

HSP 1 Score: 196.438 bits (498), Expect = 1.033e-52
Identity = 173/649 (26.66%), Postives = 288/649 (44.38%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERP-SEKDLYNQLRRIVRLAES-----EKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDY------------MEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVP-TYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGL-------------KEAAVEMNMEISELFKDKTYLESNQFR-------------------------LSTSQVPTLKDAFMCYGAVVEHGYGAAYN-PHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            R+L  V P++  E+Y K + L ++F K   +G KLQ  L   S    N+  D W + +YL     LPINS+   +   Q +   +EQ   AA +    L Y   ++   L   R    R   P CM QY R F + R P    DEL   ++ +  + EHI+V C    +++ +  S  +  S  DL  Q   I+  A+      E  E  +  LT LPR +WA +R+    D  N++SME IE+++F++ ++     TF+     EL+        + A  ++HG     +G + W+DK+   V+  DG CG+N EHS A+   +  ++E+ L Y               I     +      +L  P +L +++    +Q++  A    K   D+L   ++ +  FG+ F K + +SPD+FIQLALQ+ +YK  +   P TYES+  R +  GR + +R+ +  A  +  +  +   AS +EKI L+R+A E    +  D + G G D HL  L              ++A+ +   +S   + +  + +  F                          L  +Q+P +    +      + GYG +Y  P +N I   +S       T ++ F + L  S  E+  L 
Sbjct:  190 RFLSSVKPLLDSEEYNKMEELSKDFEK--NLGPKLQFILQLKSWWATNYCTDWWEKYVYLMGRSPLPINSNYYCL--DQGWYPTREQPSRAAVITYFFLKYHQELETEQL---RPLLIRNTIPTCMAQYERTFKTVRIPKEDVDEL---VHFEHTEQEHIVVICGGNMYMVPVQDSHGKAISCLDLEGQFEWIIADAKHSDVKREHPEGSIPALTGLPRTEWATIRKEYFGDGLNRQSMETIEEALFVVLLEDK---TFS-----ELS--------DRAKYIMHG-----DGRSLWFDKSFCLVVFTDGKCGINAEHSWADAPVIGHMLEYALTYEFVYRTYNDKGRCNPIGGAHRSHNVRTHNLQRPCRLYWDVTPQLAQIVENAVTFCKKNNDDLQHKVITHDDFGKGFIKKIKVSPDAFIQLALQIAYYKDSEGKHPLTYESSMTRLYLHGRTETVRSLTSEAKAFVQAFMSKE-ASREEKIRLMRAAAEKHAIMYKDCMNGKGCDRHLFALFVVCRGQGYDSEFLKSALTLPWTLSTSQQPQQQMTAEHFSVNEPELMHMLEPEALQVFPFTCSLTLYETQLPQISPPVVGLALFSDDGYGVSYMVPDENRIFFHVSSKISSNKTNSERFVKNLYSSLAELKELF 806          
BLAST of Choline O-acetyltransferase vs. Ensembl Medaka
Match: CHAT (choline O-acetyltransferase [Source:NCBI gene;Acc:101173179])

HSP 1 Score: 514.612 bits (1324), Expect = 9.004e-174
Identity = 270/592 (45.61%), Postives = 372/592 (62.84%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATN-INRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTE-EVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPA-SDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL 1915
            YL  V  +V  E ++KTK +VE+FG PGG+GE LQ KLL+  ++  NWV D WLEDMYL N L LP+NSSP MVFPKQ F++  + LRFAA LI G+L+YK +ID R LPVD A     G P CMEQYYRLF+SYRYPG+  D L  N  ++ P   EH+IVAC NQFFVL++  + ++ SE ++  QL +I++ +E+ K     +G+LT+  R +WA  R+ L  D  N+ S+ +IE  + +LC+D+P  +  N              + N AL +LHG G+E NGANRWYDK+MQF++  DG CG+  EHS  EGI +++  EH++ Y+               +L PP++L++  D      IS A   +  L DNLD+ +  ++ +G+++ K   +SPD+FIQ+A+QL  YK    LV TYESASIRRF  GRVDNIR+A+  AL +  SMT +    SD EK+  L+ ++  QT   +  I G G+DNHLLGL  +A E+NME  E+F D+TY+ SN F LSTSQVPT ++ F CYG VV +GYGA YNP  + II  +S + +  +T + VF   L E   E+  L
Sbjct:   32 YLKSVQHLVKEEQFKKTKAIVEKFGAPGGVGEALQRKLLKRREKTTNWVYDYWLEDMYLNNRLPLPVNSSPAMVFPKQPFRDRTDALRFAARLICGVLEYKALIDKRALPVDFARGQLAGTPLCMEQYYRLFTSYRYPGLKTDTLRVNAASKAP---EHVIVACKNQFFVLDVVANDKQLSEVEILGQLEKIMKTSENSKDGCPPMGLLTSDGRTEWARAREALTRDQVNRDSLSLIENCLGVLCLDEPCGLQPN--------------DTNRALMMLHGGGAEKNGANRWYDKSMQFIVGMDGICGVVCEHSPFEGIVMVQCSEHLIKYIFR-------------ELPPPRRLQWKCDH--QTQISLAFFFLHRLVDNLDMDVFTFKAYGKEYIKKQKVSPDAFIQVAMQLAFYKCRGRLVSTYESASIRRFQDGRVDNIRSATPEALAFVKSMTDERDTFSDLEKMKRLKESINAQTNYTIAAISGMGIDNHLLGLLRSAKELNMEKPEIFSDETYVTSNHFILSTSQVPTTEEMFCCYGPVVPNGYGACYNPQSDHIIFCVSSFWEDTETSSAVFVSALNEGLLEIREL 591          
BLAST of Choline O-acetyltransferase vs. Ensembl Medaka
Match: chata (choline O-acetyltransferase [Source:NCBI gene;Acc:101156191])

HSP 1 Score: 488.034 bits (1255), Expect = 1.129e-162
Identity = 273/630 (43.33%), Postives = 393/630 (62.38%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAES-EKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPAS----DDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL---LTSNLELAKNRKAVKV----QDSILEESCRSET 2002
            YL  V  ++T E + KT+ +V++F  PGG+GE LQ+KL+E  ++  NWV D WL DMYL N +ALP+NSSP MVFP+Q+F+   + L+FAA+LI+G+L+YK ++D   LPVD A     G P CMEQY+RLF+S+R PG+ KD L    +    D EH+IVAC NQFFVL +  +  R +E+DL  QL +I ++AES E     VG+LT+  R +WA  R  L+ +  N+ S++MIE+S+ ++C+D+      + PE  + T+         A+ +LHG G+  NG NRWYDK MQFV+  DG CG+  EHS  EGI +++  E++L YM    S +L R +SV  L  P+KL +       + IS +  +++ L  NLD+ + ++  +G++F K   MSPD+FIQ+ALQL +Y+ H  +V TYESAS RRF  GRVDNIR+A+  AL +  +MT     S    + EK+ +LR A+  QT   +  I G  +DNHLLGL+E A EM ME  E+FKD  YL SN F LSTSQVPT  + F CYG VV++GYG  YNP  + II ++S + + P+T +  F + L +   +M  L    +++   A+ RK   +    Q S LE++ + E+
Sbjct:   33 YLRCVKHLLTEEQFNKTQKIVKQFEAPGGVGELLQSKLVEKREKTANWVFDYWLNDMYLNNRVALPVNSSPVMVFPQQNFRAPIDSLKFAAHLISGVLEYKALLDAHDLPVDCARGQLAGTPLCMEQYHRLFTSHRLPGLEKDTLVALESSMMPDPEHMIVACKNQFFVLNVVINFCRLNERDLLIQLEKIKKMAESGEDRLPPVGLLTSDGRTEWAEARSILMRESINRDSLDMIERSMCLVCLDEA-----SGPELSDTTR---------AMLMLHGGGAAKNGGNRWYDKPMQFVVGEDGCCGVVCEHSPFEGIVLVQCTEYLLKYMIGSPS-KLVRAASVSKLPAPRKLHWKCSPEIQKRISSSADKLQRLVKNLDMNVHKFCDYGKEFIKKQKMSPDAFIQVALQLAYYRCHGRMVSTYESASTRRFQKGRVDNIRSATPEALAFIRAMTDGKLNSSLLQNIEKMRMLREAITAQTNYTVLAISGMAIDNHLLGLREIAQEMKMEKPEIFKDAAYLISNHFLLSTSQVPTTVEMFCCYGPVVQNGYGVCYNPQSDHIIFSVSSFHESPETCSAEFVKHLLQGLQDMMDLCNECSTDPNTAERRKGPTLEPHSQASQLEKTLQRES 647          
BLAST of Choline O-acetyltransferase vs. Ensembl Medaka
Match: chata (choline O-acetyltransferase [Source:NCBI gene;Acc:101156191])

HSP 1 Score: 483.797 bits (1244), Expect = 4.326e-161
Identity = 272/627 (43.38%), Postives = 392/627 (62.52%), Query Frame = 2
Query:  149 YLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDV-RGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAES-EKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSL---LTSNLELAKNRKAVKV----QDSILEESCRSET 2002
            YL  V  ++T E + KT+ +V++F  PGG+GE LQ+KL+E  ++  NWV D WL DMYL N +ALP+NSSP MVFP+Q+F+   + L+FAA+LI+G+L+YK ++D    LPVD A     G P CMEQY+RLF+S+R PG+ KD L    +    D EH+IVAC NQFFVL +  +  R +E+DL  QL +I ++AES E     VG+LT+  R +WA  R  L+ +  N+ S++MIE+S+ ++C+D+      + PE  + T+         A+ +LHG G+  NG NRWYDK MQFV+  DG CG+  EHS  EGI +++  E++L YM    S +L R +SV  L  P+KL +       + IS +  +++ L  NLD+ + ++  +G++F K   MSPD+FIQ+ALQL +Y+ H  +V TYESAS RRF  GRVDNIR+A+  AL +  +MT     S  +K+ +LR A+  QT   +  I G  +DNHLLGL+E A EM ME  E+FKD  YL SN F LSTSQVPT  + F CYG VV++GYG  YNP  + II ++S + + P+T +  F + L +   +M  L    +++   A+ RK   +    Q S LE++ + E+
Sbjct:   30 YLRCVKHLLTEEQFNKTQKIVKQFEAPGGVGELLQSKLVEKREKTANWVFDYWLNDMYLNNRVALPVNSSPVMVFPQQNFRAPIDSLKFAAHLISGVLEYKALLDCSHDLPVDCARGQLAGTPLCMEQYHRLFTSHRLPGLEKDTLVALESSMMPDPEHMIVACKNQFFVLNVVINFCRLNERDLLIQLEKIKKMAESGEDRLPPVGLLTSDGRTEWAEARSILMRESINRDSLDMIERSMCLVCLDEA-----SGPELSDTTR---------AMLMLHGGGAAKNGGNRWYDKPMQFVVGEDGCCGVVCEHSPFEGIVLVQCTEYLLKYMIGSPS-KLVRAASVSKLPAPRKLHWKCSPEIQKRISSSADKLQRLVKNLDMNVHKFCDYGKEFIKKQKMSPDAFIQVALQLAYYRCHGRMVSTYESASTRRFQKGRVDNIRSATPEALAFIRAMTDGKLNS--KKMRMLREAITAQTNYTVLAISGMAIDNHLLGLREIAQEMKMEKPEIFKDAAYLISNHFLLSTSQVPTTVEMFCCYGPVVQNGYGVCYNPQSDHIIFSVSSFHESPETCSAEFVKHLLQGLQDMMDLCNECSTDPNTAERRKGPTLEPHSQASQLEKTLQRES 639          
BLAST of Choline O-acetyltransferase vs. Ensembl Medaka
Match: zgc:154046 (carnitine O-acetyltransferase [Source:NCBI gene;Acc:101160324])

HSP 1 Score: 446.047 bits (1146), Expect = 5.249e-147
Identity = 231/593 (38.95%), Postives = 360/593 (60.71%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATN-INRDPFDHEHIIVACNNQFFVLEITTSAERPSEKD-LYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            RYL ++ P+V+ E+ E T+ LV+EF K GG+GE+LQ +L   +++ +NW+++ W++  YL   + L + +SPG+V P+ HFQ+ + Q+RFAA LIAG+LD+K +ID   LPV+  +    G+  CM+QYY++ SS R PG  +D +  + + + P    HI V  N QFFVL++  S   P   D +Y QL +I   +  +  +E +GILT+  R  W     +L+ D TNK+S+  I+KSIF +C+D P+P       S EL  + +        Q+LHG G+ +N  NRW+DKT+QF++  DG+CGL YEH+ AEG  ++ LI+H++ YM+ I+  R    S +  L  P+KL +NI     + I  AKQ +  +  +LD+ +LR+  FG+  PK   +SPD F+Q+ALQL +++++ C   TYESAS+R F  GR D IR+ +  +L++  +M  D+    +EK+ +L  A++   +   + I G  +D HLLGL+  ++     + E+F D +Y  +N F LSTSQV +  D  MC+G VV  GYG  YNP    I +AI+ +  C +T A  FAQ +++S  +M +LL
Sbjct:   51 RYLAILEPIVSKEELEHTRQLVQEFLK-GGVGERLQKELERRARKTDNWLSEWWMQSAYLDCRMPLAVYTSPGVVLPRLHFQDRQGQMRFAAKLIAGVLDFKRMIDTETLPVEYLS----GKSLCMDQYYQILSSCRIPGPKRDTVVNHAVGKTP--PTHIAVVHNFQFFVLDVYNSDGTPLTVDQIYMQLEKIWN-SSLQTNKEPIGILTSQHRNTWGKAYNNLIKDKTNKESVRAIQKSIFAVCLDAPLPRV-----SDELYLSRV------TAQMLHGGGARWNSGNRWFDKTLQFIVGEDGSCGLVYEHAPAEGPPIVFLIDHVVKYMQNIQMVR----SPMVPLPMPQKLRFNITPEIKRDIENAKQNMNIMVHDLDVKVLRFPHFGKKLPKQYKLSPDGFVQMALQLAYFRMYNCCCSTYESASLRMFKYGRTDAIRSTTADSLQFVKAMQ-DSTKQKEEKVAMLEKAVQTHKENTYNAIHGQAIDRHLLGLRMQSITDLTSMPEIFMDTSYAVANHFNLSTSQVGSKTDCVMCFGPVVPDGYGVCYNPMDEHINIAITAFNSCEETNAANFAQAVEDSLLDMRALL 619          
BLAST of Choline O-acetyltransferase vs. Ensembl Medaka
Match: ENSORLT00000039205.1 (carnitine O-acetyltransferase [Source:NCBI gene;Acc:101160707])

HSP 1 Score: 435.647 bits (1119), Expect = 8.234e-143
Identity = 232/593 (39.12%), Postives = 351/593 (59.19%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERP-SEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPA-SDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            RY+  + P+  + D + TK LVEEF K GGIGE+LQ  L + ++R ENW++D W++  YL+  + + ++SSPG+V P+  F ++  Q+RFAA LIAG+LD+KT+ID   LPV+       G+P CM QYY + SS R PG+  D +  +    P    HI V  N QFF L++ +    P +  DL+ QL+RI R A  E + E VGILT + R  W     +L+ D TNK S+  I++SIF LC+D   P     PE    +        N A Q+LHG GS+ +  NRW+DKT+QF++  DG+CG NYEH+ AEG  ++ LI+H++++    +++     S    L  P+KL +NI       +  AK+ +  LA +LD+ ++ ++ FG++ PKT  MSPD+FIQ+ALQL +Y++ +    TYESAS+R F  GR D IR+AS  +  +  +   D P   + EK  LL +A++         + G  +D HLLGLK  A E  + +  +F D  Y ++  ++LSTSQVP+  D  MC+G VV +GYG  YNP ++ +  A+S +  C +T A   A+ ++++  +M +LL
Sbjct:   58 RYIAALEPITDVADLQHTKTLVEEFQKAGGIGERLQKGLEQRARRAENWLSDWWVQVAYLEYRMPVVVHSSPGLVLPRMTFSDQAGQIRFAAKLIAGVLDFKTMIDNETLPVEYM----GGKPLCMSQYYEVLSSCRIPGLKTDSVVNHAKSSP-PPRHITVVHNFQFFELDVYSGDGSPLTVDDLHVQLQRICR-ASPEPSAEPVGILTTMHRDAWGKAYLNLIKDPTNKDSVSTIQRSIFTLCLDGARPPG---PEQTYRS--------NAATQMLHGGGSQQHSGNRWFDKTLQFIVGEDGSCGANYEHAPAEGPPIVALIDHVVEFTRTAEAKG----SPAASLPEPRKLPFNITPDVQTDLEVAKRSMNTLAHDLDMKVVVFEHFGKNVPKTYKMSPDAFIQMALQLAYYRLLRRCCATYESASLRMFRRGRTDTIRSASSASAAFVRAF--DDPVRQNSEKRELLENAVKAHRSYTNIAVSGQAIDRHLLGLKLQAAEEKLSVPAIFTDPAYAKALHYQLSTSQVPSKTDCVMCFGPVVPNGYGVCYNPMEDHVNFAVSSFNSCQETDAARLARGVQDALLDMKTLL 627          
BLAST of Choline O-acetyltransferase vs. Planmine SMEST
Match: SMESG000051357.1 (SMESG000051357.1)

HSP 1 Score: 1381.7 bits (3575), Expect = 0.000e+0
Identity = 680/682 (99.71%), Postives = 680/682 (99.71%), Query Frame = 2
Query:   20 MAHPVREYVRRISSQNLEQYPEWDXXXXXXXXXXXXXXXXXMRYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNRKAVKVQDSILEESCRSETFLHYAFENQSTTEMGNIKLQD 2065
            MAHPVREYVRRISSQNLEQYPEWDLSKPLPKLPVPDLKLTLMRYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNRKAVKV DSILEESCRSETFLHYAFENQS TEMGNIKLQD
Sbjct:    1 MAHPVREYVRRISSQNLEQYPEWDLSKPLPKLPVPDLKLTLMRYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNRKAVKVHDSILEESCRSETFLHYAFENQSATEMGNIKLQD 682          
BLAST of Choline O-acetyltransferase vs. Planmine SMEST
Match: SMESG000051357.1 (SMESG000051357.1)

HSP 1 Score: 1073.15 bits (2774), Expect = 0.000e+0
Identity = 513/515 (99.61%), Postives = 513/515 (99.61%), Query Frame = 2
Query:  521 MEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNRKAVKVQDSILEESCRSETFLHYAFENQSTTEMGNIKLQD 2065
            MEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNRKAVKV DSILEESCRSETFLHYAFENQS TEMGNIKLQD
Sbjct:    1 MEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNRKAVKVHDSILEESCRSETFLHYAFENQSATEMGNIKLQD 515          
BLAST of Choline O-acetyltransferase vs. Planmine SMEST
Match: SMESG000037968.1 (SMESG000037968.1)

HSP 1 Score: 359.377 bits (921), Expect = 8.466e-114
Identity = 208/596 (34.90%), Postives = 327/596 (54.87%), Query Frame = 2
Query:  146 RYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVRGLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHE---HIIVACNNQFFVLEITTSAERP--SEKDLYNQLRRIVRLAESEKTEEVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNIDSFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLL 1918
            +Y   + P+V+  +Y+ T+ L+ +F KP G GE LQ  LL+ + +KENW++D W+   YL     + INS+PG+  P + F    + L F+ NL+  IL YK +ID   LP D      K  P CM QYY LF++ R P   +D + T ++     H    +I V  NN+FF++++     +   S+  ++    +I+ L  S+ + + +G+LTA  R  W      L     N KS   I+KSI + C+DKPV          E  K+   D++  A  +LHG G + N  NRW+DKT+Q ++S+DG CG+NYEH+ AE   VI +I    DY  +  S      S   D  P  ++E+ +D  +++ I E+K  I +L  +L+++ + +  FG+   K +N+SPD+FIQ+ +QL ++ +HK    TYES S+RRF LGR D IR+ S  A+++C S+        ++K  LL SA+        + + G+GVD HLLGLK AA+     + +LF D ++ ++    LSTSQ P+  D  MC+G +V  GYG  YNP +N I   IS     P T A   ++ + +++ ++  +L
Sbjct:   43 KYEKYIKPIVSENEYQYTQKLISDFLKPNGEGEILQNILLKRAGKKENWLSDWWMNAAYLDYRDPVVINSNPGVRLPIEKFDTSDKWLEFSVNLLVEILKYKILIDSNELPQDYL----KTDPLCMNQYYTLFNACRIPDKRRDTIYTGLSHSSEKHTRIGYITVVHNNRFFMMDVINQLNQQIYSKDAIFRGFCKILEL--SQNSGQPIGLLTAENRNTWGTSFTRLREIPENSKSFSYIQKSILLFCLDKPV--------FTEEYKSENPDSI-VARNMLHGNGCKMNSPNRWFDKTLQVIVSSDGACGVNYEHTPAEAPPVITII----DYAYKNMSSDGLENSLKIDSCPVTEIEFELDKKSTEEIDESKNNINSLVRDLELHAVSFLDFGKKNIKALNVSPDAFIQIGIQLGYFNLHKSPGSTYESGSLRRFHLGRTDTIRSCSPEAVEFCKSVNNPNATLTEQKECLL-SAILNHVNYTKEVLNGNGVDRHLLGLKLAAIGYRKNLPDLFLDTSFSKAFHHVLSTSQGPSSVDLTMCFGPLVPDGYGFCYNPQRNKINFCISAINSSPSTNALSLSEHITDAWRKIFDIL 618          
BLAST of Choline O-acetyltransferase vs. Planmine SMEST
Match: SMESG000051357.1 (SMESG000051357.1)

HSP 1 Score: 268.085 bits (684), Expect = 1.842e-85
Identity = 149/149 (100.00%), Postives = 149/149 (100.00%), Query Frame = 2
Query:   20 MAHPVREYVRRISSQNLEQYPEWDXXXXXXXXXXXXXXXXXMRYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDV 466
            MAHPVREYVRRISSQNLEQYPEWDLSKPLPKLPVPDLKLTLMRYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDV
Sbjct:    1 MAHPVREYVRRISSQNLEQYPEWDLSKPLPKLPVPDLKLTLMRYLDLVAPVVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDV 149          
BLAST of Choline O-acetyltransferase vs. Planmine SMEST
Match: SMESG000022952.1 (SMESG000022952.1)

HSP 1 Score: 197.593 bits (501), Expect = 1.270e-53
Identity = 165/624 (26.44%), Postives = 290/624 (46.47%), Query Frame = 2
Query:  188 YEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKE--NWVADIWLEDMYLKNTLALPINSSPGMVFPKQHFQNEKE--------------QLRFAANLIAGILD------YKTIID-------VRGLPVDRATHNR----KGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHEHIIVACNNQFFVLEITTS-AERPSEKDLYNQLRRIVRLAESEKTE-EVVGILTALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPESVELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLNYEHSVAEGIAVIRLIEHILDYMEEIKSRRLTR-LSSVCDLLPPK----KLEYNIDS-FASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLALQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADTPASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEISELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSIIVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLEL 1936
            Y +TK  +E F      G KL ++L++  K+    N+V  IW  D YLK+   + +  +P MVF     +N K+               +RFA +L   +L+      +K   D       +R +P   + H         P  M Q   LF++ R P   KDEL TN N +     H++V  N Q ++ +I  S       + +Y+ LR I+    S   +   +G+LT + R KW+ +RQ L+  L N++++  I+ + F++ +D               + +  +D +      LHG        NRW+DK+   +I   G   LN+EHS  +G+AV+   E +  Y +  ++ + ++ L+S  +L  P     +LE+ +++ F   ++  AK+E  N  + L++ + R  + G +F  +    PD+ IQLA Q+ +YK++    P+YES S   F  GR + +R A+  +  +C  +   + A++      L+   +   ++ L  + G G D H++GLK  A   + +I ++F D +Y   N+  LSTS VP        + AV   GYG  Y   +N     +S W +   ++   +   L ESF ++  ++    +L
Sbjct:   75 YSETKKCIESFKL--NEGPKLHSELMDFQKKNSHTNYVNIIW-TDRYLKDREPVVLTHNPTMVF-----KNSKKCTSQIARATNLIFSSIRFARSLKLDLLEPLIYHRFKEKSDTESFRKIIRLIPSLFSWHVAYLFYNAFPLDMSQLKYLFNTTRIPKPGKDELVTNENAN-----HLLVIHNGQMYIFDIFQSNGHSVKPEQIYSNLRFILNQPVSVSHQLPGLGVLTTMNREKWSTIRQQLI-QLGNEETLRKIDSAAFVVALDN-------------FSYSNQKDTI---YNTLHGPAE-----NRWFDKSFSLIIDTKGETALNFEHSWGDGLAVLSYFEEV--YRDSEQNPQFSQPLTSEQELNLPTAHVDRLEFFLNTQFTENILPTAKKEYDNRRNFLNLEMNRSDRIGSNFLSSTKFDPDAIIQLAFQMAYYKLNGKQAPSYESVSTSAFKDGRTETLRPATAESKLFC-ELVHSSSATNSNLYDALQKCSDKHCRLKLQALMGKGWDRHMMGLKYFAQSAD-KIPDIFTDPSYEYINKIILSTSTVPAKALEMGAFAAVSLDGYGIGYRISENDCGAIVSNWSNSAHSKGSQYISALMESFGKIREIIDRQAKL 659          
The following BLAST results are available for this feature:
BLAST of Choline O-acetyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHAT0.000e+044.70choline O-acetyltransferase [Source:HGNC Symbol;Ac... [more]
CHAT0.000e+044.70choline O-acetyltransferase [Source:HGNC Symbol;Ac... [more]
CHAT0.000e+044.70choline O-acetyltransferase [Source:HGNC Symbol;Ac... [more]
CHAT0.000e+044.70choline O-acetyltransferase [Source:HGNC Symbol;Ac... [more]
CHAT8.345e-18044.70choline O-acetyltransferase [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Choline O-acetyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cha-13.716e-10735.33Choline O-acetyltransferase [Source:UniProtKB/Swi... [more]
B0395.37.767e-9632.32pep chromosome:WBcel235:X:16035055:16039514:-1 gen... [more]
B0395.37.767e-9632.32pep chromosome:WBcel235:X:16035063:16039231:-1 gen... [more]
cpt-23.172e-4927.13Carnitine Palmitoyl Transferase [Source:UniProtKB... [more]
F41E7.63.600e-4926.02pep chromosome:WBcel235:X:10307137:10310466:-1 gen... [more]
back to top
BLAST of Choline O-acetyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ChAT2.718e-15241.01gene:FBgn0000303 transcript:FBtr0089368[more]
ChAT8.687e-15240.71gene:FBgn0000303 transcript:FBtr0089367[more]
CRAT9.974e-10233.17gene:FBgn0037440 transcript:FBtr0347005[more]
CRAT1.757e-10133.17gene:FBgn0037440 transcript:FBtr0110774[more]
CRAT2.218e-10133.17gene:FBgn0037440 transcript:FBtr0081734[more]
back to top
BLAST of Choline O-acetyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chata0.000e+045.59choline O-acetyltransferase a [Source:NCBI gene;Ac... [more]
chata0.000e+045.59choline O-acetyltransferase a [Source:NCBI gene;Ac... [more]
crata5.086e-14740.20carnitine O-acetyltransferase a [Source:ZFIN;Acc:Z... [more]
crata5.164e-14740.20carnitine O-acetyltransferase a [Source:ZFIN;Acc:Z... [more]
crata5.164e-14740.20carnitine O-acetyltransferase a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Choline O-acetyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHAT6.995e-17845.42choline O-acetyltransferase [Source:NCBI gene;Acc:... [more]
CHAT1.563e-17745.50choline O-acetyltransferase [Source:NCBI gene;Acc:... [more]
CHAT2.099e-16544.03choline O-acetyltransferase [Source:NCBI gene;Acc:... [more]
CHAT2.445e-16544.03choline O-acetyltransferase [Source:NCBI gene;Acc:... [more]
CHAT4.358e-16343.30choline O-acetyltransferase [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Choline O-acetyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chat2.053e-17844.61choline acetyltransferase [Source:MGI Symbol;Acc:M... [more]
Crat1.320e-14340.40carnitine acetyltransferase [Source:MGI Symbol;Acc... [more]
Crat2.574e-14340.40carnitine acetyltransferase [Source:MGI Symbol;Acc... [more]
Crat2.574e-14340.40carnitine acetyltransferase [Source:MGI Symbol;Acc... [more]
Crot2.451e-7028.97carnitine O-octanoyltransferase [Source:MGI Symbol... [more]
back to top
BLAST of Choline O-acetyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P13222|CLAT_PIG0.000e+045.87Choline O-acetyltransferase OS=Sus scrofa OX=9823 ... [more]
sp|B2ZGJ1|CLAT_DANRE0.000e+045.59Choline O-acetyltransferase OS=Danio rerio OX=7955... [more]
sp|Q90YJ9|CLAT_CHICK2.416e-17945.37Choline O-acetyltransferase OS=Gallus gallus OX=90... [more]
sp|Q03059|CLAT_MOUSE2.811e-17944.78Choline O-acetyltransferase OS=Mus musculus OX=100... [more]
sp|P28329|CLAT_HUMAN4.007e-17944.70Choline O-acetyltransferase OS=Homo sapiens OX=960... [more]
back to top
BLAST of Choline O-acetyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D5MS680.000e+088.86Choline acetyltransferase OS=Dugesia japonica OX=6... [more]
A0A3Q0KP430.000e+061.29Putative choline o-acyltransferase OS=Schistosoma ... [more]
A0A4Z2DB670.000e+061.29Choline O-acetyltransferase OS=Schistosoma japonic... [more]
A0A3R7D6660.000e+060.54Choline O-acetyltransferase OS=Clonorchis sinensis... [more]
G7Y4F40.000e+060.54Choline O-acetyltransferase OS=Clonorchis sinensis... [more]
back to top
BLAST of Choline O-acetyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chata0.000e+046.19choline O-acetyltransferase a [Source:NCBI gene;Ac... [more]
ENSAMXT00000004414.21.277e-16943.98pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
crata1.502e-14640.54carnitine O-acetyltransferase [Source:NCBI gene;Ac... [more]
zgc:1540464.986e-13837.84carnitine O-acetyltransferase-like [Source:NCBI ge... [more]
zgc:1540466.447e-13437.16carnitine O-acetyltransferase-like [Source:NCBI ge... [more]
back to top
BLAST of Choline O-acetyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chata2.348e-16543.19choline O-acetyltransferase a [Source:NCBI gene;Ac... [more]
ENSPMAT00000002015.12.489e-14539.60pep scaffold:Pmarinus_7.0:GL479138:18281:30704:1 g... [more]
ENSPMAT00000002355.15.360e-6440.94pep scaffold:Pmarinus_7.0:GL479051:22504:40466:1 g... [more]
ENSPMAT00000008936.14.931e-6027.90pep scaffold:Pmarinus_7.0:GL476544:65876:98929:-1 ... [more]
ENSPMAT00000010501.12.049e-5339.27pep scaffold:Pmarinus_7.0:GL477503:71677:77001:-1 ... [more]
back to top
BLAST of Choline O-acetyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
CAT25.681e-6629.56Carnitine acetyl-CoA transferase; present in both ... [more]
YAT15.203e-4227.38Outer mitochondrial carnitine acetyltransferase; m... [more]
YAT23.447e-1422.10Carnitine acetyltransferase; has similarity to Yat... [more]
back to top
BLAST of Choline O-acetyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO442115.521e-11734.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442581.306e-11434.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO442571.438e-10934.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405802.106e-7328.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384551.033e-5226.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Choline O-acetyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHAT9.004e-17445.61choline O-acetyltransferase [Source:NCBI gene;Acc:... [more]
chata1.129e-16243.33choline O-acetyltransferase [Source:NCBI gene;Acc:... [more]
chata4.326e-16143.38choline O-acetyltransferase [Source:NCBI gene;Acc:... [more]
zgc:1540465.249e-14738.95carnitine O-acetyltransferase [Source:NCBI gene;Ac... [more]
ENSORLT00000039205.18.234e-14339.12carnitine O-acetyltransferase [Source:NCBI gene;Ac... [more]
back to top
BLAST of Choline O-acetyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051357.10.000e+099.71SMESG000051357.1[more]
SMESG000051357.10.000e+099.61SMESG000051357.1[more]
SMESG000037968.18.466e-11434.90SMESG000037968.1[more]
SMESG000051357.11.842e-85100.00SMESG000051357.1[more]
SMESG000022952.11.270e-5326.44SMESG000022952.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031525 ID=SMED30031525|Name=Choline O-acetyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=2388bp
CTATATAAATCTTATATGAATGGCTCACCCAGTTAGAGAATATGTTCGAC
GAATATCTTCACAGAATCTAGAGCAGTATCCTGAATGGGATCTTTCAAAA
CCATTGCCAAAATTACCGGTTCCGGATTTGAAACTAACATTAATGAGATA
TTTGGATTTGGTGGCACCGGTTGTGACATTGGAAGATTATGAAAAAACTA
AACTACTTGTTGAAGAATTCGGAAAGCCCGGTGGCATTGGTGAAAAATTA
CAGGCAAAATTGTTAGAGAATTCAAAAAGAAAAGAAAATTGGGTTGCAGA
TATATGGTTGGAAGACATGTATTTGAAAAATACTTTGGCACTTCCGATAA
ACTCCAGTCCAGGAATGGTGTTTCCCAAACAACATTTTCAGAACGAAAAA
GAACAATTGAGATTTGCTGCAAATTTAATAGCCGGAATCTTGGATTACAA
GACAATCATAGATGTACGAGGTCTTCCAGTGGATCGTGCTACTCATAATC
GGAAGGGTCAACCCTATTGCATGGAACAATACTATAGATTATTCTCATCG
TACAGATACCCGGGGGTAACCAAAGATGAACTTGCAACAAATATCAATCG
AGATCCATTCGACCATGAGCACATAATCGTAGCCTGCAATAATCAATTTT
TCGTATTGGAAATAACGACATCAGCCGAGAGACCGAGTGAAAAAGATCTC
TACAACCAACTAAGACGTATTGTTAGATTAGCAGAATCTGAAAAAACAGA
GGAAGTCGTTGGCATTTTAACGGCTCTTCCTCGCAGAAAATGGGCTGCTG
TCAGGCAACACCTGTTGCTCGATTTAACAAATAAGAAAAGTATGGAGATG
ATCGAAAAGAGCATATTTATTTTATGTATCGATAAACCTGTTCCCGTCAC
TTTCAATCATCCAGAAAGTGTTGAACTCACAAAAGCAGGAATCAGGGATA
ACGTTAATTGTGCTCTGCAATTACTCCATGGAATGGGATCCGAGTACAAT
GGGGCTAACAGATGGTACGACAAAACTATGCAGTTTGTTATATCAGCCGA
TGGAAACTGTGGACTCAATTATGAACATTCGGTTGCTGAAGGTATTGCAG
TTATCAGACTGATTGAACATATCTTGGATTACATGGAAGAAATAAAATCC
CGAAGACTGACTCGGTTATCATCTGTCTGTGATCTCCTGCCACCAAAGAA
ACTAGAATATAATATTGATAGCTTTGCCAGTCAAATGATATCTGAAGCCA
AACAAGAAATTAAAAATTTGGCCGATAATTTGGATATTTATATTCTACGA
TACCAGAAATTTGGTAGAGATTTTCCTAAAACTGTCAACATGAGTCCTGA
TTCCTTCATCCAACTGGCACTTCAACTCACCCATTACAAGATTCATAAAT
GTCTTGTTCCAACATATGAAAGTGCTTCCATAAGGAGGTTTTCTCTGGGA
CGCGTAGACAACATTCGTGCGGCTTCAATTCCAGCATTAAAATGGTGTAC
ATCAATGACTGCTGATACTCCTGCTTCGGATGACGAAAAGATCATTCTTT
TACGCTCGGCAATGGAATGGCAGACAAAGGTTATGTTGGACACGATTCAG
GGTCATGGAGTTGATAACCATTTGTTAGGTCTGAAAGAAGCAGCAGTTGA
AATGAATATGGAAATCTCAGAACTGTTTAAAGATAAAACTTATTTAGAAT
CTAACCAGTTTCGTTTATCCACAAGCCAGGTACCGACTTTAAAGGATGCA
TTTATGTGCTATGGAGCAGTAGTGGAACATGGTTATGGAGCAGCCTACAA
TCCCCATAAAAATAGTATTATTGTGGCAATAAGTTGTTGGTGTGATTGCC
CTGACACAAGAGCGGACGTGTTTGCTCAAAAACTCAAAGAATCCTTCGAC
GAAATGCACAGTCTTTTAACTTCGAATTTAGAGTTGGCAAAGAATCGGAA
AGCCGTCAAAGTTCAGGACAGTATATTGGAGGAGTCATGTCGCAGTGAAA
CATTTCTACATTATGCATTCGAGAACCAATCGACAACAGAAATGGGTAAC
ATAAAGTTACAAGATTAATACTCAAAATTTGTTAGACCCAGATAGATACT
ATATATAGATGGATTTATTATTTATATTATTATGATTATGTAATAATAGA
GAGAACTATCGTTTAGTTTTTCGAGAGTTTGATCATTGTTTTTAGAATAG
CAACTTTTTGTGGGATTTGTTTTTTGGTATTTTTTAGTATTATGGAAATT
TTAGTGCAAGGGATGTTTTATTATTCACTTGATATCTGTACTAGGCTCCG
TTTAGAATGCTATATGCCTATATATGAAATTTGTAGAAATGTCTACAACT
CCATTTTTTGATTGGATTAAAATTTTGTGTGCTTTAAA
back to top

protein sequence of SMED30031525-orf-1

>SMED30031525-orf-1 ID=SMED30031525-orf-1|Name=SMED30031525-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=683bp
MAHPVREYVRRISSQNLEQYPEWDLSKPLPKLPVPDLKLTLMRYLDLVAP
VVTLEDYEKTKLLVEEFGKPGGIGEKLQAKLLENSKRKENWVADIWLEDM
YLKNTLALPINSSPGMVFPKQHFQNEKEQLRFAANLIAGILDYKTIIDVR
GLPVDRATHNRKGQPYCMEQYYRLFSSYRYPGVTKDELATNINRDPFDHE
HIIVACNNQFFVLEITTSAERPSEKDLYNQLRRIVRLAESEKTEEVVGIL
TALPRRKWAAVRQHLLLDLTNKKSMEMIEKSIFILCIDKPVPVTFNHPES
VELTKAGIRDNVNCALQLLHGMGSEYNGANRWYDKTMQFVISADGNCGLN
YEHSVAEGIAVIRLIEHILDYMEEIKSRRLTRLSSVCDLLPPKKLEYNID
SFASQMISEAKQEIKNLADNLDIYILRYQKFGRDFPKTVNMSPDSFIQLA
LQLTHYKIHKCLVPTYESASIRRFSLGRVDNIRAASIPALKWCTSMTADT
PASDDEKIILLRSAMEWQTKVMLDTIQGHGVDNHLLGLKEAAVEMNMEIS
ELFKDKTYLESNQFRLSTSQVPTLKDAFMCYGAVVEHGYGAAYNPHKNSI
IVAISCWCDCPDTRADVFAQKLKESFDEMHSLLTSNLELAKNRKAVKVQD
SILEESCRSETFLHYAFENQSTTEMGNIKLQD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000099neuron
PLANA:0000418head
PLANA:0000463cholinergic neuron
Vocabulary: INTERPRO
TermDefinition
IPR042232Cho/carn_acyl_trans_1
IPR042231Cho/carn_acyl_trans_2
IPR039551Cho/carn_acyl_trans
IPR000542Carn_acyl_trans
Vocabulary: molecular function
TermDefinition
GO:0016746transferase activity, transferring acyl groups
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 407..427
NoneNo IPR availablePANTHERPTHR22589:SF14CHOLINE O-ACETYLTRANSFERASEcoord: 17..643
NoneNo IPR availableSUPERFAMILYSSF52777CoA-dependent acyltransferasescoord: 27..420
NoneNo IPR availableSUPERFAMILYSSF52777CoA-dependent acyltransferasescoord: 420..634
IPR042232Choline/Carnitine o-acyltransferase, domain 1GENE3DG3DSA:3.30.559.40coord: 29..629
e-value: 8.7E-207
score: 690.0
IPR042231Choline/Carnitine o-acyltransferase, domain 2GENE3DG3DSA:3.30.559.70coord: 90..424
e-value: 8.7E-207
score: 690.0
IPR039551Choline/carnitine acyltransferase domainPFAMPF00755Carn_acyltransfcoord: 29..629
e-value: 1.2E-179
score: 598.8
IPR000542Acyltransferase ChoActase/COT/CPTPANTHERPTHR22589CARNITINE O-ACYLTRANSFERASEcoord: 17..643
IPR000542Acyltransferase ChoActase/COT/CPTPROSITEPS00440ACYLTRANSF_C_2coord: 331..358