Tyrosine-protein kinase

Overview
NameTyrosine-protein kinase
Smed IDSMED30031519
Length (bp)2207
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Tyrosine-protein kinase (SMED30031519) t-SNE clustered cells

Violin plots show distribution of expression levels for Tyrosine-protein kinase (SMED30031519) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Tyrosine-protein kinase (SMED30031519) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Tyrosine-protein kinase (SMED30031519) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031519

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031519SMESG000020289.1 dd_Smed_v4_9416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031519SMESG000020289.1 dd_Smed_v4_9416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031519SMESG000020289.1 dd_Smed_v4_9416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031519SMESG000020289.1 dd_Smed_v4_9416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031519SMESG000020289.1 dd_Smed_v4_9416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031519SMESG000020289.1 dd_Smed_v4_9416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031519SMESG000020289.1 dd_Smed_v4_9416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031519SMESG000020289.1 dd_Smed_v4_9416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031519SMESG000020289.1 dd_Smed_v4_9416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031519SMESG000020289.1 dd_Smed_v4_9416_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
photoreceptor neuronSMED30031519SMESG000020289.1 SMED30031519smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: FYN (FYN proto-oncogene, Src family tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:4037])

HSP 1 Score: 521.546 bits (1342), Expect = 3.663e-178
Identity = 248/472 (52.54%), Postives = 324/472 (68.64%), Query Frame = 1
Query:  472 STNYGSKTDIHRNR------FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              N  S T   R R        +A++DY+ART D++   KG++  +L S++ DWW      TG  GY+PS+++A   S ++++WYF  + RKDAER LL  GN RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNG T VA+KTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE M+KGSLL +L+   G+A+ L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG G ICKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CP  ++E+M+ CW   PE RPTF  L+   +D F   E  Y+  E
Sbjct:   66 GVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGE 535          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: FYN (FYN proto-oncogene, Src family tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:4037])

HSP 1 Score: 521.546 bits (1342), Expect = 3.663e-178
Identity = 248/472 (52.54%), Postives = 324/472 (68.64%), Query Frame = 1
Query:  472 STNYGSKTDIHRNR------FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              N  S T   R R        +A++DY+ART D++   KG++  +L S++ DWW      TG  GY+PS+++A   S ++++WYF  + RKDAER LL  GN RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNG T VA+KTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE M+KGSLL +L+   G+A+ L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG G ICKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CP  ++E+M+ CW   PE RPTF  L+   +D F   E  Y+  E
Sbjct:   66 GVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGE 535          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: SRC (SRC proto-oncogene, non-receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:11283])

HSP 1 Score: 508.064 bits (1307), Expect = 7.203e-173
Identity = 240/451 (53.22%), Postives = 316/451 (70.07%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
             +A++DY++RT  ++  KKG+R+ ++ + + DWWL    +TG  GY+PS+++A   S ++++WYF  ITR+++ER LL   N RG FL+R SETT+GA CLSV D     G  V HYKI+K + G  YIT++  F SL QL+ YYS   +GLC  L+  C    P    L+   KD WEI R SL+L  KLG G FGEVW G WNGTT VA+KTLKPGTM+ E FL+EA+VMK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+ ETG+ + L QL+D  +QIA+GMAY+E   YVHRDL A NILVGE  +CK+ADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E+ T+G+VP+P M N E L  +E GYRMP P +CP  ++++M QCW   PE RPTF  L+   +D F + E  Y+  E
Sbjct:   89 FVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLA---KDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGE 534          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: SRC (SRC proto-oncogene, non-receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:11283])

HSP 1 Score: 508.064 bits (1307), Expect = 7.203e-173
Identity = 240/451 (53.22%), Postives = 316/451 (70.07%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
             +A++DY++RT  ++  KKG+R+ ++ + + DWWL    +TG  GY+PS+++A   S ++++WYF  ITR+++ER LL   N RG FL+R SETT+GA CLSV D     G  V HYKI+K + G  YIT++  F SL QL+ YYS   +GLC  L+  C    P    L+   KD WEI R SL+L  KLG G FGEVW G WNGTT VA+KTLKPGTM+ E FL+EA+VMK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+ ETG+ + L QL+D  +QIA+GMAY+E   YVHRDL A NILVGE  +CK+ADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E+ T+G+VP+P M N E L  +E GYRMP P +CP  ++++M QCW   PE RPTF  L+   +D F + E  Y+  E
Sbjct:   89 FVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLA---KDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGE 534          
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Match: SRC (SRC proto-oncogene, non-receptor tyrosine kinase [Source:HGNC Symbol;Acc:HGNC:11283])

HSP 1 Score: 508.064 bits (1307), Expect = 7.203e-173
Identity = 240/451 (53.22%), Postives = 316/451 (70.07%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
             +A++DY++RT  ++  KKG+R+ ++ + + DWWL    +TG  GY+PS+++A   S ++++WYF  ITR+++ER LL   N RG FL+R SETT+GA CLSV D     G  V HYKI+K + G  YIT++  F SL QL+ YYS   +GLC  L+  C    P    L+   KD WEI R SL+L  KLG G FGEVW G WNGTT VA+KTLKPGTM+ E FL+EA+VMK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+ ETG+ + L QL+D  +QIA+GMAY+E   YVHRDL A NILVGE  +CK+ADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E+ T+G+VP+P M N E L  +E GYRMP P +CP  ++++M QCW   PE RPTF  L+   +D F + E  Y+  E
Sbjct:   89 FVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLA---KDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGE 534          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 454.521 bits (1168), Expect = 2.475e-153
Identity = 220/455 (48.35%), Postives = 304/455 (66.81%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLD-HPVNSGYVVNHYKIKKTNQGAVY-ITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICS-DEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEG----EICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIY-EIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGY 1857
            L+A++ Y +R   ++  +KGD + LL+ ++ DWW V  + TG  GYVP +F+A + + ES++WY   I R  AER +L     +G FLIR  E       L++ D     +G  V HYKIK+ +    Y ITT++ F SL +L+ YYS+ P+GLCC L+ P  +  P   DLS+ T+  WEI R+ L L  KLG G FGEVW G W G   VA+KT+KPGTM+ E FL+EA++MK   H NLV+LYA+C+ +EP YI+TE M  GSLLQYLR++ G  + ++ L+D  +QIANGM YLE    VHRDLAARN+LVG+      + K+ADFGLAR +    ++YEA  G++FP+KWTAPEAA  G F+ KSDVWS+G+L+YEI+T+GQVP+P M N E ++ +E GYRMP P+ CP  IY E++L+CW+  P+ RPTF +L   FDD F++ +  Y
Sbjct:   20 LVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTD-GSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKL-MEEDIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPRGCPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFVSTQPNY 472          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 455.677 bits (1171), Expect = 5.441e-153
Identity = 221/456 (48.46%), Postives = 306/456 (67.11%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLD-HPVNSGYVVNHYKIKKTNQGAVY-ITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICS-DEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEG----EICKIADFGLAR-LIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIY-EIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGY 1857
            L+A++ Y +R   ++  +KGD + LL+ ++ DWW V  + TG  GYVP +F+A + + ES++WY   I R  AER +L     +G FLIR  E       L++ D     +G  V HYKIK+ +    Y ITT++ F SL +L+ YYS+ P+GLCC L+ P  +  P   DLS+ T+  WEI R+ L L  KLG G FGEVW G W G   VA+KT+KPGTM+ E FL+EA++MK   H NLV+LYA+C+ +EP YI+TE M  GSLLQYLR++ G  + ++ L+D  +QIANGM YLE    VHRDLAARN+LVG+      + K+ADFGLAR L++   ++YEA  G++FP+KWTAPEAA  G F+ KSDVWS+G+L+YEI+T+GQVP+P M N E ++ +E GYRMP P+ CP  IY E++L+CW+  P+ RPTF +L   FDD F++ +  Y
Sbjct:   76 LVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTD-GSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEE--DIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPRGCPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFVSTQPNY 528          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 455.677 bits (1171), Expect = 5.441e-153
Identity = 221/456 (48.46%), Postives = 306/456 (67.11%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLD-HPVNSGYVVNHYKIKKTNQGAVY-ITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICS-DEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEG----EICKIADFGLAR-LIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIY-EIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGY 1857
            L+A++ Y +R   ++  +KGD + LL+ ++ DWW V  + TG  GYVP +F+A + + ES++WY   I R  AER +L     +G FLIR  E       L++ D     +G  V HYKIK+ +    Y ITT++ F SL +L+ YYS+ P+GLCC L+ P  +  P   DLS+ T+  WEI R+ L L  KLG G FGEVW G W G   VA+KT+KPGTM+ E FL+EA++MK   H NLV+LYA+C+ +EP YI+TE M  GSLLQYLR++ G  + ++ L+D  +QIANGM YLE    VHRDLAARN+LVG+      + K+ADFGLAR L++   ++YEA  G++FP+KWTAPEAA  G F+ KSDVWS+G+L+YEI+T+GQVP+P M N E ++ +E GYRMP P+ CP  IY E++L+CW+  P+ RPTF +L   FDD F++ +  Y
Sbjct:   76 LVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTD-GSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEE--DIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPRGCPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFVSTQPNY 528          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 455.292 bits (1170), Expect = 9.862e-153
Identity = 221/456 (48.46%), Postives = 306/456 (67.11%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLD-HPVNSGYVVNHYKIKKTNQGAVY-ITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICS-DEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEG----EICKIADFGLAR-LIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIY-EIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGY 1857
            L+A++ Y +R   ++  +KGD + LL+ ++ DWW V  + TG  GYVP +F+A + + ES++WY   I R  AER +L     +G FLIR  E       L++ D     +G  V HYKIK+ +    Y ITT++ F SL +L+ YYS+ P+GLCC L+ P  +  P   DLS+ T+  WEI R+ L L  KLG G FGEVW G W G   VA+KT+KPGTM+ E FL+EA++MK   H NLV+LYA+C+ +EP YI+TE M  GSLLQYLR++ G  + ++ L+D  +QIANGM YLE    VHRDLAARN+LVG+      + K+ADFGLAR L++   ++YEA  G++FP+KWTAPEAA  G F+ KSDVWS+G+L+YEI+T+GQVP+P M N E ++ +E GYRMP P+ CP  IY E++L+CW+  P+ RPTF +L   FDD F++ +  Y
Sbjct:   80 LVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTD-GSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEE--DIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPRGCPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFVSTQPNY 532          
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Match: src-1 (Tyrosine protein-kinase src-1 [Source:UniProtKB/Swiss-Prot;Acc:G5EE56])

HSP 1 Score: 455.292 bits (1170), Expect = 9.862e-153
Identity = 221/456 (48.46%), Postives = 306/456 (67.11%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLD-HPVNSGYVVNHYKIKKTNQGAVY-ITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICS-DEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEG----EICKIADFGLAR-LIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIY-EIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGY 1857
            L+A++ Y +R   ++  +KGD + LL+ ++ DWW V  + TG  GYVP +F+A + + ES++WY   I R  AER +L     +G FLIR  E       L++ D     +G  V HYKIK+ +    Y ITT++ F SL +L+ YYS+ P+GLCC L+ P  +  P   DLS+ T+  WEI R+ L L  KLG G FGEVW G W G   VA+KT+KPGTM+ E FL+EA++MK   H NLV+LYA+C+ +EP YI+TE M  GSLLQYLR++ G  + ++ L+D  +QIANGM YLE    VHRDLAARN+LVG+      + K+ADFGLAR L++   ++YEA  G++FP+KWTAPEAA  G F+ KSDVWS+G+L+YEI+T+GQVP+P M N E ++ +E GYRMP P+ CP  IY E++L+CW+  P+ RPTF +L   FDD F++ +  Y
Sbjct:   80 LVALYPYDSRADGDLSFQKGDAMYLLDHSNCDWWYVRHQRTGQTGYVPRNFVAKQQTIESEEWYAGKIPRNRAERLVLSSHLPKGTFLIREREADTREFALTIRDTDDQRNGGTVKHYKIKRLDHDQGYFITTRRTFRSLQELVRYYSDVPDGLCCQLTFPAPRLAPTRPDLSHDTQQNWEIPRNQLHLKRKLGDGNFGEVWYGKWRGIVEVAIKTMKPGTMSPEAFLQEAQIMKQCDHPNLVKLYAVCTREEPFYIITEYMINGSLLQYLRTD-GSTLGIQALVDMAAQIANGMMYLEERKLVHRDLAARNVLVGDKISGVPVVKVADFGLARKLMEE--DIYEARTGAKFPIKWTAPEAATCGNFTVKSDVWSYGILLYEIMTKGQVPYPGMHNREVVEQVELGYRMPMPRGCPEQIYEEVLLKCWDKTPDRRPTFDTLYHFFDDYFVSTQPNY 532          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src42A (gene:FBgn0264959 transcript:FBtr0335275)

HSP 1 Score: 484.182 bits (1245), Expect = 3.595e-164
Identity = 228/458 (49.78%), Postives = 317/458 (69.21%), Query Frame = 1
Query:  511 RFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSK-PTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICS-DEPIYIVTELMSKGSLLQYLRSETGQAMILKQ--LIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAEC 1872
            +  +A++DY ART +++  +KG+ + +L     DWWL   + T + GY+PS+++A   S E++ WYF  I R +AE+ LL P N  G FLIR SE+      LSV D     G  V HY+I++ ++G  +I  +  F +L +L+ +YS   +GLC +L  PC +   P+   LS++T+D+WEIDR+SL+   KLG+GQFG+VW GLWN TTPVA+KTLK GTM  +DFL EA++MK L H  L++LYA+C+ +EPIYI+TELM  GSLL+YL++  G+   LK   LID  +QIA GMAYLE+  Y+HRDLAARN+LVG+G I KIADFGLARLI    + YEA  G+RFP+KWTAPEAA + KFS KSDVWSFG+L+ E++T G++P+P M+N+E L  +E GYRMP P  C   +YEIML+CW+  P  RPTF +L+   +D + + +S Y+ A+ 
Sbjct:   66 KIFVALYDYDARTDEDLSFRKGEHLEILNDTQGDWWLARSKKTRSEGYIPSNYVAKLKSIEAEPWYFRKIKRIEAEKKLLLPENEHGAFLIRDSESRHNDYSLSVRD-----GDTVKHYRIRQLDEGGFFIARRTTFRTLQELVEHYSKDSDGLCVNLCKPCVQIEKPVTEGLSHRTRDQWEIDRTSLKFVRKLGSGQFGDVWEGLWNNTTPVAIKTLKSGTMDPKDFLAEAQIMKKLRHTKLIQLYAVCTVEEPIYIITELMKHGSLLEYLQAIAGKGRSLKMQTLIDMAAQIAAGMAYLESQNYIHRDLAARNVLVGDGNIVKIADFGLARLIKE--DEYEARVGARFPIKWTAPEAANYSKFSIKSDVWSFGILLTELVTYGRIPYPGMTNAEVLTQVEHGYRMPQPPNCEPRLYEIMLECWHKDPMRRPTFETLQWKLEDFYTSDQSDYKEAQA 516          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src64B (gene:FBgn0262733 transcript:FBtr0100508)

HSP 1 Score: 448.743 bits (1153), Expect = 7.354e-150
Identity = 222/456 (48.68%), Postives = 295/456 (64.69%), Query Frame = 1
Query:  511 RFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICS-DEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQ--CPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
            R ++A++DYK+R   ++   KGDR+ +++  + DWW V    T   G +P +F+A E S  S+DW+F  + RK+A++ LL   N RG FL+R SE       LSV D     GY V HY+IK  + G  YI T + FPSL  L++ YS    GLC  LS PC KP P + DL  + +DK+EI RS +QL  KLG G FGEV+ G W  +  VAVKTL+ GTM+   FL+EA +MK   H  LV LYA+CS +EPIYIV E MSKGSLL +LR   G+ +  + LI   +Q+A+GM YLE+   +HRDLAARN+L+GE  + KI DFGLAR+I    + Y   QGSRFPVKWTAPEA ++GKFS KSDVWS+G+L+ E+ T GQVP+P M + E ++NIE G+RMP P     P  IY+++LQCW+  PE RPTF  L   F+   +T+E  YR  +
Sbjct:   98 RVVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIATNQTFPSLQALVMAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVI--ADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSVTSEVPYREVQ 551          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src64B (gene:FBgn0262733 transcript:FBtr0100505)

HSP 1 Score: 448.743 bits (1153), Expect = 7.354e-150
Identity = 222/456 (48.68%), Postives = 295/456 (64.69%), Query Frame = 1
Query:  511 RFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICS-DEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQ--CPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
            R ++A++DYK+R   ++   KGDR+ +++  + DWW V    T   G +P +F+A E S  S+DW+F  + RK+A++ LL   N RG FL+R SE       LSV D     GY V HY+IK  + G  YI T + FPSL  L++ YS    GLC  LS PC KP P + DL  + +DK+EI RS +QL  KLG G FGEV+ G W  +  VAVKTL+ GTM+   FL+EA +MK   H  LV LYA+CS +EPIYIV E MSKGSLL +LR   G+ +  + LI   +Q+A+GM YLE+   +HRDLAARN+L+GE  + KI DFGLAR+I    + Y   QGSRFPVKWTAPEA ++GKFS KSDVWS+G+L+ E+ T GQVP+P M + E ++NIE G+RMP P     P  IY+++LQCW+  PE RPTF  L   F+   +T+E  YR  +
Sbjct:   98 RVVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIATNQTFPSLQALVMAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVI--ADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSVTSEVPYREVQ 551          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src64B (gene:FBgn0262733 transcript:FBtr0100504)

HSP 1 Score: 448.743 bits (1153), Expect = 7.354e-150
Identity = 222/456 (48.68%), Postives = 295/456 (64.69%), Query Frame = 1
Query:  511 RFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICS-DEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQ--CPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
            R ++A++DYK+R   ++   KGDR+ +++  + DWW V    T   G +P +F+A E S  S+DW+F  + RK+A++ LL   N RG FL+R SE       LSV D     GY V HY+IK  + G  YI T + FPSL  L++ YS    GLC  LS PC KP P + DL  + +DK+EI RS +QL  KLG G FGEV+ G W  +  VAVKTL+ GTM+   FL+EA +MK   H  LV LYA+CS +EPIYIV E MSKGSLL +LR   G+ +  + LI   +Q+A+GM YLE+   +HRDLAARN+L+GE  + KI DFGLAR+I    + Y   QGSRFPVKWTAPEA ++GKFS KSDVWS+G+L+ E+ T GQVP+P M + E ++NIE G+RMP P     P  IY+++LQCW+  PE RPTF  L   F+   +T+E  YR  +
Sbjct:   98 RVVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIATNQTFPSLQALVMAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVI--ADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSVTSEVPYREVQ 551          
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Match: Src64B (gene:FBgn0262733 transcript:FBtr0304990)

HSP 1 Score: 448.743 bits (1153), Expect = 7.354e-150
Identity = 222/456 (48.68%), Postives = 295/456 (64.69%), Query Frame = 1
Query:  511 RFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICS-DEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQ--CPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
            R ++A++DYK+R   ++   KGDR+ +++  + DWW V    T   G +P +F+A E S  S+DW+F  + RK+A++ LL   N RG FL+R SE       LSV D     GY V HY+IK  + G  YI T + FPSL  L++ YS    GLC  LS PC KP P + DL  + +DK+EI RS +QL  KLG G FGEV+ G W  +  VAVKTL+ GTM+   FL+EA +MK   H  LV LYA+CS +EPIYIV E MSKGSLL +LR   G+ +  + LI   +Q+A+GM YLE+   +HRDLAARN+L+GE  + KI DFGLAR+I    + Y   QGSRFPVKWTAPEA ++GKFS KSDVWS+G+L+ E+ T GQVP+P M + E ++NIE G+RMP P     P  IY+++LQCW+  PE RPTF  L   F+   +T+E  YR  +
Sbjct:   98 RVVVALYDYKSRDESDLSFMKGDRMEVIDDTESDWWRVVNLTTRQEGLIPLNFVAEERSVNSEDWFFENVLRKEADKLLLAEENPRGTFLVRPSEHNPNGYSLSVKDWEDGRGYHVKHYRIKPLDNGGYYIATNQTFPSLQALVMAYSKNALGLCHILSRPCPKPQPQMWDLGPELRDKYEIPRSEIQLLRKLGRGNFGEVFYGKWRNSIDVAVKTLREGTMSTAAFLQEAAIMKKFRHNRLVALYAVCSQEEPIYIVQEYMSKGSLLDFLREGDGRYLHFEDLIYIATQVASGMEYLESKQLIHRDLAARNVLIGENNVAKICDFGLARVI--ADDEYCPKQGSRFPVKWTAPEAIIYGKFSIKSDVWSYGILLMELFTYGQVPYPGMHSREVIENIERGFRMPKPTNHYFPDNIYQLLLQCWDAVPEKRPTFEFLNHYFESFSVTSEVPYREVQ 551          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: fyna (FYN proto-oncogene, Src family tyrosine kinase a [Source:NCBI gene;Acc:373872])

HSP 1 Score: 524.628 bits (1350), Expect = 1.144e-179
Identity = 244/452 (53.98%), Postives = 320/452 (70.80%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              +A++DY+AR+ D++  +KG++  +L S + DWW      TG  GY+PS+++A   S +++DWYF  + RKDAER LL  GN RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNG T VAVKTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+   G+ + L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG+  +CKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CPS ++E+MLQCW   PE RPTF  L+   +D F   E  Y+  +
Sbjct:   86 LFVALYDYEARSEDDLSFRKGEKFQILNSTEGDWWEARSLTTGGTGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLSNGNPRGTFLIRESETTKGAYSLSIQDWDETKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVHHYSARAAGLCCRLIVPCHKGMPRLADLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAVKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRGLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPSSLHELMLQCWKRDPEERPTFEYLQAFLEDYFTATEPQYQPGD 535          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: fynb (FYN proto-oncogene, Src family tyrosine kinase b [Source:NCBI gene;Acc:574422])

HSP 1 Score: 517.309 bits (1331), Expect = 1.384e-176
Identity = 240/452 (53.10%), Postives = 318/452 (70.35%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              +A++DY+ART D++  +KG++  ++ S + DWW      TG  GY+PS+++A   S +++DWYF  + RKDAER LL  GN RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +Y+    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNG T VA+KTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE M KGSLL +L+   G+A+ L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG+  +CKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+GKF+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRM  P+ CPS ++E+M+QCW    E RPTF  L+   +D F   E  Y+  +
Sbjct:   93 LFVALYDYEARTEDDLSFRKGEKFQIINSTEGDWWDARSLTTGGTGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLSTGNPRGTFLIRESETTKGAFSLSIRDWDDVKGDHVKHYKIRKLDSGGYYITTRAQFETLQQLVQHYTERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMGKGSLLDFLKDGEGRALKLPNLVDMAAQVAGGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGKFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMQCPQDCPSSLHELMVQCWKKDAEERPTFEYLQAFLEDYFTATEPQYQPGD 542          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: fynb (FYN proto-oncogene, Src family tyrosine kinase b [Source:NCBI gene;Acc:574422])

HSP 1 Score: 517.309 bits (1331), Expect = 1.384e-176
Identity = 240/452 (53.10%), Postives = 318/452 (70.35%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              +A++DY+ART D++  +KG++  ++ S + DWW      TG  GY+PS+++A   S +++DWYF  + RKDAER LL  GN RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +Y+    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNG T VA+KTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE M KGSLL +L+   G+A+ L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG+  +CKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+GKF+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRM  P+ CPS ++E+M+QCW    E RPTF  L+   +D F   E  Y+  +
Sbjct:   93 LFVALYDYEARTEDDLSFRKGEKFQIINSTEGDWWDARSLTTGGTGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLSTGNPRGTFLIRESETTKGAFSLSIRDWDDVKGDHVKHYKIRKLDSGGYYITTRAQFETLQQLVQHYTERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMGKGSLLDFLKDGEGRALKLPNLVDMAAQVAGGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGKFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMQCPQDCPSSLHELMVQCWKKDAEERPTFEYLQAFLEDYFTATEPQYQPGD 542          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: yrk (Yes-related kinase [Source:ZFIN;Acc:ZDB-GENE-030131-9517])

HSP 1 Score: 509.605 bits (1311), Expect = 6.383e-174
Identity = 240/452 (53.10%), Postives = 318/452 (70.35%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              IA+++Y ART D++  +KG++  ++ + + DWW      TG  GY+PS+++A   S ++++WYF  + RKDAER LL   N RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F ++ QL+ +Y+    GLCC L   C +  P ++DLS KTKD WEI R SLQL +KLG GQFGEVW G+WNGTT VAVKTLKPGTM+ E FL EA++MK L H  LV+LYA+ S+EPIYI+TE MS+GSLL +L+   G+ + L QL+D  +QIA GMAY+E   Y+HRDL A NILVG+G +CKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+GKF+ KSDVWSFG+L+ E+IT+G+VP+P M+N E L+ +E GYRMP P+  P+ ++E+MLQCW   P+ R TF  L+   +D F   E  Y+  E
Sbjct:   77 LFIALYEYDARTEDDLSFQKGEKFHIINNTEGDWWEARSLDTGKSGYIPSNYVAPVDSIQAEEWYFGKMGRKDAERQLLAQNNPRGTFLIRESETTKGAYSLSIRDWDDAKGDHVKHYKIRKLDNGGYYITTRTQFDTVQQLVEHYTERAAGLCCRLIGSCRRGMPKLADLSVKTKDVWEIPRESLQLIKKLGNGQFGEVWMGMWNGTTKVAVKTLKPGTMSPEAFLDEAQIMKRLRHDKLVQLYAVVSEEPIYIITEFMSQGSLLDFLKDGDGRNLKLPQLVDMAAQIAAGMAYIERMNYIHRDLRAANILVGDGLVCKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGKFTIKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVERGYRMPCPQGSPASLHELMLQCWRKDPDERHTFEYLQSFLEDYFTATEPQYQPGE 526          
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Match: yrk (Yes-related kinase [Source:ZFIN;Acc:ZDB-GENE-030131-9517])

HSP 1 Score: 509.605 bits (1311), Expect = 6.383e-174
Identity = 240/452 (53.10%), Postives = 318/452 (70.35%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              IA+++Y ART D++  +KG++  ++ + + DWW      TG  GY+PS+++A   S ++++WYF  + RKDAER LL   N RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F ++ QL+ +Y+    GLCC L   C +  P ++DLS KTKD WEI R SLQL +KLG GQFGEVW G+WNGTT VAVKTLKPGTM+ E FL EA++MK L H  LV+LYA+ S+EPIYI+TE MS+GSLL +L+   G+ + L QL+D  +QIA GMAY+E   Y+HRDL A NILVG+G +CKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+GKF+ KSDVWSFG+L+ E+IT+G+VP+P M+N E L+ +E GYRMP P+  P+ ++E+MLQCW   P+ R TF  L+   +D F   E  Y+  E
Sbjct:   77 LFIALYEYDARTEDDLSFQKGEKFHIINNTEGDWWEARSLDTGKSGYIPSNYVAPVDSIQAEEWYFGKMGRKDAERQLLAQNNPRGTFLIRESETTKGAYSLSIRDWDDAKGDHVKHYKIRKLDNGGYYITTRTQFDTVQQLVEHYTERAAGLCCRLIGSCRRGMPKLADLSVKTKDVWEIPRESLQLIKKLGNGQFGEVWMGMWNGTTKVAVKTLKPGTMSPEAFLDEAQIMKRLRHDKLVQLYAVVSEEPIYIITEFMSQGSLLDFLKDGDGRNLKLPQLVDMAAQIAAGMAYIERMNYIHRDLRAANILVGDGLVCKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGKFTIKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVERGYRMPCPQGSPASLHELMLQCWRKDPDERHTFEYLQSFLEDYFTATEPQYQPGE 526          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: ccdc13 (coiled-coil domain containing 13 [Source:Xenbase;Acc:XB-GENE-992948])

HSP 1 Score: 520.776 bits (1340), Expect = 1.198e-178
Identity = 244/455 (53.63%), Postives = 321/455 (70.55%), Query Frame = 1
Query:  505 RNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
            R    +A++DY+ART D++  +KG++  +L S++ DWW      TG  GY+PS+++A   S ++++WYF  + RKDAER LL  GN RG +LIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNG T VA+KTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+   G+A+ L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG G ICKIADFGLARLI+     Y A QG +FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CP+ ++E+ML CW   PE RPTF  L+   +D F   E  Y+  +
Sbjct:   33 RVTLFVALYDYEARTEDDLSFQKGEKFQILNSSEGDWWEARSLTTGGTGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTYLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIED--NEYTARQGMKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPNSLHELMLNCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGD 485          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: ccdc13 (coiled-coil domain containing 13 [Source:Xenbase;Acc:XB-GENE-992948])

HSP 1 Score: 520.776 bits (1340), Expect = 1.752e-178
Identity = 246/460 (53.48%), Postives = 324/460 (70.43%), Query Frame = 1
Query:  496 DIH--RNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
            D+H  R    +A++DY+ART D++  +KG++  +L S++ DWW      TG  GY+PS+++A   S ++++WYF  + RKDAER LL  GN RG +LIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNG T VA+KTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+   G+A+ L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG G ICKIADFGLARLI+     Y A QG +FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CP+ ++E+ML CW   PE RPTF  L+   +D F   E  Y+  +
Sbjct:   39 DLHALRVTLFVALYDYEARTEDDLSFQKGEKFQILNSSEGDWWEARSLTTGGTGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTYLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIED--NEYTARQGMKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPNSLHELMLNCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGD 496          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: ccdc13 (coiled-coil domain containing 13 [Source:Xenbase;Acc:XB-GENE-992948])

HSP 1 Score: 521.161 bits (1341), Expect = 3.870e-178
Identity = 248/472 (52.54%), Postives = 325/472 (68.86%), Query Frame = 1
Query:  472 STNYGSKTDIHRNR------FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              N  S T   R R        +A++DY+ART D++  +KG++  +L S++ DWW      TG  GY+PS+++A   S ++++WYF  + RKDAER LL  GN RG +LIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNG T VA+KTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+   G+A+ L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG G ICKIADFGLARLI+     Y A QG +FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CP+ ++E+ML CW   PE RPTF  L+   +D F   E  Y+  +
Sbjct:   67 GVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFQKGEKFQILNSSEGDWWEARSLTTGGTGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTYLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIED--NEYTARQGMKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPNSLHELMLNCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGD 536          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: FGR (FGR proto-oncogene, Src family tyrosine kinase [Source:NCBI gene;Acc:100493811])

HSP 1 Score: 505.753 bits (1301), Expect = 4.546e-173
Identity = 243/469 (51.81%), Postives = 323/469 (68.87%), Query Frame = 1
Query:  469 TSTNYGSKTDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAECI 1875
            T   + ++T +   R  IA++DY ART D++  KKG++  ++ +++ DWW     ++GN GY+PS+++A   S +S+DWYF  I RKDAER LL  GN RG F+IR SETT+GA  LSV D     G    HYKI+K + G  YITT+  F ++ +L+ +YS   +GLC  L++PC    P    LS   KD WEI R S+ L +KLG G FG+VW+G WNGTT VAVKTLKP TM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE M+KGSLL YL+   G  + L QL+D   QIA+GMAY+E   Y+HRDL A NILVG+  ICKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+GKF+ KSDVWSFG+++ E++T+G++P+P MSN E L+ +E GYRMP+P  CP  ++E+MLQCW   PE RPTF  L+   +D F   E  Y+  + I
Sbjct:    5 TRAGFINRTSMQPLRNFIALYDYDARTEDDLTFKKGEKFHIINNSEGDWWEARSLSSGNTGYIPSNYVAPMNSIQSKDWYFGKIGRKDAERLLLCEGNPRGTFMIRESETTKGAYSLSVRDWDATRGDHAKHYKIRKLDNGGFYITTRVQFDTVEELVEHYSEFNDGLCHLLTNPCINQKPQTLGLS---KDAWEITRDSISLDKKLGQGCFGDVWKGTWNGTTNVAVKTLKPSTMSPEAFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEFMTKGSLLDYLKEGEGHLLKLPQLVDMSGQIASGMAYIERMNYIHRDLRAANILVGDNLICKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGKFTIKSDVWSFGIMVCELVTKGRIPYPGMSNREVLEQVERGYRMPAPPACPPSLHELMLQCWRGDPEERPTFEYLQSFLEDYFTATEPQYQPGDNI 468          
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Match: cthrc1 (collagen triple helix repeat containing 1 [Source:Xenbase;Acc:XB-GENE-980161])

HSP 1 Score: 504.212 bits (1297), Expect = 3.597e-172
Identity = 243/466 (52.15%), Postives = 319/466 (68.45%), Query Frame = 1
Query:  472 STNYGSKTDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
            S N+G  T        +A++DY++RT  ++  KKG+R+ ++ + + DWWL    ++G  GY+PS+++A   S ++++WY   ITR++AER LL   N RG FL+R SETT+GA CLSV D+  N G  V HYKI+K + G  YIT++  F SL QL+ YYS   +GLC  L+  C    P    LS   KD WEI R SL+L  KLG G FGEVW G WNGTT VA+KTLKPGTM+ E FL+EA+VMK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+ E G+ + L QL+D  +QIA+GMAY+E   YVHRDL A NILVGE  +CK+ADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E+ T+G+VP+P M N E L  +E GYRMP P  CP  ++++M QCW   PE RPTF  L+   +D F   E  Y+  +
Sbjct:   33 SKNHGGVTT------FVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLARSLSSGQTGYIPSNYVAPSDSIQAEEWYLGKITRREAERLLLSLENPRGTFLVRESETTKGAYCLSVSDYDANRGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTTVCPTAKPQTQGLS---KDAWEIPRDSLRLELKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGEMGRYLRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPDCPESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTATEPQYQPGD 487          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Fyn (Fyn proto-oncogene [Source:MGI Symbol;Acc:MGI:95602])

HSP 1 Score: 522.702 bits (1345), Expect = 7.885e-179
Identity = 249/472 (52.75%), Postives = 324/472 (68.64%), Query Frame = 1
Query:  472 STNYGSKTDIHRNR------FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              N  S T   R R        +A++DY+ART D++   KG++  +L S++ DWW      TG  GY+PS+++A   S ++++WYF  + RKDAER LL  GN RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNG T VA+KTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+   G+A+ L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG G ICKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CP  ++E+M+ CW   PE RPTF  L+   +D F   E  Y+  E
Sbjct:   66 GVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGE 535          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Src (Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:98397])

HSP 1 Score: 506.138 bits (1302), Expect = 2.132e-172
Identity = 239/451 (52.99%), Postives = 316/451 (70.07%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
             +A++DY++RT  ++  KKG+R+ ++ + + DWWL    +TG  GY+PS+++A   S ++++WYF  ITR+++ER LL   N RG FL+R SETT+GA CLSV D     G  V HYKI+K + G  YIT++  F SL QL+ YYS   +GLC  L+  C    P    L+   KD WEI R SL+L  KLG G FGEVW G WNGTT VA+KTLKPGTM+ E FL+EA+VMK L H  LV+LYA+ S+EPIYIVTE M+KGSLL +L+ ETG+ + L QL+D  +QIA+GMAY+E   YVHRDL A NILVGE  +CK+ADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E+ T+G+VP+P M N E L  +E GYRMP P +CP  ++++M QCW   PE RPTF  L+   +D F + E  Y+  E
Sbjct:   88 FVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLA---KDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGE 533          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Src (Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:98397])

HSP 1 Score: 506.138 bits (1302), Expect = 2.132e-172
Identity = 239/451 (52.99%), Postives = 316/451 (70.07%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
             +A++DY++RT  ++  KKG+R+ ++ + + DWWL    +TG  GY+PS+++A   S ++++WYF  ITR+++ER LL   N RG FL+R SETT+GA CLSV D     G  V HYKI+K + G  YIT++  F SL QL+ YYS   +GLC  L+  C    P    L+   KD WEI R SL+L  KLG G FGEVW G WNGTT VA+KTLKPGTM+ E FL+EA+VMK L H  LV+LYA+ S+EPIYIVTE M+KGSLL +L+ ETG+ + L QL+D  +QIA+GMAY+E   YVHRDL A NILVGE  +CK+ADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E+ T+G+VP+P M N E L  +E GYRMP P +CP  ++++M QCW   PE RPTF  L+   +D F + E  Y+  E
Sbjct:   88 FVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLA---KDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGE 533          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Src (Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:98397])

HSP 1 Score: 506.138 bits (1302), Expect = 2.132e-172
Identity = 239/451 (52.99%), Postives = 316/451 (70.07%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
             +A++DY++RT  ++  KKG+R+ ++ + + DWWL    +TG  GY+PS+++A   S ++++WYF  ITR+++ER LL   N RG FL+R SETT+GA CLSV D     G  V HYKI+K + G  YIT++  F SL QL+ YYS   +GLC  L+  C    P    L+   KD WEI R SL+L  KLG G FGEVW G WNGTT VA+KTLKPGTM+ E FL+EA+VMK L H  LV+LYA+ S+EPIYIVTE M+KGSLL +L+ ETG+ + L QL+D  +QIA+GMAY+E   YVHRDL A NILVGE  +CK+ADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E+ T+G+VP+P M N E L  +E GYRMP P +CP  ++++M QCW   PE RPTF  L+   +D F + E  Y+  E
Sbjct:   88 FVALYDYESRTETDLSFKKGERLQIVNNTEGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLA---KDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGE 533          
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Match: Src (Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:98397])

HSP 1 Score: 499.975 bits (1286), Expect = 8.015e-170
Identity = 239/457 (52.30%), Postives = 316/457 (69.15%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILL------ESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
             +A++DY++RT  ++  KKG+R+ ++      +  + DWWL    +TG  GY+PS+++A   S ++++WYF  ITR+++ER LL   N RG FL+R SETT+GA CLSV D     G  V HYKI+K + G  YIT++  F SL QL+ YYS   +GLC  L+  C    P    L+   KD WEI R SL+L  KLG G FGEVW G WNGTT VA+KTLKPGTM+ E FL+EA+VMK L H  LV+LYA+ S+EPIYIVTE M+KGSLL +L+ ETG+ + L QL+D  +QIA+GMAY+E   YVHRDL A NILVGE  +CK+ADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E+ T+G+VP+P M N E L  +E GYRMP P +CP  ++++M QCW   PE RPTF  L+   +D F + E  Y+  E
Sbjct:   88 FVALYDYESRTETDLSFKKGERLQIVNNTRKVDVREGDWWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGLCHRLTTVCPTSKPQTQGLA---KDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKGETGKYLRLPQLVDMSAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGE 539          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P27446|FYN_XIPHE (Tyrosine-protein kinase Fyn OS=Xiphophorus helleri OX=8084 GN=fyn PE=2 SV=3)

HSP 1 Score: 529.25 bits (1362), Expect = 1.403e-180
Identity = 251/472 (53.18%), Postives = 328/472 (69.49%), Query Frame = 1
Query:  472 STNYGSKTDIHRNR------FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              N  S T   R R        +A++DY+ART D++  +KG+R  +L S + DWW      TG  GY+PS+++A   S +++DWYF  + RKDAER LL  GN RG +LIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS+   GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNGTT VAVKTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+   G+A+ L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG+  +CKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CP+ ++E+MLQCW   PE RPTF  L+   +D F   E  Y+  +
Sbjct:   66 GVNTSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFRKGERFQILNSTEGDWWDARSLTTGGSGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLSTGNPRGTYLIRESETTKGAFSLSIRDWDDEKGDHVKHYKIRKLDSGGYYITTRAQFDTLQQLVQHYSDRAAGLCCRLVVPCHKGMPRLADLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGTTKVAVKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDNLVCKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPASLHELMLQCWKKDPEERPTFEYLQAFLEDYFTATEPQYQPGD 535          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|Q6EWH2|FYNA_DANRE (Tyrosine-protein kinase fyna OS=Danio rerio OX=7955 GN=fyna PE=1 SV=2)

HSP 1 Score: 524.628 bits (1350), Expect = 8.639e-179
Identity = 244/452 (53.98%), Postives = 320/452 (70.80%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              +A++DY+AR+ D++  +KG++  +L S + DWW      TG  GY+PS+++A   S +++DWYF  + RKDAER LL  GN RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNG T VAVKTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+   G+ + L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG+  +CKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CPS ++E+MLQCW   PE RPTF  L+   +D F   E  Y+  +
Sbjct:   86 LFVALYDYEARSEDDLSFRKGEKFQILNSTEGDWWEARSLTTGGTGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLSNGNPRGTFLIRESETTKGAYSLSIQDWDETKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVHHYSARAAGLCCRLIVPCHKGMPRLADLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAVKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRGLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPSSLHELMLQCWKRDPEERPTFEYLQAFLEDYFTATEPQYQPGD 535          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P39688|FYN_MOUSE (Tyrosine-protein kinase Fyn OS=Mus musculus OX=10090 GN=Fyn PE=1 SV=4)

HSP 1 Score: 522.702 bits (1345), Expect = 5.515e-178
Identity = 249/472 (52.75%), Postives = 324/472 (68.64%), Query Frame = 1
Query:  472 STNYGSKTDIHRNR------FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              N  S T   R R        +A++DY+ART D++   KG++  +L S++ DWW      TG  GY+PS+++A   S ++++WYF  + RKDAER LL  GN RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNG T VA+KTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+   G+A+ L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG G ICKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CP  ++E+M+ CW   PE RPTF  L+   +D F   E  Y+  E
Sbjct:   66 GVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGE 535          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P13406|FYN_XENLA (Tyrosine-protein kinase Fyn OS=Xenopus laevis OX=8355 GN=fyn PE=2 SV=3)

HSP 1 Score: 521.546 bits (1342), Expect = 1.545e-177
Identity = 248/472 (52.54%), Postives = 325/472 (68.86%), Query Frame = 1
Query:  472 STNYGSKTDIHRNR------FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              N  S T   R R        +A++DY+ART D++  +KG++  +L S++ DWW      TG  GY+PS+++A   S ++++WYF  + RKDAER LL  GN RG +LIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNG T VA+KTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+   G+A+ L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG G ICKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CP  ++E+ML CW   PE RPTF  L+   +D F   E  Y+  +
Sbjct:   66 GVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFQKGEKFQILNSSEGDWWEARSLTTGGTGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTYLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRALKLPNLVDMAAQVARGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMLNCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGD 535          
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Match: sp|P06241|FYN_HUMAN (Tyrosine-protein kinase Fyn OS=Homo sapiens OX=9606 GN=FYN PE=1 SV=3)

HSP 1 Score: 521.546 bits (1342), Expect = 1.759e-177
Identity = 248/472 (52.54%), Postives = 324/472 (68.64%), Query Frame = 1
Query:  472 STNYGSKTDIHRNR------FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              N  S T   R R        +A++DY+ART D++   KG++  +L S++ DWW      TG  GY+PS+++A   S ++++WYF  + RKDAER LL  GN RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNG T VA+KTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE M+KGSLL +L+   G+A+ L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG G ICKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CP  ++E+M+ CW   PE RPTF  L+   +D F   E  Y+  E
Sbjct:   66 GVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGE 535          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A0V0J867 (Tyrosine-protein kinase OS=Schistocephalus solidus OX=70667 GN=TR96230 PE=3 SV=1)

HSP 1 Score: 571.622 bits (1472), Expect = 0.000e+0
Identity = 271/458 (59.17%), Postives = 341/458 (74.45%), Query Frame = 1
Query:  472 STNYGSKTDIHRN--RFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKK-TNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLF 1836
            + N    T   RN  R  +AIFDY+A + +++ +++ DR+++L+ +D DWWLVE  AT   GYVPS++LA E S E  +WYF  I+RKD+ER LL  GN RG FL+R SETTQGA  LSV DH  N G +VNHYKIK   + GAV IT+KK FP+L  L+  Y+   +GLCC L++ C +P P++SDLS +TKD WEI RS L L EKLG GQFGEVW+G WNGTTPVAVKT++PGTM+KE+FLKEA++MK+L H  LVRLYA+ + EPI+IVTELMS GSLL YLRSE G+A+ LKQ +D ++QIA+GM+YLE    VHRDLAARN+LVGE    K+ADFGLAR ID   E Y A QG++FP+KWTAPEAAL G+F+ KSDVWS+GV++YEIIT GQVPFPSM+N+E LQ +  GYRMP P  CP  IY +ML+ W   P  RP+F+SL   F+D F
Sbjct:  260 TVNSADSTRQSRNTARNFVAIFDYQAHSKEDLSVRRQDRLVVLDKSDSDWWLVENPATSCHGYVPSAYLAEEGSVEVYEWYFREISRKDSERLLLLNGNVRGTFLVRESETTQGALSLSVRDHDPNRGDIVNHYKIKPYGDDGAVCITSKKGFPNLVALVRNYTEHADGLCCRLTNYCPRPPPVLSDLSKRTKDHWEIPRSQLVLQEKLGNGQFGEVWKGEWNGTTPVAVKTMRPGTMSKEEFLKEARIMKTLNHPRLVRLYAVVTTEPIFIVTELMSNGSLLHYLRSEAGKALDLKQQVDIMAQIADGMSYLEAKDLVHRDLAARNVLVGESNEVKVADFGLARQIDRDTEAYNAKQGAKFPIKWTAPEAALLGQFTVKSDVWSYGVVLYEIITYGQVPFPSMANTEILQQVSDGYRMPCPNNCPPVIYAVMLRTWEEDPNKRPSFSSLCGYFEDYF 717          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A3Q0KT01 (Tyrosine-protein kinase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 570.081 bits (1468), Expect = 0.000e+0
Identity = 275/453 (60.71%), Postives = 346/453 (76.38%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQ-GAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
            + +AIFDY+A T +E+  +KGD++ +L+ +D +WWLVE   +G  GY+PSS+LA   S E++DWYF  I+RKD+ER LL  GN RG FL+RASETT GA  LSV D     G  V HYKIK++++   VYITTK++FP L  L+++YSN  +GLCC L+ PC +P P+ +DLS  T+D+WEI RSSL+L E LGAGQFGEVW+G WN T  VAVKTLK GTMTKE+FLKEA++MK L H  LVRLYA+ + EPIYI+TELM  GSLL+YLR   G+ + LK LID ++QIA+GMAYLE   Y+HRDLAARNILVGE    K+ADFGLAR+ID+G E Y A QG++FP+KWTAPEAAL G+F+ KSDVWSFG++IYEIIT GQVPFPSM+N+E LQ +E GYRMP P  CP+ IYEIML  W+ +PE RPTFA L + F+D F +AE  YR A+
Sbjct:  337 YHVAIFDYEAHTSEEVSARKGDQLRVLDLSDSEWWLVEH--SGQVGYIPSSYLAQANSVEAEDWYFRSISRKDSERLLLLKGNIRGTFLVRASETTNGALSLSVRDTEQQRGETVKHYKIKQSSETNDVYITTKQVFPDLKSLVIHYSNQADGLCCCLTRPCPRPPPVPTDLSRLTRDQWEISRSSLKLIELLGAGQFGEVWKGKWNETIEVAVKTLKQGTMTKEEFLKEARIMKQLHHPRLVRLYAVVTAEPIYIITELMKNGSLLKYLRDGPGKELGLKPLIDMMAQIASGMAYLEKEHYIHRDLAARNILVGENNSVKVADFGLARIIDSGNETYTAKQGAKFPIKWTAPEAALMGRFTIKSDVWSFGIVIYEIITYGQVPFPSMNNTETLQQVENGYRMPCPINCPNSIYEIMLNTWDAKPECRPTFAFLCNYFEDYFTSAELSYRPAD 787          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A4Z2CUE7 (Tyrosine-protein kinase OS=Schistosoma japonicum OX=6182 GN=EWB00_007520 PE=3 SV=1)

HSP 1 Score: 568.54 bits (1464), Expect = 0.000e+0
Identity = 276/452 (61.06%), Postives = 344/452 (76.11%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQ-GAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAA 1866
            + +AIFDY+A T +E+  +KGD + +L+ +D +WWLVE   +G  GY+PSS+LA   S E++DWYF  I+RKD+ER LL  GN RG FL+RASETT GA  LSV D     G  V HYKIK+ ++ G VYITTK++F  L  L+++YSN P+GLCC L+ PC +P P+ +DLS  T+D+WEI RSSL+L E LGAGQFGEVW+G WN T  VAVKTLK GTMTKE+FLKEA++MK L H  LVRLYA+ + EPIYIVTELM+ GSLL+YLR   G+ + LK LID ++QIA+GMAYLE   Y+HRDLAARNILVGE    K+ADFGLAR+ID+  + Y A QG++FP+KWTAPEAAL G+F+ KSDVWSFG++IYEIIT GQVPFPSM+N+E LQ +E GYRMP P  CP+ IYEIML  W+ RPE RPTFA L + F+D F +AE  YR A
Sbjct:  329 YHVAIFDYEAHTAEEVSARKGDLLRVLDLSDSEWWLVEH--SGQVGYIPSSYLAQANSVEAEDWYFRSISRKDSERLLLLKGNIRGTFLVRASETTNGALSLSVRDTEQQRGETVKHYKIKQCHETGDVYITTKQVFSDLKSLVIHYSNQPDGLCCCLTRPCPRPPPVPTDLSRLTRDQWEISRSSLKLIELLGAGQFGEVWKGKWNETIEVAVKTLKQGTMTKEEFLKEARIMKQLHHPRLVRLYAVVTAEPIYIVTELMTNGSLLKYLRDGPGKELGLKPLIDMMAQIASGMAYLEKEHYIHRDLAARNILVGENNSVKVADFGLARIIDSANDTYTAKQGAKFPIKWTAPEAALMGRFTIKSDVWSFGIVIYEIITYGQVPFPSMNNTETLQQVENGYRMPCPINCPNSIYEIMLNTWDARPECRPTFAFLCNYFEDYFTSAELSYRPA 778          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A4E0S0K6 (Tyrosine-protein kinase OS=Fasciola hepatica OX=6192 GN=D915_003399 PE=3 SV=1)

HSP 1 Score: 564.303 bits (1453), Expect = 0.000e+0
Identity = 267/452 (59.07%), Postives = 340/452 (75.22%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQ-GAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAA 1866
            + + IFDY  +  +E+ ++KGD++ +L+ +D +WWL E   +G  GY+PSS+LA  +S E++DWYF  I+RKD+ER LL  GN RG FL+R SETT GA  LSV D  ++ G  V HYKIK+T +   VYITTK+I P L  L+ +YS   +GLCC L+ PC +P P+ +DLS  T+D+WEI RSSL L E+LG+GQFG+VW+G WNGTT VA+KTLK GTM++EDFLKEAK+MK L H  LVRLYA+ + EPIYIVTELM  GSLL YLR   GQ + L+ L+D ++QIA+GMAYLE  GY+HRDLAARNILVGE    K+ADFGLAR+ID+G E Y A QG++FP+KWTAPEAAL G+F+ KSDVWSFG++IYEI+T GQVPFPSM+N+E LQ +++GYRMP P  CP  IYE+ML  W+  PE+RPTFA L   F+D F  AE  YR A
Sbjct:  335 YHVTIFDYVTKEAEELRVRKGDKIRVLDMSDSEWWLAEHLHSGLVGYIPSSYLAPAHSVEAEDWYFRNISRKDSERLLLLKGNIRGTFLVRESETTDGALSLSVRDTEMHRGDTVKHYKIKRTGKRDEVYITTKQILPDLKALVAHYSAQADGLCCCLTRPCPRPPPVPNDLSRLTRDQWEIPRSSLALIERLGSGQFGDVWKGKWNGTTEVAIKTLKQGTMSREDFLKEAKIMKRLHHPRLVRLYAVVTTEPIYIVTELMPNGSLLHYLRDGAGQDLGLRPLVDMMAQIASGMAYLEQEGYIHRDLAARNILVGEHNTVKVADFGLARIIDSGNETYTAKQGAQFPIKWTAPEAALLGRFTVKSDVWSFGIVIYEIVTHGQVPFPSMNNTETLQQVDSGYRMPRPANCPVSIYEVMLHAWDAIPENRPTFAFLCAYFEDYFANAERAYRPA 786          
BLAST of Tyrosine-protein kinase vs. TrEMBL
Match: A0A0V0J6V3 (Tyrosine-protein kinase OS=Schistocephalus solidus OX=70667 GN=TR116233 PE=3 SV=1)

HSP 1 Score: 558.91 bits (1439), Expect = 0.000e+0
Identity = 261/470 (55.53%), Postives = 340/470 (72.34%), Query Frame = 1
Query:  469 TSTNYGSKTDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGY----VVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAA 1866
            +S   GS++   +NR L+AIFDY ART +EI L+KGD +++L  +D +WW VE   T  +GYVPSS++A E+S E+++WY P I+RKD+ER LL   N RG FLIR SETT+G   LSV D  V+S       V HY++K  + G  YITTK+ FP+L  L+ +YS   NGLCC L+ PC +P P+ +DLS +TKD WE+ R S+   E+LG+GQFGEVW+  WNGTT VAVK LKPGTM+ E+FLKEA++MK+  H  LVRLYA+C ++PI I+TELM  GSLL YLR   G+ + L+ L+D ++QIA+GMAYLE   Y+HRDLAARNILVGE    KIADFGLAR+++   E Y A +G++FP+KWTAPEAAL G+F+ KSDVWS+G+++YEIIT GQVP+PSM+N+E L  +  GYRMP P  CP  IY IMLQ W+   + RPTFA L D F+D F + E+ YR A
Sbjct:  199 SSNEQGSESPELKNR-LVAIFDYNARTDEEISLRKGDVMLVLNDSDSEWWFVEHCRTSAKGYVPSSYVAFEFSVEAEEWYVPKISRKDSERLLLLNSNNRGTFLIRESETTKGTLTLSVRDREVDSCLHTTDTVKHYRVKHIDGGGFYITTKRGFPTLRDLVEHYSADANGLCCRLTRPCPRPPPLTTDLSVQTKDHWEVPRKSISFVEQLGSGQFGEVWKATWNGTTEVAVKMLKPGTMSTEEFLKEARIMKAARHPRLVRLYAVCIEDPILIITELMPHGSLLHYLRDGPGKNLTLRPLVDMMAQIASGMAYLERERYIHRDLAARNILVGENCCVKIADFGLARMVEDRYETYVAQKGTKFPIKWTAPEAALMGRFTIKSDVWSYGIVLYEIITHGQVPYPSMNNTETLNQVGNGYRMPQPTTCPDPIYGIMLQTWDAVADKRPTFAYLCDFFEDYFASTETNYRHA 667          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: fyna (tyrosine-protein kinase fyna [Source:NCBI gene;Acc:103043249])

HSP 1 Score: 522.702 bits (1345), Expect = 7.129e-179
Identity = 244/452 (53.98%), Postives = 319/452 (70.58%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              +A++DY+ART D++  +KG++  +L S + DWW      TG  GY+PS+++A   S +++DWYF  + RKDAER LL  GN RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNGTT VAVKTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE M KGSLL +L+   G+ + L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG+  +CKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CP  ++E+MLQCW   PE RPTF  L+   +D F   E  Y+  +
Sbjct:   86 LFVALYDYEARTEDDLSFRKGEKFQILNSTEGDWWEARSLTTGGTGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLSNGNPRGTFLIRESETTKGAYSLSIQDWDDIKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSARAAGLCCRLIVPCHKGMPRLADLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGTTKVAVKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMGKGSLLDFLKDGEGRGLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDSLVCKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMLQCWKRDPEERPTFEYLQAFLEDYFTATEPQYQPGD 535          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: yrk (proto-oncogene tyrosine-protein kinase Yrk [Source:NCBI gene;Acc:103036565])

HSP 1 Score: 509.605 bits (1311), Expect = 9.407e-174
Identity = 240/452 (53.10%), Postives = 319/452 (70.58%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              IA++DY ART D++  +KG++  ++ + + DWW      TG  GY+PS+++A   S ++++WYF  + RKDAER LL   N RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F ++ QL+++YS+   GLCC L   C +  P ++DLS KTKD WEI R SLQL +KLG GQFGEVW G+WNGTT VAVKTLKPGTM+ E FL EA++MK L H  LV+LYA+ S+EPIYI+TE MS+GSLL +L+   G+++ L QL+D  +QIA GMAY+E   Y+HRDL A NILVG+  +CKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+GKF+ KSDVWSFG+L+ E+IT+G+VP+P M+N E L+ +E GYRMP P+  P+ ++E+MLQCW    + R TF  L+   +D F   E  Y+  E
Sbjct:   86 LFIALYDYDARTEDDLTFQKGEKFHIINNTEGDWWEARSLDTGKSGYIPSNYVAPVDSIQAEEWYFGKMGRKDAERQLLGQNNPRGTFLIRESETTKGAYSLSIRDWDDAKGDHVKHYKIRKLDNGGYYITTRSQFETVQQLVVHYSDRAAGLCCRLIGSCRRGMPKLADLSVKTKDVWEIPRESLQLIKKLGNGQFGEVWMGMWNGTTKVAVKTLKPGTMSPEAFLDEAQIMKRLRHDKLVQLYAVVSEEPIYIITEFMSQGSLLDFLKDGEGRSLKLPQLVDMAAQIAAGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGKFTIKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVERGYRMPCPQGSPASLHELMLQCWRKDADERHTFEYLQGFLEDYFTATEPQYQPGE 535          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: SRC (proto-oncogene tyrosine-protein kinase Src-like [Source:NCBI gene;Acc:103042998])

HSP 1 Score: 501.516 bits (1290), Expect = 1.743e-170
Identity = 239/461 (51.84%), Postives = 318/461 (68.98%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAECISR*LYYQK 1899
             +A++DY++RT  ++  KKG+R+ +L + + DWWL     TG  GY+PS+++A   S ++++W+F  ITR+D+ER LL   N RG FL+R SETT+GA CLSVLD+    G  + HYKI+K + G  YIT++  F SL QL+L+Y    +GLC  L+  C    P    L+   +D WEI R SL+L  KLG G FGEVW G WNGTT VA+KTLK GTM+ E FL+EA+VMK L H  LV+LYA+ S+EPIYIVTE MS+GSLL +L+ + G+ + L QL+D  SQIA GMAY+E   YVHRDL A NILVG+  +CK+ADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E+ T+G+VP+P M N E L  +E GYRMP P +CPS ++E+ML CW   PE RPTF  L+   +D F + E  Y+        +Y QK
Sbjct:   89 FVALYDYESRTTADLTFKKGERLQILNNTEGDWWLARSLTTGESGYIPSNYVAPSDSIQAEEWFFGKITRRDSERLLLNIQNRRGTFLVRESETTKGAYCLSVLDYDNMKGLNIKHYKIRKLDSGGFYITSRTQFTSLQQLVLHYRTHADGLCHVLTDICPMLKPQTQGLA---RDAWEIPRESLRLDVKLGQGCFGEVWMGTWNGTTRVAIKTLKRGTMSPEAFLEEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSQGSLLDFLKGDKGKFLRLPQLVDMASQIAAGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELATKGRVPYPGMVNREVLDQVERGYRMPCPAECPSSMHELMLSCWRKEPEERPTFEYLQGFLEDYFTSTEPQYQPENLFLYKIYSQK 544          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: clul1 (tyrosine-protein kinase yes [Source:NCBI gene;Acc:103029125])

HSP 1 Score: 494.197 bits (1271), Expect = 1.192e-167
Identity = 232/452 (51.33%), Postives = 312/452 (69.03%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
            F +A++DY+ART D++  KKGDR  ++ + + DWW      TG +GY+PS+++A   S ++++WYF  + RKDAER LL PGN RG FL+R SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L +L+ +Y+   +GLC  L+  C    P    L+   KD WEI R SL+L  KLG G FGEVW G WNGTT VA+KTLKPGTM+ E FL+EA++MK L H  LV LYA+ S+EPIYIVTE M KGSLL +L+   G+ + L QL+D  +QIA+GMA++E   Y+HRDL A NILVG+  +CKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M N E L+ +E GYRMP P+ CP  ++E+M  CW   P+ RPTF  ++   +D F   E  Y+  +
Sbjct:   99 FFVALYDYEARTSDDLSFKKGDRFQIINNTEGDWWEARSINTGKKGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLVPGNQRGTFLVRESETTKGAYSLSIRDWDDMKGDNVKHYKIRKLDNGGYYITTRAQFETLQKLVKHYTEHADGLCYRLTTVCPTVKPQTQGLA---KDAWEIPRESLRLELKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMSPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEYMGKGSLLDFLKEGEGKYLKLPQLVDMAAQIADGMAFIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHEMMRLCWKKEPDERPTFEYIQSFLEDYFTATEPQYQPGD 545          
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Match: SRC (proto-oncogene tyrosine-protein kinase Src-like [Source:NCBI gene;Acc:103042998])

HSP 1 Score: 494.582 bits (1272), Expect = 7.182e-167
Identity = 237/456 (51.97%), Postives = 315/456 (69.08%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESN------DPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAA 1866
             +A++DY++RT  ++  KKG+R+ +L +       + DWWL     TG  GY+PS+++A   S ++++W+F  ITR+D+ER LL   N RG FL+R SETT+GA CLSVLD+    G  + HYKI+K + G  YIT++  F SL QL+L+Y    +GLC  L+  C    P    L+   +D WEI R SL+L  KLG G FGEVW G WNGTT VA+KTLK GTM+ E FL+EA+VMK L H  LV+LYA+ S+EPIYIVTE MS+GSLL +L+ + G+ + L QL+D  SQIA GMAY+E   YVHRDL A NILVG+  +CK+ADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E+ T+G+VP+P M N E L  +E GYRMP P +CPS ++E+ML CW   PE RPTF  L+   +D F + E  Y+ A
Sbjct:   89 FVALYDYESRTTADLTFKKGERLQILNNTRKYNYREGDWWLARSLTTGESGYIPSNYVAPSDSIQAEEWFFGKITRRDSERLLLNIQNRRGTFLVRESETTKGAYCLSVLDYDNMKGLNIKHYKIRKLDSGGFYITSRTQFTSLQQLVLHYRTHADGLCHVLTDICPMLKPQTQGLA---RDAWEIPRESLRLDVKLGQGCFGEVWMGTWNGTTRVAIKTLKRGTMSPEAFLEEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSQGSLLDFLKGDKGKFLRLPQLVDMASQIAAGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELATKGRVPYPGMVNREVLDQVERGYRMPCPAECPSSMHELMLSCWRKEPEERPTFEYLQGFLEDYFTSTEPQYQPA 539          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: clul1 (clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GENE-031118-57])

HSP 1 Score: 494.197 bits (1271), Expect = 2.042e-169
Identity = 235/460 (51.09%), Postives = 315/460 (68.48%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESN--------DPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              +A++DY ART D++  +KG++  ++ +         + DWW     +TGN+GY+PS+++A   S ++++WYF  ++RKDAER LL PGN RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L +L+ +YS   +GLC  L+  C    P    L+   +D WE+ R SL+L  KLG G FGEVW G WNGTT VA+KTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+   G+ + L QL+D  +QIA GMAY+E   Y+HRDL A NILVG+  ICKIADFGLARLI+     Y A QG++FP+KWTAPEAA++G+F+ KSDVWSFG+L+ E++T+G+VP+P M N E L+ +E GYRMP P  CP  ++E+M+QCW   PE RPTF  L+   +D F   E  Y+  E
Sbjct:   17 LFVALYDYDARTQDDLSFRKGEKFQIINNTIEVAVVYREGDWWEARSLSTGNKGYIPSNYVAPADSVQAEEWYFGKVSRKDAERQLLCPGNPRGTFLIRESETTKGAYSLSIRDWDEVKGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVQHYSEHADGLCYKLTLVCPNEKPQTQGLA---RDAWEMPRDSLKLELKLGQGCFGEVWAGTWNGTTKVAIKTLKPGTMSPEAFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEFMSKGSLLDFLKEGDGRYLKLPQLVDMAAQIAAGMAYIERMNYIHRDLRAANILVGDNLICKIADFGLARLIEDN--EYTARQGAKFPIKWTAPEAAMFGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPPSCPESLHELMMQCWKKDPEERPTFEYLQAFLEDYFTATEPQYQPGE 471          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 461.07 bits (1185), Expect = 8.495e-157
Identity = 214/449 (47.66%), Postives = 305/449 (67.93%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYR 1860
             ++A++D++    D++  KKGD++ +++    +WW+ E     ++GY+PS+++A   S E+++W+F  ++RK+ ER LL PGN+ G +L+R SE+ +G+  LSV D+ + +G VV HYKI+  + G  +I+ +  FP L  LI +Y+   +GLC  L  PC    P         KD WEI R SL+LS++LGAGQFGEVW G++N  T VA+KT+KPG+M+ E FL EA +MK+L H  LVRLYA+ + EPIYIVTE M  GSLL YL+S  G  + + ++ID  +QIA GMA++E   Y+HRDL A NILV E    KIADFGLAR+I+     Y A +G++FP+KWTAPEA  +G FS KSDVWSFG+L+ EIIT G++P+P MSNS+ ++ +E GYRMP P+Q P  +Y +M+ CW  RPE RPTF  L+ V +D F + E  Y+
Sbjct:    2 LVVALYDFEQLNPDDMGFKKGDKMRIIQERG-EWWMAELMDGSHKGYIPSNYVAKANSLETEEWFFSGVSRKEGERLLLAPGNSIGAYLLRDSESNKGSYSLSVRDYDITNGDVVRHYKIRTLDNGGYFISARLTFPDLFALIQHYTAHSDGLCQKLLRPCVSKKP----QQLWEKDAWEIPRDSLKLSKRLGAGQFGEVWMGIYNNRTKVAIKTMKPGSMSPEAFLDEANLMKTLQHPRLVRLYAVVTQEPIYIVTEFMENGSLLDYLKSTEGSTLPMPKMIDMAAQIAEGMAFIERKNYIHRDLRAANILVNEQLASKIADFGLARIIEDN--EYTAREGAKFPIKWTAPEAINYGSFSIKSDVWSFGILLTEIITFGRIPYPGMSNSDVIRQLERGYRMPCPEQAPKQLYGVMMDCWKERPEERPTFEYLQGVLEDFFTSTEGQYQ 443          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: frk (fyn-related Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-110411-7])

HSP 1 Score: 458.373 bits (1178), Expect = 1.128e-155
Identity = 224/452 (49.56%), Postives = 309/452 (68.36%), Query Frame = 1
Query:  520 IAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQR--ATGN-----RGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQ-GAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPC---SKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICS-DEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCE-MYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLR---DVFD 1827
            +A++DY  RT +++  K+G+ + + +  + DWW  +++  +T N     RGY+P++++A   S +++ W+F  I R DAE+ LL   N  G FLIR SE+ +    LSV D     G  V HY+I++ ++ G  +I+ +  F +L +L+ YY +  +GLC +L  PC     PT I   LSY T DKWEI R+S+QL ++LGAG FGEVW+GLWN +T VAVKTLKPG M KE+F+ EA++MK L H NL++LYA+CS +EPIYI+TELM  GSLL YLR   G+ +   +L+D   QIA GMAYLE+  Y+HRDLAARNILVGEG++CK+ADFGLAR+I    E  YE   G++ P+KWTAPEA  + +FS KSDVWSFG+L+YE+IT G++P+P M N E L+ ++ GYRMP P  CP   Y IML+CWN + E RPTF +L+   D FD
Sbjct:    2 VALYDYDGRTNEDLSFKEGELLEVTDKTNSDWWYAQKKTASTSNERYNTRGYIPANYVAEYQSLDAEPWFFGDIKRADAEKYLLADVNTTGAFLIRQSESRKTDYSLSVRD-----GSTVKHYRIRQLDENGGFFISRRVTFQNLIELVQYYKSNSDGLCMALQKPCVVIEAPTTI--GLSYNTVDKWEIPRASIQLQKRLGAGMFGEVWQGLWNNSTLVAVKTLKPGAMKKEEFIGEAQIMKQLRHANLIQLYAVCSQEEPIYIITELMRHGSLLDYLRGPLGKQLKAPELVDMARQIAAGMAYLESQNYIHRDLAARNILVGEGKVCKVADFGLARIIKVRYEDEYEGKAGAKVPIKWTAPEAVNFHRFSVKSDVWSFGILLYELITYGRMPYPEMGNMEVLKQLDRGYRMPQPDNCPPLFYSIMLECWNKKEEERPTFETLQWRLDYFD 446          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: hck (HCK proto-oncogene, Src family tyrosine kinase [Source:ZFIN;Acc:ZDB-GENE-090313-72])

HSP 1 Score: 452.595 bits (1163), Expect = 1.411e-152
Identity = 210/449 (46.77%), Postives = 302/449 (67.26%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYR 1860
             ++A++DY     D++  ++GD+++++E  + DWW     AT   GY+PS+F+A   S E ++W+F  ++RKDAER LL  GN  G +LIR SET +G+  LSV DH V  G  V HYKI+  ++G  +IT++  F +L +L++YY    +GLC  L  PC    P         KD WEI R S++L +KLGAGQFG+VW G++N  T VAVK +KPG+M  + FL+EA +MK+L H  LVRL+A+ +DEPI+IVTE M KGSLL +L++  G  +   ++ID  +Q+A GMA++E+  Y+HRDL A NILV    +CKIADFGLAR+I+     Y A +G++FP+KWTAPEA  +G FS KSDVWSFG+L+ E++T G++P+P M+N E ++++E GYRMP P  CP  +Y IM +CW  +PE RPTF  L+ + +D +   E  Y+
Sbjct:   67 LVVALYDYDPIHADDLCFRRGDQLVIVEEGN-DWWKARSVATKKEGYIPSNFVAKVNSIEKEEWFFKGLSRKDAERQLLLCGNKIGSYLIRDSETNKGSYSLSVRDHIVEVGDTVKHYKIRTLDKGGYFITSRITFHTLQELVVYYHLKADGLCQKLGKPCIAIQP----QKPWEKDAWEIPRESIKLEKKLGAGQFGDVWMGVYNKKTKVAVKMMKPGSMAPQAFLEEANLMKTLQHDKLVRLHAVVTDEPIFIVTEYMEKGSLLDFLKTSEGSRLKQPKMIDMCAQVAEGMAFIEDKNYIHRDLRAANILVNVNLVCKIADFGLARIIEDN--EYTAREGAKFPIKWTAPEAINYGSFSIKSDVWSFGILLTEMVTFGRIPYPGMTNPEVIRSLERGYRMPKPDNCPCELYSIMQECWRQKPEERPTFEYLQSLLEDFYTATELQYQ 508          
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006670.1 (pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene:ENSPMAG00000006016.1 transcript:ENSPMAT00000006670.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 414.075 bits (1063), Expect = 1.742e-139
Identity = 200/381 (52.49%), Postives = 265/381 (69.55%), Query Frame = 1
Query:  745 LLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPC-SKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICS-DEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCE-MYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAECIS 1878
            L++ GN  G FL+R SET+     LSV D     G  V HYKI+   +G+ +IT +  F +L  L+  YS   NGLC +L+ PC  K  P    LS    DKWEI RSS+QL ++LGAGQFGEVW+GLWN TTPVA+KTLK GTM ++DFL+EA++MK L H  L++LYA+C+ +EPIYI+TELMS GSL  YL++  G+++ L +L+D  +Q+A GMAYLE   Y+HRDLAARNILV E   CK+ADFGLAR+I    E  YEA  GS+FP+KWTAPEAA + +FS KSDVWSFGVL++EIIT G++P+P  +N+E L  ++ GYRMP P  CP   Y++ML+CWN+  + RPTF +L+   +D F    + Y  A  ++
Sbjct:   10 LMKSGNVHGSFLVRQSETSGHGYSLSVRD-----GDTVKHYKIRVLEKGSFFITRRNQFATLRDLVQSYSRDANGLCVTLNQPCLKKEMPQTEGLSSDMADKWEIPRSSVQLVKRLGAGQFGEVWQGLWNKTTPVAIKTLKQGTMDRDDFLREAQLMKRLRHPKLIQLYAVCTQEEPIYIITELMSNGSLANYLQTPEGRSLDLVELVDMAAQVAAGMAYLEAQNYIHRDLAARNILVAEHNACKVADFGLARVIKMSNEDEYEARVGSKFPIKWTAPEAANYNRFSIKSDVWSFGVLLHEIITYGKLPYPGQTNAEVLAAVDRGYRMPCPPGCPQAFYDLMLECWNVDDQARPTFETLQWQLEDFFSQEGTNYTEAGALN 385          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: CDC15 (Protein kinase of the Mitotic Exit Network; localized to the spindle pole bodies at late anaphase; promotes mitotic exit by directly switching on the kinase activity of Dbf2p; required for spindle disassembly after meiosis II; relocalizes to the cytoplasm upon DNA replication stress [Source:SGD;Acc:S000000072])

HSP 1 Score: 92.8189 bits (229), Expect = 7.564e-20
Identity = 65/247 (26.32%), Postives = 120/247 (48.58%), Query Frame = 1
Query: 1072 QLSEKLGAGQFGEVWRGLWNGTTPV-AVK-TLKPGTMTKEDFLKEAKVMKSLCHINLVRLYA-ICSDEPIYIVTELMSKGSLLQYL-RSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPT 1800
             L + +G G +G V++ +   T  V A+K  +        D + E  ++K+L H N+V+ +  I     +YI+ E  + GSL + + RS TG +    +   +++Q   G+ YL   G +HRD+ A NIL+      K+ADFG++ ++++       +      + W APE       ST SD+WS G  + E++T+   P+ +++++     +E     P P      + + + +C+      RPT
Sbjct:   26 HLKQVIGRGSYGVVYKAINKHTDQVVAIKEVVYENDEELNDIMAEISLLKNLNHNNIVKYHGFIRKSYELYILLEYCANGSLRRLISRSSTGLSE--NESKTYVTQTLLGLKYLHGEGVIHRDIKAANILLSADNTVKLADFGVSTIVNSSALTLAGT------LNWMAPEILGNRGASTLSDIWSLGATVVEMLTKNP-PYHNLTDANIYYAVENDTYYP-PSSFSEPLKDFLSKCFVKNMYKRPT 262          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: PHO85 (Cyclin-dependent kinase; has ten cyclin partners; involved in regulating the cellular response to nutrient levels and environmental conditions and progression through the cell cycle; human lissencephaly-associated homolog CDK5 functionally complements null mutation [Source:SGD;Acc:S000005952])

HSP 1 Score: 88.9669 bits (219), Expect = 8.963e-20
Identity = 73/238 (30.67%), Postives = 120/238 (50.42%), Query Frame = 1
Query: 1063 SSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKED-----FLKEAKVMKSLCHINLVRLY-AICSDEPIYIVTELMSKGSLLQYLRSET----GQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGK-FSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPS 1743
            S  +  EKLG G +  V++GL N TT V V  LK   +  E+      ++E  +MK L H N+VRLY  I ++  + +V E M    L +Y+ S T     + + L  +  F  Q+  G+A+   +  +HRDL  +N+L+ +    K+ DFGLAR        + +   + +   + AP+  +  + +ST  D+WS G ++ E+IT G+  FP  ++ E L+ I      P+    PS
Sbjct:    5 SQFKQLEKLGNGTYATVYKGL-NKTTGVYV-ALKEVKLDSEEGTPSTAIREISLMKELKHENIVRLYDVIHTENKLTLVFEFMD-NDLKKYMDSRTVGNTPRGLELNLVKYFQWQLLQGLAFCHENKILHRDLKPQNLLINKRGQLKLGDFGLARAFGIPVNTFSSEVVTLW---YRAPDVLMGSRTYSTSIDIWSCGCILAEMIT-GKPLFPGTNDEEQLKLIFDIMGTPNESLWPS 235          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: HOG1 (Mitogen-activated protein kinase involved in osmoregulation; controls global reallocation of RNAPII during osmotic shock; mediates recruitment/activation of RNAPII at Hot1p-dependent promoters; binds calmodulin; stimulates antisense transcription to activate CDC28; defines novel S-phase checkpoint with Mrc1p that prevent replication/transcription conflicts; nuclear form represses pseudohyphal growth; autophosphorylates; protein abundance increases under DNA replication stress [Source:SGD;Acc:S000004103])

HSP 1 Score: 89.3521 bits (220), Expect = 2.469e-19
Identity = 74/203 (36.45%), Postives = 105/203 (51.72%), Query Frame = 1
Query: 1087 LGAGQFGEVWRGLWNGTT-PVAVK-TLKP---GTMTKEDFLKEAKVMKSLCHINLVRLYAICSD--EPIYIVTELMSKGSLLQYLRSETGQAMILKQLID-FISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAAL-WGKFSTKSDVWSFGVLIYEIITRGQVPFP 1668
            +G G FG V       T+ PVA+K  +KP     + K  + +E K++K L H NL+ L  I     E IY VTEL  +G+ L  L        + KQ +  F+ QI  G+ Y+ ++G +HRDL   NIL+ E    KI DFGLAR+ D     Y +++  R      APE  L W K+  + D+WS G +  E+I  G+  FP
Sbjct:   29 VGMGAFGLVCSATDTLTSQPVAIKKIMKPFSTAVLAKRTY-RELKLLKHLRHENLICLQDIFLSPLEDIYFVTEL--QGTDLHRLLQTRP---LEKQFVQYFLYQILRGLKYVHSAGVIHRDLKPSNILINENCDLKICDFGLARIQDPQMTGYVSTRYYR------APEIMLTWQKYDVEVDIWSAGCIFAEMI-EGKPLFP 218          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: BCK1 (MAPKKK acting in the protein kinase C signaling pathway; the kinase C signaling pathway controls cell integrity; upon activation by Pkc1p phosphorylates downstream kinases Mkk1p and Mkk2p; MAPKKK is an acronym for mitogen-activated protein (MAP) kinase kinase kinase [Source:SGD;Acc:S000003631])

HSP 1 Score: 89.3521 bits (220), Expect = 9.891e-19
Identity = 79/264 (29.92%), Postives = 127/264 (48.11%), Query Frame = 1
Query: 1081 EKLGAGQFGEVWRGLWNGTTP--VAVKTLKPGT---------MTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIY-IVTELMSKGSLLQYLRSETG-QAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGS-RFPVKWTAPEAALWGK-FSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPS-PKQCPSYIYEI----MLQCWNLRPEHRPTFASL 1812
            E +G G FG V+  L N TT   +AVK ++             T E    E   +K L H+N+V+     +   IY +  E ++ GS+   +R        ++K L    +Q+  G+AYL + G +HRD+ A N+L+ +  ICKI+DFG++R      ++Y  S  + R  V W APE     + +S K D+WS G ++ E+   G+ P+ ++    A+  I      P  P+     I +I    +  C+ + PE RPT   L
Sbjct: 1179 EMIGKGSFGAVYLCL-NVTTGEMMAVKQVEVPKYSSQNEAILSTVEALRSEVSTLKDLDHLNIVQYLGFENKNNIYSLFLEYVAGGSVGSLIRMYGRFDEPLIKHLT---TQVLKGLAYLHSKGILHRDMKADNLLLDQDGICKISDFGISR---KSKDIYSNSDMTMRGTVFWMAPEMVDTKQGYSAKVDIWSLGCIVLEMFA-GKRPWSNLEVVAAMFKIGKSKSAPPIPEDTLPLISQIGRNFLDACFEINPEKRPTANEL 1434          
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 86.2705 bits (212), Expect = 8.977e-18
Identity = 84/268 (31.34%), Postives = 126/268 (47.01%), Query Frame = 1
Query: 1072 QLSEKLGAGQFGEVWRGLWNGTT--PVAVKTLKPGTM-------------TKEDFL-----KEAKVMKSLCHINLVRLYAI-CSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAAL---WGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNS--EALQNIETG-YRMPSPKQCPSYIYEIMLQCWNLRPEHR 1794
            +L E LG G  G+V     NG+T    AVK +                  T  D L     +E  +MK L H N++RLY +  ++  +Y+V E   KG L   L  E G  +   + I F  QI  G++Y    G VHRDL   N+L+      KIADFG+A L   G ++ E S GS     + APE      +  F+  SDVWS GV+++ ++T G++PF     +    L  ++ G + MPS  +      +++ +   + PE R
Sbjct:   20 KLGETLGLGSTGKVQLA-RNGSTGQEAAVKVISKAVFNTGNVSGTSIVGSTTPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLL-VERG-PLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEG-KLLETSCGSPH---YAAPEIVSGIPYQGFA--SDVWSCGVILFALLT-GRLPFDEEDGNIRTLLLKVQKGEFEMPSDDEISREAQDLIRKILTVDPERR 277          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO47195 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN18])

HSP 1 Score: 267.314 bits (682), Expect = 5.785e-84
Identity = 124/267 (46.44%), Postives = 177/267 (66.29%), Query Frame = 1
Query: 1042 DKWEIDRSSLQLSEKLGAGQFGEVWRGLWNG-TTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEP-IYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLF 1836
            D+WEI+R+ + +  KLG GQ+GEV+ G W      VAVKTL+  TM  E+FLKEA VMK + H NLV+L  +C+ EP  YI+TE M  G+LL YLRS  G+ +    L+   +Q+ + M+YLE+  ++HRDLAARN LVG+  + K+ADFGL+RL+    ++Y A QG++FP+KWTAPEA     FS KSDVW+FG+L++E+ T G  P+P +  S+    ++ GYRMP P+ CP  +Y +M  CW   P  RP+F  + +  + +F
Sbjct:    5 DEWEIERTEIAMKHKLGGGQYGEVYEGTWKKYNKTVAVKTLREETMEVEEFLKEASVMKGIKHQNLVQLLGVCTREPPFYIITEFMMNGNLLDYLRSPKGKDLDAVTLMYMATQVGSAMSYLESMNFIHRDLAARNCLVGDNNLVKVADFGLSRLVSE--DIYTAHQGAKFPIKWTAPEALAHNTFSIKSDVWAFGILLWELATYGMSPYPGIDLSQVYDKLDGGYRMPCPEGCPPEVYSLMQTCWCWDPNSRPSFKEIHEKLNTMF 269          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO49804 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFY7])

HSP 1 Score: 239.58 bits (610), Expect = 2.436e-74
Identity = 109/219 (49.77%), Postives = 155/219 (70.78%), Query Frame = 1
Query: 1123 LWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLAR-LIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWN 1776
            +W GT PVAVK +K G M++EDF++EAKVMK   H NLV+LY ICS++PIYI+ ELM  G LL YLR    + +   ++ + + Q+A  M YLE+  ++HRDLAARN L+GE    K+ADFGLAR +ID   + Y AS+G++FP+KW APE  L+ KFS+KSDVW+FG+L +E+ T G+ P+P+ +N++ +Q +  GYR+  P +CP   Y  M +CW+
Sbjct:    1 MWRGTIPVAVKMMKDGAMSEEDFIEEAKVMKQFQHGNLVQLYGICSEKPIYIIQELMKGGCLLHYLRKSQFK-LQSAEMTEMVRQVAAAMKYLESHNFIHRDLAARNCLIGENRTVKVADFGLARYVID---DEYTASEGTKFPIKWAAPEVILYSKFSSKSDVWAFGILAWEVYTGGKQPYPATNNTDVVQMVINGYRLEKPLRCPDAAYSTMRKCWH 215          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO40994 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5K8])

HSP 1 Score: 230.72 bits (587), Expect = 1.686e-68
Identity = 122/273 (44.69%), Postives = 170/273 (62.27%), Query Frame = 1
Query: 1051 EIDRSSLQLSEKLGAGQFGEVWRGLWN----GTTPVAVKTLKPGTMTKE--DFLKEAKVMKSLCHINLVRLYAICSD-EPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAE 1848
            E+D+  L+L + +G G+FG+V++G        T PVA+KTLK G+ +K   DFL EA VM   C  N++ L  + S   P+ IVTE MS GSL  +L+ +    + L QL+     IA+GM YL    +VHRDLAARNILV E  +CK+ADFGL+R ++     YE S G + PV+WTAPEA  + KFST SDVWS+G+L++E  +  + P+   SN E +  +ETGYR+P P  CP  I++IML+CW+     RP+FA +    D L  + E
Sbjct:   52 ELDKRWLKLEKVIGGGEFGDVYKGTLKRPGENTIPVAIKTLKQGSTSKNRGDFLSEASVMGQFCDPNVIFLEGVVSKTHPLMIVTEFMSNGSLDNFLK-KMDSKLSLIQLMGMARGIASGMKYLSEMNFVHRDLAARNILVTETLVCKVADFGLSRELEDSA--YETS-GGKIPVRWTAPEAIKYRKFSTSSDVWSYGILLWETFSFAERPYWDWSNFEVMDRVETGYRLPPPMSCPKVIHQIMLECWDADRTKRPSFALIVKQLDSLIRSPE 320          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO49315 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHA0])

HSP 1 Score: 218.394 bits (555), Expect = 8.429e-65
Identity = 123/294 (41.84%), Postives = 168/294 (57.14%), Query Frame = 1
Query: 1015 ISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWR----GLWNGT--TPVAVKTLKPGTMTKE--DFLKEAKVMKSLC-HINLVRLYAICSDE-PIYIVTELMSKGSLLQYLRS-----------ETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDL 1833
            ++++  +  ++WE DR+ L + E LG G FG+V R    GL   +  T VAVK LK     +E  D + E +VMKS+  HIN++ L   C+   P++++ E    G+L Q+LR            E  + + L  L+ F  QIA GM YL +   +HRDLAARNILV +  I KIADFGLAR +    + Y  +   R PVKW A EA     ++T+SDVWSFG++++EIIT G  P+P +   +    + TGYRM  P  C   +YEIM  CWN  PE RPTF SL   FDDL
Sbjct:   41 LNEVEIEYDEEWEFDRTYLVIREVLGEGAFGKVMRAEAFGLHGNSACTTVAVKMLKEDATEQELFDLVSEMEVMKSIGKHINIINLLGTCTQHGPLFVLVEYARWGNLRQFLRDRRPVKDYDDVMEPAETLTLLNLMTFCYQIAKGMEYLASRKCIHRDLAARNILVADDNILKIADFGLARDVH-NVDYYRKTTDGRLPVKWMAFEALFDRVYTTQSDVWSFGIVVWEIITFGGTPYPGVPIEKLCMLLNTGYRMERPVNCSKELYEIMRNCWNENPEARPTFTSLVQAFDDL 333          
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Match: EDO33736 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SRD7])

HSP 1 Score: 218.394 bits (555), Expect = 3.529e-64
Identity = 110/272 (40.44%), Postives = 167/272 (61.40%), Query Frame = 1
Query: 1051 EIDRSSLQLSEKLGAGQFGEVWRGLWNGTTP----VAVKTLKPGTMTK--EDFLKEAKVMKSLCHINLVRLYAICS-DEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEA---SQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLF 1836
            EI++  L+L   +G G+F +V+RG+          VAVK LKPG+  K  EDF  EA +M    H N++ L  + +   P+ I+TE +  GSL  +L+S  G+   L QL+     +A GMAYL    ++HRDLAARNILV +    K++DFGL+R +D   E  ++   +QG + PV+WTAPEA  + KFS+ SDVWS+G+L++EI++ G+ P+ +  N + +  +E GYR+P+P +CP  I+ +ML CW+     RP FA +   FD++ 
Sbjct:   21 EINKDDLKLEIIIGGGEFADVYRGVLTNEDKTQEKVAVKILKPGSSHKNREDFCVEASIMGQFDHPNVIALKGVITRTRPMMIITEFLENGSLDNFLKSNDGRLTTL-QLVGIGRGVAAGMAYLSEMNFIHRDLAARNILVSDNLAAKVSDFGLSRELDDSPENEQSEYQTQGGKIPVRWTAPEAIRYRKFSSASDVWSYGILLWEIMSFGERPYWTWDNFQVMDRVEGGYRLPAPMKCPKVIHNLMLDCWDKEKTSRPKFADIVRRFDEVI 291          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: fyna (tyrosine-protein kinase fyna [Source:NCBI gene;Acc:101157019])

HSP 1 Score: 533.102 bits (1372), Expect = 0.000e+0
Identity = 248/452 (54.87%), Postives = 323/452 (71.46%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              +A++DY+ART D++  +KG+R  +L S + DWW      TG  GY+PS+++A   S +++DWYF  + RKDAER LL  GNARG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L QL+ +YS    GLCC L  PC K  P ++DLS KTKD WEI R SLQL ++LG GQFGEVW G WNGTT VAVKTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYIVTE MSKGSLL +L+   G+ + L  L+D  +Q+A GMAY+E   Y+HRDL + NILVG+G +CKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+GKF+ KSDVWSFG+L+ E++T+G+VP+P M+N E L+ +E GYRMP P+ CP+ ++E+M+QCW   PE RPTF  L+   +D F   E  Y+  +
Sbjct:   86 LFVALYDYEARTEDDLSFRKGERFQILNSTEGDWWEARSLTTGGTGYIPSNYVAPVDSIQAEDWYFGKLGRKDAERQLLSSGNARGTFLIRESETTKGAYSLSIQDWDDIKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSARAAGLCCRLIAPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGTTKVAVKTLKPGTMSPESFLEEAQIMKKLRHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGRGLKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGDGLVCKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGKFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPTSLHELMVQCWKKDPEERPTFEYLQAFLEDYFTATEPQYQPGD 535          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: yrk (proto-oncogene tyrosine-protein kinase Yrk [Source:NCBI gene;Acc:101155365])

HSP 1 Score: 513.842 bits (1322), Expect = 1.382e-175
Identity = 241/452 (53.32%), Postives = 318/452 (70.35%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
              IA++DY ART D++  +KG++  ++ + + DWW      TG  GY+PS+++A   S ++++WYF  + RKDAER LL  GN RG FLIR SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F ++ QL+ +Y+    GLCC L   C +  P ++DLS KTKD WEI R SLQL +KLG GQFGEVW G+WNGTT VAVKTLKPGTM+ E FL+EA++MK L H  LV+LYA+ S+EPIYI+TE MS+GSLL +L+   GQ + L QL+D  +QIA GMAY+E   Y+HRDL A NILVG+  +CKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E+IT+G+VP+P M+N E L+ +E GYRMP    CP+ ++E+MLQCW   P+ R TF  L+   +D F   E  Y+  E
Sbjct:   78 LFIALYDYDARTEDDLTFQKGEKFQIINNTEGDWWEARSLDTGKSGYIPSNYVAPIDSIQAEEWYFGKMGRKDAERQLLGQGNPRGTFLIRESETTKGAYSLSIRDWDDTKGDHVKHYKIRKLDNGGYYITTRSQFDTVQQLVEHYTERAAGLCCRLIGSCKRGMPKLADLSVKTKDMWEIPRESLQLIKKLGNGQFGEVWMGMWNGTTKVAVKTLKPGTMSPEAFLEEAQIMKRLRHDKLVQLYAVVSEEPIYIITEFMSEGSLLDFLKDGEGQTLKLPQLVDMAAQIAAGMAYIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELITKGRVPYPGMNNREVLEQVERGYRMPCAPGCPASLHELMLQCWRREPDERHTFEYLQSFLEDYFTATEPQYQPGE 527          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: SRC (SRC proto-oncogene, non-receptor tyrosine kinase [Source:NCBI gene;Acc:101173856])

HSP 1 Score: 509.605 bits (1311), Expect = 1.039e-173
Identity = 239/451 (52.99%), Postives = 317/451 (70.29%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
             +A++DY++RT  ++  +KGDR+ ++ + + DWWL     TG  GY+PS+++A   S ++++WYF  ITR+D+ER LL   N RG FL+R SETT+GA CLSVLD+    G  V HYKI+K + G  YIT++  F SL QL+ +Y    +GLC +L+  C    P    L+   +D WEI R SL+L  KLG G FGEVW G WNGTT VA+KTLKPGTM+ E FL+EA+VMK L H  LV+LYA+ S+EPIYIVTE MS+GSLL +L+ +TG+ + L QL+D  +QIA GMAY+E   YVHRDL A NILVG+  +CK+ADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFGVL+ E+ T+G+VP+P M N E L  +E GYRMP P +CPS ++E+ML CW   PE RPTF  L+   +D F + E  Y+  E
Sbjct:   97 FVALYDYESRTASDLTFRKGDRLQIVNNTEGDWWLARSLTTGESGYIPSNYVAPSDSIQAEEWYFGKITRRDSERLLLNLQNRRGTFLVRESETTKGAYCLSVLDYDNAKGLNVKHYKIRKLDSGGFYITSRTQFTSLQQLVFHYRKHSDGLCHALTDVCPVAKPQTQGLA---RDAWEIPRESLRLDVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSQGSLLDFLKGDTGKLLRLPQLVDMAAQIAAGMAYVEKMNYVHRDLRAANILVGDNLVCKVADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGVLLTELATKGRVPYPGMVNREVLDQVERGYRMPCPAECPSSLHELMLSCWRKDPEERPTFEYLQGFLEDYFTSTEPQYQPGE 542          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: src (proto-oncogene tyrosine-protein kinase Src [Source:NCBI gene;Acc:101164480])

HSP 1 Score: 496.508 bits (1277), Expect = 9.011e-169
Identity = 236/451 (52.33%), Postives = 313/451 (69.40%), Query Frame = 1
Query:  517 LIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
             +A++DY++RT  ++  +KG+R+ ++ + + DWWL    ATG  GY+PS+++A   S ++++WYF  ITR+D+ER LL   N RG FL+R SETT+GA CLSVLD+    G  V HYKI+K + G  YIT++  F  L QL  Y+    +GLC SL+  C    P    L+   KD WEI R SL+L  KLG G FGEVW G WNGTT VA+KTLKPGTM+ E FL+EA+VMK L H  LV+LYA+ S+EPIYIVTE MS+GSLL +L+ + G+ + L QL+D  SQIA+GMAY+E   YVHRDL A NILVG+  +CK+ADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E+ T+G+VP+P M N E L  ++ GYRMP P  CP  ++E+ML CW    E RPTF  L+   +D F + E  Y+  E
Sbjct:   89 FVALYDYESRTASDLSFRKGERLQIVNNTEGDWWLARSLATGESGYIPSNYVAPSESIQAEEWYFGKITRRDSERLLLSLENRRGTFLVRESETTKGAYCLSVLDYDNTKGLNVKHYKIRKLDSGGFYITSRTQFSGL-QLSRYFPAHADGLCHSLTDICPVLKPQTQGLA---KDAWEIPRESLRLDVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSQGSLLDFLKGDMGKMLRLPQLVDMASQIASGMAYVERMNYVHRDLRAANILVGDNLVCKVADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELATKGRVPYPGMVNREVLDQVDRGYRMPCPADCPESLHELMLTCWRKEAEERPTFEYLQSFLEDYFTSTEPQYQPGE 533          
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Match: YES1 (YES proto-oncogene 1, Src family tyrosine kinase [Source:NCBI gene;Acc:101158313])

HSP 1 Score: 496.893 bits (1278), Expect = 1.041e-168
Identity = 233/452 (51.55%), Postives = 313/452 (69.25%), Query Frame = 1
Query:  514 FLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAE 1869
            F +A++DY+ART D++  KKGDR  ++ + + DWW      TG +GY+PS+++A   S ++++WYF  + RKDAER LL PGN RG FL+R SETT+GA  LS+ D     G  V HYKI+K + G  YITT+  F +L +L+ +Y+   +GLC  L+  C    P    L+   KD WEI R SLQL  KLG G FGEVW G WNGTT VA+KTLKPGTM+ E FL+EA++MK L H  LV L+A+ S+EPIYIVTE MSKGSLL +L+   G+ + L  L+D  ++IA+GMA++E   Y+HRDL A NILVG+  +CKIADFGLARLI+     Y A QG++FP+KWTAPEAAL+G+F+ KSDVWSFG+L+ E++T+G+VP+P M N E L+ +E GYRMP P+ CP  ++E+M  CW   P+ RPTF  L+   +D F + E  Y+  E
Sbjct:  102 FFVALYDYEARTSDDLTFKKGDRFQIINNTEGDWWEARSITTGKKGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNDRGTFLVRESETTKGAYSLSIRDWDSAKGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHYTEHADGLCHRLTTVCPTVKPQTQGLA---KDAWEISRESLQLELKLGQGCFGEVWMGTWNGTTKVAIKTLKPGTMSPEAFLQEAQIMKKLRHDKLVPLFAVVSEEPIYIVTEYMSKGSLLDFLKEGEGKFLNLVMLVDMAAKIADGMAFIERMNYIHRDLRAANILVGDNLVCKIADFGLARLIED--NEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMVNREVLEQVERGYRMPCPQGCPESLHEMMKLCWKKEPDERPTFEYLQSFLEDYFTSTEPQYQPGE 548          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000020289.1 (SMESG000020289.1)

HSP 1 Score: 1244.18 bits (3218), Expect = 0.000e+0
Identity = 609/609 (100.00%), Postives = 609/609 (100.00%), Query Frame = 1
Query:   55 MGNCVDKLENGSLRDNKYLPNQKENIDKDDYKFSNENSNQTQSYPSTPHMTKANVSSSSSVPIEKKYSISSFANSNVSKLTNSQEGSHMSVKISESCTTFINNSGENILPRLSDCSDRNWNVRXXXXXXXXXXXXLFTTSTNYGSKTDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAECISR 1881
            MGNCVDKLENGSLRDNKYLPNQKENIDKDDYKFSNENSNQTQSYPSTPHMTKANVSSSSSVPIEKKYSISSFANSNVSKLTNSQEGSHMSVKISESCTTFINNSGENILPRLSDCSDRNWNVRSDSPSRHSQSSSLFTTSTNYGSKTDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAECISR
Sbjct:    1 MGNCVDKLENGSLRDNKYLPNQKENIDKDDYKFSNENSNQTQSYPSTPHMTKANVSSSSSVPIEKKYSISSFANSNVSKLTNSQEGSHMSVKISESCTTFINNSGENILPRLSDCSDRNWNVRSDSPSRHSQSSSLFTTSTNYGSKTDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAECISR 609          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000020289.1 (SMESG000020289.1)

HSP 1 Score: 1186.4 bits (3068), Expect = 0.000e+0
Identity = 588/609 (96.55%), Postives = 588/609 (96.55%), Query Frame = 1
Query:   55 MGNCVDKLENGSLRDNKYLPNQKENIDKDDYKFSNENSNQTQSYPSTPHMTKANVSSSSSVPIEKKYSISSFANSNVSKLTNSQEGSHMSVKISESCTTFINNSGENILPRLSDCSDRNWNVRXXXXXXXXXXXXLFTTSTNYGSKTDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAECISR 1881
            MGNCVDKLENGSLRDNKYLPNQKENIDKDDYKFSNENSNQTQSYPSTPHMTKANVSSSSSVPIEKKYSISSFANSNVSKLTNSQEGSHMSVKISES                     RNWNVRSDSPSRHSQSSSLFTTSTNYGSKTDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAECISR
Sbjct:    1 MGNCVDKLENGSLRDNKYLPNQKENIDKDDYKFSNENSNQTQSYPSTPHMTKANVSSSSSVPIEKKYSISSFANSNVSKLTNSQEGSHMSVKISESY--------------------RNWNVRSDSPSRHSQSSSLFTTSTNYGSKTDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAECISR 589          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000020289.1 (SMESG000020289.1)

HSP 1 Score: 1066.22 bits (2756), Expect = 0.000e+0
Identity = 521/521 (100.00%), Postives = 521/521 (100.00%), Query Frame = 1
Query:  319 MSVKISESCTTFINNSGENILPRLSDCSDRNWNVRXXXXXXXXXXXXLFTTSTNYGSKTDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAECISR 1881
            MSVKISESCTTFINNSGENILPRLSDCSDRNWNVRSDSPSRHSQSSSLFTTSTNYGSKTDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAECISR
Sbjct:    1 MSVKISESCTTFINNSGENILPRLSDCSDRNWNVRSDSPSRHSQSSSLFTTSTNYGSKTDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAAECISR 521          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000003807.1 (SMESG000003807.1)

HSP 1 Score: 566.229 bits (1458), Expect = 0.000e+0
Identity = 261/458 (56.99%), Postives = 344/458 (75.11%), Query Frame = 1
Query:  493 TDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAA 1866
            T+I + R LIA+FDY  RT +E+ L+KGDRV LL   DP+WWLVE   T ++GY+PSSF+A+E S ESQDW+   I+RKD+ER L+   N +G FL+R SET+QG   LSV D+  N    V HYKI+  +   V ITTK +F SL +LI +YS   NGLCC L+ PC +P P+ +DLS+KTKD+WEI RSS++L  KLGAGQFGEVW+G WN +T VAVKTLK G MT ++FLKEA++MK+L H  LV+LYA+C+D+PIYIVTELM+ GSLL YLR   G+ + +K L+D ++QIA GMA+LE   Y+HRDLAARNILVGE  +CK+ADFGLAR+I      YEA +G++FP+KWTAPEAA+ G+F+ KSDVWS+G+++YEI+T+G+VP+PSM+N+E LQ +E GYRMP P +CP  IY IML  W   P+ RPTF  L + F++ ++ AE+ Y+ A
Sbjct:  186 TEIEK-RVLIAMFDYNERTNEELSLRKGDRVYLLNEFDPEWWLVEHATTLDKGYIPSSFVALEGSLESQDWFISKISRKDSERLLMLQCNTQGTFLVRQSETSQGFLSLSVRDNEPNGSESVKHYKIRYADD-MVCITTKCMFSSLVELIDFYSKDSNGLCCRLTRPCPRPAPVTTDLSFKTKDQWEIPRSSIELVTKLGAGQFGEVWKGKWNNSTWVAVKTLKQGAMTTDEFLKEARIMKNLNHAKLVKLYAVCTDDPIYIVTELMTHGSLLAYLREGPGKNLEMKMLVDLMAQIACGMAFLEKERYIHRDLAARNILVGENNMCKVADFGLARMIRENSGTYEAKEGTKFPIKWTAPEAAMIGRFTIKSDVWSYGIVLYEIVTKGKVPYPSMNNTETLQEVEKGYRMPIPAECPHKIYNIMLTTWQQNPDDRPTFEFLCEFFENYYVHAETNYKHA 641          
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Match: SMESG000016930.1 (SMESG000016930.1)

HSP 1 Score: 557.37 bits (1435), Expect = 0.000e+0
Identity = 285/579 (49.22%), Postives = 384/579 (66.32%), Query Frame = 1
Query:  172 QTQSYPSTPHMTKAN--------VSSSSSVPIEKKYS-ISSFANSNVSKLTNSQEGSHMSVKISESCTTFINNSGENILPRLSDCSDRNWNVRXXXXXXXXXXXXLFTTSTNYGSKTDIHRNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGYVPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQGAQCLSVLDHPVNSGYVVNHYKIKK-----TNQGAVYITTKKIFPSLTQLILYYSNAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQFGEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAICSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLENSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPVKWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIETGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESGYRAA 1866
            +  SYP+TP  +  N        V+S + V +   +S  SS   S ++   NSQ   H  V+           S EN L +L    D    + S   +      ++    + Y  +TD+      +A+FDY AR  +EI ++K D + +++ +D DWW VE    G +GY+P S++A + S E++DW+F  I+RKD+ER LL  GN +G FLIR SET      LSV     N    VNHY+++K     + +    IT++K+F +L +L+ +YS   NGLCC L+  C +P P+ISDLS  T+D+WEI+R+S++L +KLG+G FGEV++G+WN TT VAVKTLKPGTM KE+FLKEA++MK L H NLVRLYA+CSDEPIYIVTELM+KGSLL+YLR E G+   LK+L+D +SQIANGMAYLE  GY+HRDLAARNIL+GE  ICKIADFGL R+I    + Y A QG++FP+KWTAPEAAL GKF+ KSDVWS+G+++YEIIT GQ PFP+M+N++ LQ +E GYRMP P  CP  +Y++ML CW   PE+RPTF  L + FDD F +AE  Y+ A
Sbjct:   71 KNHSYPNTPKSSSNNLIAHPNSIVASPNEVILSLSFSNCSSPLTSTINSKANSQTTRHSFVE-----------SSENYLKKLRQFPDPLNQINSAYLTSVMGPENV---QSFYSVETDV-----FVALFDYNARDEEEISIRKADYLKVIDDSDLDWWFVEHIGHGVKGYIPKSYIASKGSVEAEDWFFYNISRKDSERLLLLKGNIQGTFLIRGSETMPDQLSLSV-----NYNGTVNHYRVRKRRFPESMEEGFCITSRKMFFALPELVDFYSTEANGLCCKLTRACPRPPPVISDLSRNTRDRWEINRNSIELLKKLGSGNFGEVYQGIWNKTTDVAVKTLKPGTMAKEEFLKEARIMKRLNHSNLVRLYAVCSDEPIYIVTELMTKGSLLEYLREE-GKHTELKELMDMMSQIANGMAYLEKEGYIHRDLAARNILIGENNICKIADFGLTRVIQGSSDTYNARQGAKFPIKWTAPEAALMGKFTVKSDVWSYGIVLYEIITHGQTPFPAMNNTQTLQQVEKGYRMPKPSNCPQELYKVMLYCWEALPENRPTFKYLSEFFDD-FSSAECSYKPA 623          
The following BLAST results are available for this feature:
BLAST of Tyrosine-protein kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FYN3.663e-17852.54FYN proto-oncogene, Src family tyrosine kinase [So... [more]
FYN3.663e-17852.54FYN proto-oncogene, Src family tyrosine kinase [So... [more]
SRC7.203e-17353.22SRC proto-oncogene, non-receptor tyrosine kinase [... [more]
SRC7.203e-17353.22SRC proto-oncogene, non-receptor tyrosine kinase [... [more]
SRC7.203e-17353.22SRC proto-oncogene, non-receptor tyrosine kinase [... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
src-12.475e-15348.35Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-15.441e-15348.46Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-15.441e-15348.46Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-19.862e-15348.46Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
src-19.862e-15348.46Tyrosine protein-kinase src-1 [Source:UniProtKB/S... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Src42A3.595e-16449.78gene:FBgn0264959 transcript:FBtr0335275[more]
Src64B7.354e-15048.68gene:FBgn0262733 transcript:FBtr0100508[more]
Src64B7.354e-15048.68gene:FBgn0262733 transcript:FBtr0100505[more]
Src64B7.354e-15048.68gene:FBgn0262733 transcript:FBtr0100504[more]
Src64B7.354e-15048.68gene:FBgn0262733 transcript:FBtr0304990[more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fyna1.144e-17953.98FYN proto-oncogene, Src family tyrosine kinase a [... [more]
fynb1.384e-17653.10FYN proto-oncogene, Src family tyrosine kinase b [... [more]
fynb1.384e-17653.10FYN proto-oncogene, Src family tyrosine kinase b [... [more]
yrk6.383e-17453.10Yes-related kinase [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
yrk6.383e-17453.10Yes-related kinase [Source:ZFIN;Acc:ZDB-GENE-03013... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ccdc131.198e-17853.63coiled-coil domain containing 13 [Source:Xenbase;A... [more]
ccdc131.752e-17853.48coiled-coil domain containing 13 [Source:Xenbase;A... [more]
ccdc133.870e-17852.54coiled-coil domain containing 13 [Source:Xenbase;A... [more]
FGR4.546e-17351.81FGR proto-oncogene, Src family tyrosine kinase [So... [more]
cthrc13.597e-17252.15collagen triple helix repeat containing 1 [Source:... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fyn7.885e-17952.75Fyn proto-oncogene [Source:MGI Symbol;Acc:MGI:9560... [more]
Src2.132e-17252.99Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:9... [more]
Src2.132e-17252.99Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:9... [more]
Src2.132e-17252.99Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:9... [more]
Src8.015e-17052.30Rous sarcoma oncogene [Source:MGI Symbol;Acc:MGI:9... [more]
back to top
BLAST of Tyrosine-protein kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P27446|FYN_XIPHE1.403e-18053.18Tyrosine-protein kinase Fyn OS=Xiphophorus helleri... [more]
sp|Q6EWH2|FYNA_DANRE8.639e-17953.98Tyrosine-protein kinase fyna OS=Danio rerio OX=795... [more]
sp|P39688|FYN_MOUSE5.515e-17852.75Tyrosine-protein kinase Fyn OS=Mus musculus OX=100... [more]
sp|P13406|FYN_XENLA1.545e-17752.54Tyrosine-protein kinase Fyn OS=Xenopus laevis OX=8... [more]
sp|P06241|FYN_HUMAN1.759e-17752.54Tyrosine-protein kinase Fyn OS=Homo sapiens OX=960... [more]
back to top
BLAST of Tyrosine-protein kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J8670.000e+059.17Tyrosine-protein kinase OS=Schistocephalus solidus... [more]
A0A3Q0KT010.000e+060.71Tyrosine-protein kinase OS=Schistosoma mansoni OX=... [more]
A0A4Z2CUE70.000e+061.06Tyrosine-protein kinase OS=Schistosoma japonicum O... [more]
A0A4E0S0K60.000e+059.07Tyrosine-protein kinase OS=Fasciola hepatica OX=61... [more]
A0A0V0J6V30.000e+055.53Tyrosine-protein kinase OS=Schistocephalus solidus... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fyna7.129e-17953.98tyrosine-protein kinase fyna [Source:NCBI gene;Acc... [more]
yrk9.407e-17453.10proto-oncogene tyrosine-protein kinase Yrk [Source... [more]
SRC1.743e-17051.84proto-oncogene tyrosine-protein kinase Src-like [S... [more]
clul11.192e-16751.33tyrosine-protein kinase yes [Source:NCBI gene;Acc:... [more]
SRC7.182e-16751.97proto-oncogene tyrosine-protein kinase Src-like [S... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
clul12.042e-16951.09clusterin-like 1 (retinal) [Source:ZFIN;Acc:ZDB-GE... [more]
hck8.495e-15747.66HCK proto-oncogene, Src family tyrosine kinase [So... [more]
frk1.128e-15549.56fyn-related Src family tyrosine kinase [Source:ZFI... [more]
hck1.411e-15246.77HCK proto-oncogene, Src family tyrosine kinase [So... [more]
ENSPMAT00000006670.11.742e-13952.49pep scaffold:Pmarinus_7.0:GL482639:18:11990:1 gene... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC157.564e-2026.32Protein kinase of the Mitotic Exit Network; locali... [more]
PHO858.963e-2030.67Cyclin-dependent kinase; has ten cyclin partners; ... [more]
HOG12.469e-1936.45Mitogen-activated protein kinase involved in osmor... [more]
BCK19.891e-1929.92MAPKKK acting in the protein kinase C signaling pa... [more]
GIN48.977e-1831.34Protein kinase involved in bud growth and assembly... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO471955.785e-8446.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO498042.436e-7449.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409941.686e-6844.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO493158.429e-6541.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO337363.529e-6440.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fyna0.000e+054.87tyrosine-protein kinase fyna [Source:NCBI gene;Acc... [more]
yrk1.382e-17553.32proto-oncogene tyrosine-protein kinase Yrk [Source... [more]
SRC1.039e-17352.99SRC proto-oncogene, non-receptor tyrosine kinase [... [more]
src9.011e-16952.33proto-oncogene tyrosine-protein kinase Src [Source... [more]
YES11.041e-16851.55YES proto-oncogene 1, Src family tyrosine kinase [... [more]
back to top
BLAST of Tyrosine-protein kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000020289.10.000e+0100.00SMESG000020289.1[more]
SMESG000020289.10.000e+096.55SMESG000020289.1[more]
SMESG000020289.10.000e+0100.00SMESG000020289.1[more]
SMESG000003807.10.000e+056.99SMESG000003807.1[more]
SMESG000016930.10.000e+049.22SMESG000016930.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031519 ID=SMED30031519|Name=Tyrosine-protein kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=2207bp
AAATTAGAATTTTTGAATTAAAAATGTATTCGACAGATTTATTTTTGTGA
CAAAATGGGTAATTGTGTTGATAAATTAGAAAATGGCTCCTTAAGAGATA
ACAAATATTTACCAAATCAGAAAGAAAATATCGATAAAGATGATTATAAG
TTTTCAAATGAAAATTCTAATCAAACTCAATCATATCCGTCTACTCCACA
TATGACTAAAGCTAATGTAAGTTCCAGTAGCTCTGTTCCTATTGAAAAAA
AATATTCAATAAGTAGTTTTGCAAATTCCAATGTCTCTAAACTAACGAAT
TCTCAAGAGGGTTCTCACATGTCAGTTAAAATTTCAGAGTCTTGTACTAC
TTTTATAAATAATTCTGGTGAAAATATCTTACCTCGTTTGTCTGATTGTT
CAGATCGTAATTGGAATGTTAGATCAGATTCTCCAAGTAGGCACAGTCAG
TCATCATCTCTATTTACAACTTCAACAAATTATGGATCGAAAACAGATAT
TCATCGAAATAGATTTTTGATAGCTATCTTCGACTATAAAGCAAGAACAA
TTGATGAAATATATCTTAAAAAAGGCGATAGAGTTATTTTACTAGAATCT
AATGATCCAGATTGGTGGCTAGTCGAACAACGAGCAACGGGAAATAGAGG
CTACGTGCCTTCATCATTTTTGGCTGTGGAATATTCATTTGAATCTCAGG
ATTGGTATTTCCCGTTCATTACAAGAAAAGACGCCGAAAGATCATTGCTA
CAACCAGGAAATGCCCGAGGCTGTTTTTTAATTCGAGCTAGTGAAACTAC
TCAAGGAGCCCAATGTTTGTCGGTATTGGATCATCCGGTTAACAGTGGCT
ATGTTGTTAATCATTACAAAATCAAAAAAACCAATCAAGGCGCTGTGTAT
ATTACCACCAAAAAAATCTTTCCTAGTCTTACTCAGTTAATTTTATATTA
CTCAAATGCACCAAATGGCTTATGCTGTTCACTGTCACATCCATGTTCAA
AGCCAACTCCGATAATAAGTGATTTGTCATATAAAACCAAAGATAAATGG
GAAATCGACAGGTCCTCCTTACAGCTCAGTGAAAAATTAGGTGCTGGTCA
ATTCGGAGAAGTTTGGAGAGGACTTTGGAATGGAACAACACCAGTAGCAG
TTAAGACTTTAAAGCCAGGTACGATGACAAAGGAAGATTTTTTAAAAGAG
GCGAAAGTAATGAAGAGTTTATGTCACATTAATCTAGTTCGATTATACGC
GATATGCTCGGATGAACCAATTTATATCGTAACCGAACTCATGTCGAAAG
GCAGTTTATTACAGTACCTCAGATCAGAAACAGGCCAAGCAATGATTTTA
AAACAACTTATCGATTTTATTTCACAGATTGCAAATGGAATGGCGTATTT
GGAAAACAGTGGCTATGTTCATCGAGATTTAGCAGCTCGTAATATTCTTG
TTGGTGAAGGAGAAATTTGTAAAATCGCCGATTTCGGTCTGGCGCGTTTA
ATTGATGCAGGGTGTGAAATGTATGAAGCTAGCCAAGGATCTCGATTTCC
AGTAAAATGGACAGCACCAGAAGCCGCTTTATGGGGTAAATTCAGCACCA
AGTCCGATGTTTGGTCATTTGGCGTGTTAATTTATGAAATTATAACCCGT
GGTCAAGTACCATTTCCTTCAATGAGCAACTCCGAAGCACTTCAAAATAT
CGAGACAGGATATAGGATGCCAAGTCCGAAACAATGTCCCAGTTATATAT
ATGAAATTATGCTTCAATGTTGGAATTTACGTCCTGAACATAGACCAACC
TTTGCCAGTTTACGAGACGTATTCGATGATCTTTTTATTACTGCTGAATC
AGGATATCGAGCCGCAGAGTGTATCTCTCGTTAGCTTTATTATCAAAAAT
TGATCTGAATTTGCCTGGCTCTGATTCCACTGCTGTCTTCCACCCAGTGT
GATCTCTACACCTTCATTGTGGACAACAGTGCCTGAGACGTTCTAGTCAT
GTTGCCTTATCTGGTCCGAGGGGTGGACGATTATCTCGATCTCAGATTAA
ATTTCGGCTACCTCTAGATTCAACCATTGTCTAGAATAAAGGACTTATCT
CAGCTTTTCAAAATTACTATTAATATTACCATAATAGATTTTTAATTGAT
TTTTTTAATATTGCTTTCATTGTTTTTTATCTACCATATTGATCTGAGAG
ATTGACA
back to top

protein sequence of SMED30031519-orf-1

>SMED30031519-orf-1 ID=SMED30031519-orf-1|Name=SMED30031519-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=610bp
MGNCVDKLENGSLRDNKYLPNQKENIDKDDYKFSNENSNQTQSYPSTPHM
TKANVSSSSSVPIEKKYSISSFANSNVSKLTNSQEGSHMSVKISESCTTF
INNSGENILPRLSDCSDRNWNVRSDSPSRHSQSSSLFTTSTNYGSKTDIH
RNRFLIAIFDYKARTIDEIYLKKGDRVILLESNDPDWWLVEQRATGNRGY
VPSSFLAVEYSFESQDWYFPFITRKDAERSLLQPGNARGCFLIRASETTQ
GAQCLSVLDHPVNSGYVVNHYKIKKTNQGAVYITTKKIFPSLTQLILYYS
NAPNGLCCSLSHPCSKPTPIISDLSYKTKDKWEIDRSSLQLSEKLGAGQF
GEVWRGLWNGTTPVAVKTLKPGTMTKEDFLKEAKVMKSLCHINLVRLYAI
CSDEPIYIVTELMSKGSLLQYLRSETGQAMILKQLIDFISQIANGMAYLE
NSGYVHRDLAARNILVGEGEICKIADFGLARLIDAGCEMYEASQGSRFPV
KWTAPEAALWGKFSTKSDVWSFGVLIYEIITRGQVPFPSMSNSEALQNIE
TGYRMPSPKQCPSYIYEIMLQCWNLRPEHRPTFASLRDVFDDLFITAESG
YRAAECISR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036860SH2_dom_sf
IPR036028SH3-like_dom_sf
IPR001245Ser-Thr/Tyr_kinase_cat_dom
IPR001452SH3_domain
IPR000980SH2
IPR020635Tyr_kinase_cat_dom
IPR017441Protein_kinase_ATP_BS
IPR008266Tyr_kinase_AS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005515protein binding
GO:0004713protein tyrosine kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004715non-membrane spanning protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPRINTSPR00109TYRKINASEcoord: 448..466
score: 67.23
coord: 561..583
score: 47.63
coord: 410..423
score: 53.12
coord: 517..539
score: 55.21
coord: 498..508
score: 67.07
IPR001245Serine-threonine/tyrosine-protein kinase, catalytic domainPFAMPF07714Pkinase_Tyrcoord: 339..588
e-value: 1.3E-92
score: 309.7
IPR000980SH2 domainPRINTSPR00401SH2DOMAINcoord: 267..277
score: 41.64
coord: 217..231
score: 48.68
coord: 238..248
score: 58.75
coord: 250..261
score: 37.29
coord: 288..302
score: 37.12
IPR000980SH2 domainSMARTSM00252SH2_5coord: 215..305
e-value: 4.4E-27
score: 106.0
IPR000980SH2 domainPFAMPF00017SH2coord: 217..299
e-value: 2.5E-20
score: 72.4
IPR000980SH2 domainPROSITEPS50001SH2coord: 217..314
score: 21.408
IPR001452SH3 domainPRINTSPR00452SH3DOMAINcoord: 167..182
score: 30.84
coord: 184..193
score: 29.96
coord: 197..209
score: 28.34
coord: 153..163
score: 31.94
IPR001452SH3 domainSMARTSM00326SH3_2coord: 153..210
e-value: 1.7E-15
score: 67.5
IPR001452SH3 domainPFAMPF00018SH3_1coord: 156..203
e-value: 5.2E-13
score: 48.4
IPR001452SH3 domainPROSITEPS50002SH3coord: 150..211
score: 24.087
IPR020635Tyrosine-protein kinase, catalytic domainSMARTSM00219tyrkin_6coord: 339..590
e-value: 3.2E-135
score: 465.2
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 329..414
e-value: 6.2E-35
score: 121.2
NoneNo IPR availableGENE3DG3DSA:2.30.30.40coord: 154..206
e-value: 1.5E-16
score: 61.7
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 415..603
e-value: 7.1E-56
score: 191.0
NoneNo IPR availablePIRSFPIRSF000615TyrPK_CSF1-Rcoord: 21..133
e-value: 380.0
score: -3.5
coord: 424..604
e-value: 1.5E-53
score: 179.9
coord: 322..432
e-value: 3.1E-15
score: 53.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 36..60
NoneNo IPR availablePANTHERPTHR24418:SF224TYROSINE-PROTEIN KINASE FGRcoord: 138..604
NoneNo IPR availablePANTHERPTHR24418TYROSINE-PROTEIN KINASEcoord: 138..604
NoneNo IPR availableCDDcd11845SH3_Src_likecoord: 154..205
e-value: 4.27177E-17
score: 73.3856
NoneNo IPR availableCDDcd05034PTKc_Src_likecoord: 343..591
e-value: 1.05862E-165
score: 470.612
IPR036860SH2 domain superfamilyGENE3DG3DSA:3.30.505.10coord: 207..316
e-value: 5.2E-30
score: 105.5
IPR036860SH2 domain superfamilySUPERFAMILYSSF55550SH2 domaincoord: 212..359
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 345..367
IPR008266Tyrosine-protein kinase, active sitePROSITEPS00109PROTEIN_KINASE_TYRcoord: 454..466
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 339..595
score: 41.234
IPR036028SH3-like domain superfamilySUPERFAMILYSSF50044SH3-domaincoord: 154..236
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 325..591