Zinc finger and SCAN domain-containing protein 2

Overview
NameZinc finger and SCAN domain-containing protein 2
Smed IDSMED30031507
Length (bp)2131
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Zinc finger and SCAN domain-containing protein 2 (SMED30031507) t-SNE clustered cells

Violin plots show distribution of expression levels for Zinc finger and SCAN domain-containing protein 2 (SMED30031507) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Zinc finger and SCAN domain-containing protein 2 (SMED30031507) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Zinc finger and SCAN domain-containing protein 2 (SMED30031507) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031507

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031507SMESG000049972.1 SMESG000031902.1 SmedASXL_017518SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30031507SMESG000049972.1 SMESG000031902.1 dd_Smed_v4_13890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031507SMESG000049972.1 SMESG000031902.1 dd_Smed_v4_13890_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031507SMESG000072824.1 SMESG000049972.1 SMESG000031902.1 SMED30031507smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30031507SMESG000072824.1 SMESG000049972.1 SMESG000031902.1 SMED30031507smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30031507SMESG000049972.1 SMESG000031902.1 dd_Smed_v4_13890_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Human
Match: ZNF333 (zinc finger protein 333 [Source:HGNC Symbol;Acc:HGNC:15624])

HSP 1 Score: 104.375 bits (259), Expect = 1.399e-22
Identity = 78/281 (27.76%), Postives = 116/281 (41.28%), Query Frame = 2
Query:  425 QNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHE-LREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEI 1264
            Q C + F ++++L +H +     K F C QC   F     L LH +R H    KP        Y C    DC    N   +   H+R H+G+KPFEC  C K F +++++KTH   H  EK + C+ C K F+T      H R    E L E             C  C +   +L  +++HM+      E  + C  C   F +   L+KH + H      AC  C       + Q +H I    +    R   C  CE  F+  + +T H + +   E 
Sbjct:  397 QECGQAFKYSSNLRRHMRTHTGEKPFECSQCGKTFTRNFNLILH-QRNHTG-EKP--------YECK---DCGKAFNQPSSLRSHVRTHTGEKPFECSQCGKAFREHSSLKTHLRTHTREKPYECNQCGKPFRTSTHLNVHKRIHTGEKLYE-------------CATCGQVLSRLSTLKSHMRT--HTGEKPYVCQECGRAFSEPSSLRKHARTHSGKKPYACQECGR----AFGQSSHLIVHVRTHSAGRPYQCNQCEKAFRHSSSLTVHKRTHVGRET 645          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Human
Match: ZNF358 (zinc finger protein 358 [Source:HGNC Symbol;Acc:HGNC:16838])

HSP 1 Score: 93.2041 bits (230), Expect = 4.612e-19
Identity = 69/253 (27.27%), Postives = 100/253 (39.53%), Query Frame = 2
Query:  494 KIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRT----REHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHV 1240
            + F C  C   F   S L  H RR H    KP        Y C   PDC    ++G T   H   H+G +P++C  C K F   + +  HRS H  EK  +C +C K+F    +   HLRT    R H+                C  C + F +   +  H++      E  + C  C   FG    L +H + H       CP C +  F   + L HH+ R H+ +  R   C +C   F   + +  H+
Sbjct:  149 RPFSCPDCGRAFRRSSGLSQH-RRTHSG-EKP--------YRC---PDCGKSFSHGATLAQHRGIHTGARPYQCAACGKAFGWRSTLLKHRSSHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHK----------------CPVCAKGFGQGSALLKHLRT--HTGERPYPCPQCGKAFGQSSALLQHQRTHTAERPYRCPHCGK-AFGQSSNLQHHL-RIHTGE--RPYACPHCSKAFGQSSALLQHL 366          

HSP 2 Score: 88.1965 bits (217), Expect = 1.429e-17
Identity = 65/243 (26.75%), Postives = 94/243 (38.68%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREY--------FVEKVNFS---------VKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHK 1072
            SG+  Y C   +C K F+H  +L +H       + + C  C   F   S L  H R  H    KP        +HC   P C     +G     H+R H G +P +C +C K F Q + +  H   H  E+ + C  C K+F      L H RT   E R Y        F +  N               C  C++ F +   +  H+ V     E  ++C +C   FG    L KH + H+
Sbjct:  174 SGEKPYRC--PDCGKSFSHGATLAQHRGIHTGARPYQCAACGKAFGWRSTLLKH-RSSHSG-EKP--------HHC---PVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPCPQCGKAFGQSSALLQHQRTHTAE-RPYRCPHCGKAFGQSSNLQHHLRIHTGERPYACPHCSKAFGQSSALLQHLHV--HSGERPYRCQLCGKAFGQASSLTKHKRVHE 398          

HSP 3 Score: 71.2478 bits (173), Expect = 3.443e-12
Identity = 54/218 (24.77%), Postives = 82/218 (37.61%), Query Frame = 2
Query:  692 SGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTEL 1345
            S  +PF C  C + F +++ +  HR  H  EK + C  C KSF +H   LA  R      R Y            C  C + F     +  H        E    C +C   FG    L +H++ H       CP+C + GF   + L  H+ R H+ +  R   C  C   F   + +  H + + A              + CP+ G  F  ++ L
Sbjct:  146 SPPRPFSCPDCGRAFRRSSGLSQHRRTHSGEKPYRCPDCGKSF-SHGATLAQHRGIHTGARPY-----------QCAACGKAFGWRSTLLKHRS--SHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAK-GFGQGSALLKHL-RTHTGE--RPYPCPQCGKAFGQSSALLQHQRTHTAERP-----------YRCPHCGKAFGQSSNL 334          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Human
Match: ZBTB11 (zinc finger and BTB domain containing 11 [Source:HGNC Symbol;Acc:HGNC:16740])

HSP 1 Score: 92.4337 bits (228), Expect = 1.198e-18
Identity = 62/243 (25.51%), Postives = 103/243 (42.39%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCH 1159
            C K F    SL +H         ++C  C   FH  S L  H ++        PK P    YHCT    C            H+  H G KPF+C  C K ++   +  +H   H   + + C+IC K F    ++  H++   H  +     +   +++ +C  C  +F +L + R HM   + +    F+C  C + + D   LK+H++ H       CP+C+E  ++    L  H+T+ H
Sbjct:  712 CVKSFVTKRSLQEHMSIHTGESKYLCSVCGKSFHRGSGLSKHFKKHQ------PK-PEVRGYHCT---QCEKSFFEARDLRQHMNKHLGVKPFQCQFCDKCYSWKKDWYSHVKSHSVTEPYRCNICGKEFYEKALFRRHVKKATHGKKG----RAKQNLERVCEKCGRKFTQLREYRRHMN--NHEGVKPFECLTCGVAWADARSLKRHVRTHTGERPYVCPVCSE-AYIDARTLRKHMTKFH 937          

HSP 2 Score: 61.6178 bits (148), Expect = 4.718e-9
Identity = 64/243 (26.34%), Postives = 95/243 (39.09%), Query Frame = 2
Query:  677 HIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLE-SMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFS------CPYEGCKFTSNTELLITSHIERHENGK 1384
            H+  H+G KP  C +C K F     +K H+S H S+K F C++C KSF T      H+     E             K +C  C + F +   +  H K    K E   + C+ C+  F +  +L++H+  H       C  C++      +  +H   + HS  V+    C  C   F  +     HVK         + +HG  GR        C   G KFT   E     H+  HE  K
Sbjct:  669 HMLKHTGVKPHACQVCGKTFIYKHGLKLHQSLHQSQKQFQCELCVKSFVTKRSLQEHMSIHTGE------------SKYLCSVCGKSFHRGSGLSKHFKKHQPKPEVRGYHCTQCEKSFFEARDLRQHMNKHLGVKPFQCQFCDKCYSWKKDWYSH--VKSHS--VTEPYRCNICGKEFYEKALFRRHVK---------KATHGKKGRAKQNLERVCEKCGRKFTQLREY--RRHMNNHEGVK 884          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Human
Match: ZNF57 (zinc finger protein 57 [Source:HGNC Symbol;Acc:HGNC:13125])

HSP 1 Score: 91.2781 bits (225), Expect = 1.721e-18
Identity = 72/283 (25.44%), Postives = 120/283 (42.40%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVK 1243
            +G+  Y C  Q+C K F +  +  +H K     K + C+QC   F     L +H R    D            Y C +   C     +  +F+ H+R H+G+KP+EC  C K FT ++  + H   H  E+L+ C+ C K+F +   +  HLRT   E                C  C + F      R H+++  Q  E + KC  C   F      + H++ H       C  C +  F   + L++H+ R H+ +   K  C+ C + F+  +   +H++
Sbjct:  277 TGEKPYKC--QHCGKAFTYPQAFQRHEKTHTGEKPYECKQCGKTFSWSETLRVHMRIHTGDKL----------YKCEH---CGKAFTSSRSFQGHLRTHTGEKPYECKQCGKAFTWSSTFREHVRIHTQEQLYKCEQCGKAFTSSRSFRGHLRTHTGE------------KPYECKQCGKTFTWSSTFREHVRIHTQ--EQLHKCEHCGKAFTSSRAFQGHLRMHTGEKPYECKQCGKT-FTWSSTLHNHV-RMHTGEKPHK--CKQCGMSFKWHSSFRNHLR 526          

HSP 2 Score: 75.0998 bits (183), Expect = 2.034e-13
Identity = 69/290 (23.79%), Postives = 108/290 (37.24%), Query Frame = 2
Query:  425 QNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTR--------EHELREYFVEKVNFSVKVI---------CLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVK 1243
            Q C + F H   L+ H K     K + C QC   F+  +    H R    D  +P        Y C    +C        TF+ H+  H+G+KP++C  C K FT     + H   H  EK + C  C K+F   +    H+R          EH   + F    +F   +          C  C + F      R H+++  Q  E ++KC  C   F      + H++ H       C  C +  F   +    H+ R H+ +   K  C +C   F +      H++
Sbjct:  201 QACGQTFQHPRYLSHHVKTHTAEKTYKCEQCRMAFNGFASFTRHVRTHTKD--RP--------YKC---QECGRAFIYPSTFQRHMTTHTGEKPYKCQHCGKAFTYPQAFQRHEKTHTGEKPYECKQCGKTFSWSETLRVHMRIHTGDKLYKCEH-CGKAFTSSRSFQGHLRTHTGEKPYECKQCGKAFTWSSTFREHVRIHTQ--EQLYKCEQCGKAFTSSRSFRGHLRTHTGEKPYECKQCGKT-FTWSSTFREHV-RIHTQEQLHK--CEHCGKAFTSSRAFQGHLR 470          

HSP 3 Score: 56.9954 bits (136), Expect = 8.615e-8
Identity = 61/277 (22.02%), Postives = 99/277 (35.74%), Query Frame = 2
Query:  461 LTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTRE-------HELREYFVEKVNFSVKVI---------CLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVK 1243
            LT H K     K + C +C  +F  LS L  H +  H   + PP +            +C            H R  + +KP++C  C + F     +  H   H +EK + C+ C+ +F     +  H+RT          E    F+    F   +          C  C + F      + H K      E  ++C  C   F   E L+ H++ H    L  C  C +  F        H+ R H+ +  +   C+ C   F   +   +HV+
Sbjct:  129 LTLHKKVSAGEKPYECTKCRTVFTHLSSLKRHVK-SHCGRKAPPGE------------ECKQACICPSHLHSHGRTDTEEKPYKCQACGQTFQHPRYLSHHVKTHTAEKTYKCEQCRMAFNGFASFTRHVRTHTKDRPYKCQECGRAFIYPSTFQRHMTTHTGEKPYKCQHCGKAFTYPQAFQRHEKT--HTGEKPYECKQCGKTFSWSETLRVHMRIHTGDKLYKCEHCGK-AFTSSRSFQGHL-RTHTGE--KPYECKQCGKAFTWSSTFREHVR 386          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Human
Match: ZNF497 (zinc finger protein 497 [Source:HGNC Symbol;Acc:HGNC:23714])

HSP 1 Score: 90.8929 bits (224), Expect = 1.842e-18
Identity = 89/343 (25.95%), Postives = 133/343 (38.78%), Query Frame = 2
Query:  293 IKFNSDESLHQPILRNDKEYAFVEKDGGFSL--------EEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHE-------------LREYFVE--KVNFSVKV-ICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEY 1249
              ++S+ S HQ I   +K YA  E    F          E  SG   + C   +C K F  + +L +H +     K + C +C   F   +  FL  RR H   R     P   R       DC    +       H++ H+G +P  C  C K F + A ++ HR  H SEK F C  C K+F+     L H RT   E             +  Y  E  +V+   K   C  C + F +  ++ +H +         F C+ C   F     L  H  +H      AC  C +  F   ++L  H  R HS +  R  VC +C   F  ++E+  H + +
Sbjct:  143 FAWSSNLSQHQRIHSGEKPYACRECGKAFRAHSQLIHHQETHSGLKPFRC--PDCGKSFGRSTTLVQHRRTHTGEKPYECPECGKAF-SWNSNFLEHRRVHTGAR-----PHACR-------DCGKAFSQSSNLAEHLKIHAGARPHACPDCGKAFVRVAGLRQHRRTHSSEKPFPCAECGKAFRESSQLLQHQRTHTGERPFECAECGQAFVMGSYLAEHRRVHTGEKPHACAQCGKAFSQRSNLLSHRRT--HSGAKPFACADCGKAFRGSSGLAHHRLSHTGERPFACAECGK-AFRGSSELRQH-QRLHSGE--RPFVCAHCSKAFVRKSELLSHRRTH 464          

HSP 2 Score: 88.1965 bits (217), Expect = 1.106e-17
Identity = 79/318 (24.84%), Postives = 124/318 (38.99%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKV-ICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTEL 1345
            +G+  Y C    C K F  +++L++H +     K + CR+C   F   S+L  H  +E     KP        + C   PDC        T   H R H+G+KP+EC  C K F+ N+N   HR  H   +   C  C K+F        HL             K++   +   C  C + F ++  +R H +      E  F C+ C   F +  +L +H + H       C  C +  FV  + L  H  R H+ +  +   C  C   F   + +  H           R++H     F+C   G  F  ++ L
Sbjct:  129 TGEKPYTC--PECGKAFAWSSNLSQHQRIHSGEKPYACRECGKAFRAHSQLIHH--QETHSGLKP--------FRC---PDCGKSFGRSTTLVQHRRTHTGEKPYECPECGKAFSWNSNFLEHRRVHTGARPHACRDCGKAFSQSSNLAEHL-------------KIHAGARPHACPDCGKAFVRVAGLRQHRRT--HSSEKPFPCAECGKAFRESSQLLQHQRTHTGERPFECAECGQ-AFVMGSYLAEH-RRVHTGE--KPHACAQCGKAFSQRSNLLSH-----------RRTHSGAKPFACADCGKAFRGSSGL 401          

HSP 3 Score: 64.6994 bits (156), Expect = 3.396e-10
Identity = 61/255 (23.92%), Postives = 95/255 (37.25%), Query Frame = 2
Query:  563 REHVDPRKPPKD--------PSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYF-----VEKVNFSVKVI-------------CLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEY 1249
            R+   PR  P D        P +    C    +C    + G     H R H+G+KP+ C  C K F  ++N+  H+  H  EK + C  C K+F+ H   + H  T  H   + F      +    S  ++             C  C + F    +   H +V          C  C   F     L +H+K H  +   ACP C +  FV    L  H  R HS +  +   C  C   F+  +++  H + +
Sbjct:   81 RDGAGPRSEPADRALRPSPLPEEPGCRCG---ECGKAFSQGSYLLQHRRVHTGEKPYTCPECGKAFAWSSNLSQHQRIHSGEKPYACRECGKAFRAHSQLIHHQET--HSGLKPFRCPDCGKSFGRSTTLVQHRRTHTGEKPYECPECGKAFSWNSNFLEHRRV--HTGARPHACRDCGKAFSQSSNLAEHLKIHAGARPHACPDCGK-AFVRVAGLRQH-RRTHSSE--KPFPCAECGKAFRESSQLLQHQRTH 324          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Celegans
Match: fezf-1 (FEZ Family zinc finger protein [Source:UniProtKB/TrEMBL;Acc:O62425])

HSP 1 Score: 83.1889 bits (204), Expect = 7.870e-18
Identity = 66/206 (32.04%), Postives = 92/206 (44.66%), Query Frame = 2
Query:  356 FVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMK 973
            F E   G   ++ + + K+ C I  C KQFN   +LT+H       + FVC+ C   F + S L  H +  H D +     P K +        C    N   T   H+R H G KPF C+IC K F QN N K HR  H   K F+C IC ++F  H  Y        HE  + F           C  C++ FC+ FD++ H++
Sbjct:   37 FAESSSG---DDENSRKKFPCEI--CGKQFNAHYNLTRHMPVHTGERPFVCKVCGKAFRQASTLCRH-KIIHTDSK-----PHKCK-------TCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAF--HQSYNLAFHMFTHEEHKPFT----------CHVCSKGFCRNFDLKKHLR 212          

HSP 2 Score: 48.9062 bits (115), Expect = 3.631e-6
Identity = 46/199 (23.12%), Postives = 78/199 (39.20%), Query Frame = 2
Query:  692 SGD-----KPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIY----LAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANE 1261
            SGD     K F C+IC K+F  + N+  H   H  E+ F C +C K+F+         + H  ++ H+                C  C + F +   +  H+++  Q  +  F C IC   F      K H   H+++   +C IC+      YN   H  T     +  +   C  C   F    ++  H+++ H  +
Sbjct:   42 SGDDENSRKKFPCEICGKQFNAHYNLTRHMPVHTGERPFVCKVCGKAFRQASTLCRHKIIHTDSKPHK----------------CKTCGKCFNRSSTLNTHVRI-HQGFKP-FVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRAFHQSYNLAFHMFTH----EEHKPFTCHVCSKGFCRNFDLKKHLRKMHMTQ 218          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058845:1063187:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 80.8777 bits (198), Expect = 1.590e-15
Identity = 58/246 (23.58%), Postives = 108/246 (43.90%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIK 1168
            C K  +  ++L  H K  H  K F C  CP  F   + L LH ++ H        + ++ ++ C Y   CN      G+ + H+R H+G++P+ C  C K F    N+++H   H  E+ ++C  C+++F       AH  T  H  +++ V   + +  ++ +  +              V D ++   ++C+ C+  +     L  H++ H E    +C  C +P +     LN H  +C + K
Sbjct:  194 CDKLLSSPSALYTH-KKTHGDKTFRCDFCPKTFALKNYLKLHVKQVH--------EQNERKHVCVY---CNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHEST--HLTQKHSVNPDSTTADILPVAGS--------------VTDHQMVGNYECTFCNKKYPYASSLYIHMRKHTEKSAYSCDGCGKP-YSQKISLNIHQDQCEAFK 410          

HSP 2 Score: 76.6406 bits (187), Expect = 3.125e-14
Identity = 52/192 (27.08%), Postives = 81/192 (42.19%), Query Frame = 2
Query:  668 FEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKES--MLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDH 1237
             E H R+H+G+KP+ C  C K F Q A ++ H   H  E+ + C  C+K+F  +     H ++    +R Y            C  C++       +  H K    K    F+C  C   F     LK H+K   E       C  CN+ GF +   L  H+ R H+ +  R  VC++C   F ++  +  H
Sbjct:  119 LESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNY-----------KCPKCDKLLSSPSALYTHKKTHGDK---TFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNK-GFAYAGSLQVHV-RTHTGE--RPYVCKFCPKAFASQGNLQSH 292          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Celegans
Match: Y55F3AM.14 (pep chromosome:WBcel235:IV:1058695:1067525:-1 gene:WBGene00021931.1 transcript:Y55F3AM.14.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y55F3AM.14)

HSP 1 Score: 80.8777 bits (198), Expect = 1.590e-15
Identity = 58/246 (23.58%), Postives = 108/246 (43.90%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIK 1168
            C K  +  ++L  H K  H  K F C  CP  F   + L LH ++ H        + ++ ++ C Y   CN      G+ + H+R H+G++P+ C  C K F    N+++H   H  E+ ++C  C+++F       AH  T  H  +++ V   + +  ++ +  +              V D ++   ++C+ C+  +     L  H++ H E    +C  C +P +     LN H  +C + K
Sbjct:  194 CDKLLSSPSALYTH-KKTHGDKTFRCDFCPKTFALKNYLKLHVKQVH--------EQNERKHVCVY---CNKGFAYAGSLQVHVRTHTGERPYVCKFCPKAFASQGNLQSHERTHTGERPYSCQFCQRTFIQKSQLTAHEST--HLTQKHSVNPDSTTADILPVAGS--------------VTDHQMVGNYECTFCNKKYPYASSLYIHMRKHTEKSAYSCDGCGKP-YSQKISLNIHQDQCEAFK 410          

HSP 2 Score: 76.6406 bits (187), Expect = 3.125e-14
Identity = 52/192 (27.08%), Postives = 81/192 (42.19%), Query Frame = 2
Query:  668 FEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKES--MLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDH 1237
             E H R+H+G+KP+ C  C K F Q A ++ H   H  E+ + C  C+K+F  +     H ++    +R Y            C  C++       +  H K    K    F+C  C   F     LK H+K   E       C  CN+ GF +   L  H+ R H+ +  R  VC++C   F ++  +  H
Sbjct:  119 LESHKRSHTGEKPYNCHFCQKTFAQKATLQVHERTHTGERPYKCRYCEKTFAQYGTKTVHEKSAHLGIRNY-----------KCPKCDKLLSSPSALYTHKKTHGDK---TFRCDFCPKTFALKNYLKLHVKQVHEQNERKHVCVYCNK-GFAYAGSLQVHV-RTHTGE--RPYVCKFCPKAFASQGNLQSH 292          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 71.633 bits (174), Expect = 1.248e-12
Identity = 45/155 (29.03%), Postives = 66/155 (42.58%), Query Frame = 2
Query:  602 SKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKN 1066
             K RY C    DCN         + H+R H+G++PF+C+IC K FTQ A+++ H   H  E+   CDIC K F +      HLR              N      C  C+ +F +   +R H ++     E  + C  C   +     L+ H K 
Sbjct:  504 GKTRYACK---DCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLH------------NGQKPYTCDVCDAKFTQYVHLRLHKRL--HANERPYSCGTCGKKYISPSGLRTHWKT 641          

HSP 2 Score: 63.929 bits (154), Expect = 2.784e-10
Identity = 40/157 (25.48%), Postives = 73/157 (46.50%), Query Frame = 2
Query:  386 EEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRT 856
            ++ +GK +Y C  ++C K F   ++L  H +     + F C  C   F +L+ L  H    H   R          + C     C+   ++    + H+R H+G KP+ CD+C  +FTQ  +++ H+  H +E+ ++C  C K + +      H +T
Sbjct:  500 QQENGKTRYAC--KDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKH-HLVHTGERP---------HRCDI---CDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWKT 641          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 71.633 bits (174), Expect = 1.311e-12
Identity = 45/155 (29.03%), Postives = 66/155 (42.58%), Query Frame = 2
Query:  602 SKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKN 1066
             K RY C    DCN         + H+R H+G++PF+C+IC K FTQ A+++ H   H  E+   CDIC K F +      HLR              N      C  C+ +F +   +R H ++     E  + C  C   +     L+ H K 
Sbjct:  504 GKTRYACK---DCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHLRLH------------NGQKPYTCDVCDAKFTQYVHLRLHKRL--HANERPYSCGTCGKKYISPSGLRTHWKT 641          

HSP 2 Score: 63.929 bits (154), Expect = 2.879e-10
Identity = 40/157 (25.48%), Postives = 73/157 (46.50%), Query Frame = 2
Query:  386 EEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRT 856
            ++ +GK +Y C  ++C K F   ++L  H +     + F C  C   F +L+ L  H    H   R          + C     C+   ++    + H+R H+G KP+ CD+C  +FTQ  +++ H+  H +E+ ++C  C K + +      H +T
Sbjct:  500 QQENGKTRYAC--KDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKH-HLVHTGERP---------HRCDI---CDKRFSSTSNLKTHLRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTHWKT 641          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Fly
Match: CG12299 (gene:FBgn0032295 transcript:FBtr0080113)

HSP 1 Score: 95.1301 bits (235), Expect = 6.343e-20
Identity = 77/294 (26.19%), Postives = 130/294 (44.22%), Query Frame = 2
Query:  557 ARREHVDPRKPPKDPS----KYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRT----REHELREYFVEKVNFSVKV-------------ICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHE 1375
             RR ++    P  DP+    +  + CT+   C     N G    H+R+H  +KPF+C IC K FT   ++ TH   H  EK + C++C K+F      + H+R+    + H+  +     +N+S  +             IC  C  +F     +  HM++  Q+L  +++C+IC   F    EL +H+KNH       C +C+   F     LN H+ R H+ +  +   C+ C+  F   + ++ H+K  HA E            + CP  G  ++    L    HI+ H+
Sbjct:  233 GRRSNIG--APVMDPALNGNQKCFQCTH---CEASFPNAGDLSKHVRSHITNKPFQCSICQKTFTHIGSLNTHIRIHSGEKPYKCELCPKAFTQSSSLMVHMRSHSVRKPHQCVQCDKGFINYSSLLLHQKTHIAPTETFICPECEREFKAEALLDEHMRMHTQEL--VYQCAICREAFRASSELVQHMKNHMGEKPFTCSLCDR-SFTQSGSLNIHM-RIHTGE--KPFQCKLCDKCFTQASSLSVHMK-IHAGE----------KPYPCPICGKSYSQQAYL--NKHIQAHQ 502          

HSP 2 Score: 82.8037 bits (203), Expect = 4.446e-16
Identity = 75/303 (24.75%), Postives = 118/303 (38.94%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAH-SGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIK------------VSRKS----VCRYCELIFQTETEMTDHVKEYHANEINSRKSHGI 1288
            C K F H  SL  H +     K + C  CP  F + S L +H R   V  RKP        + C     C+    N  +   H + H +  + F C  C + F   A +  H   H  E ++ C IC+++F+     + H++        +  EK        C  C+  F +   +  HM++     E  F+C +CD  F     L  H+K H       CPIC +  +     LN HI + H +             V+++     VC  C  +    T +  HV   HA  +++ K  G+
Sbjct:  287 CQKTFTHIGSLNTHIRIHSGEKPYKCELCPKAFTQSSSLMVHMRSHSV--RKP--------HQCV---QCDKGFINYSSLLLHQKTHIAPTETFICPECEREFKAEALLDEHMRMHTQELVYQCAICREAFRASSELVQHMKN-------HMGEK-----PFTCSLCDRSFTQSGSLNIHMRI--HTGEKPFQCKLCDKCFTQASSLSVHMKIHAGEKPYPCPICGK-SYSQQAYLNKHI-QAHQMASAASASTSPGLLVAKQPHETLVCIVCGSLHADATALASHVHSQHAALLDTMKQSGM 560          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Fly
Match: su(Hw) (gene:FBgn0003567 transcript:FBtr0082945)

HSP 1 Score: 93.9745 bits (232), Expect = 1.838e-19
Identity = 74/298 (24.83%), Postives = 126/298 (42.28%), Query Frame = 2
Query:  410 YICHIQNCYKQFNHANSLTKH--YKDC--HDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESM--LIACPICNE----PGFV--HYNQLNHHITRCHS-----IKVSRKSVCRYCELIFQTETEMTDHVKEYH 1252
            Y C I  C K F  +  L +H  Y  C  ++     C+ C  +F+ L  L     R H+      +   K  Y C    +C Y  +   T   HIR H+G+KPF+CD+C K+F+    +K HR  H  EK ++C +C ++F   ++   H++    E                C  C + F +   +R H K   +     F C  CD  F   ++L++H+K H  +   + +C  C      P  +  H ++  H   +  S     +K+  ++ C  C+  F +   +  H++  H
Sbjct:  348 YACKI--CGKDFTRSYHLKRHQKYSSCSSNETDTMSCKVCDRVFYRLDNL-----RSHLKQHLGTQVVKKPEYMCHTCKNCFYSLS---TLNIHIRTHTGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQAFAVKEVLNRHMKRHTGERPHK------------CDECGKSFIQATQLRTHSKTHIRP----FPCEQCDEKFKTEKQLERHVKTHSRTKRPVFSCAECKRNFRTPALLKEHMDEGKHSPKQQRSSMRSAVKIMERTDCAICDKNFDSSDTLRRHIRTVH 619          

HSP 2 Score: 61.6178 bits (148), Expect = 2.018e-9
Identity = 69/271 (25.46%), Postives = 102/271 (37.64%), Query Frame = 2
Query:  638 CNYMTNNGGTFEHHIRAH-SGDKPFECDICHKRFTQNANMKTHRSRHV----SEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHIT-----------------------RCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIE 1366
            CN    +      H   H S  KP+ C IC K FT++ ++K H+             +C +C + F   D   +HL+     L    V+K  +    +C  C   F  L  +  H++      E  F C +CD  F     LKKH + H      +C +CN+  F     LN H+                        R HS    R   C  C+  F+TE ++  HVK +      SR    +   FSC    CK    T  L+  H++
Sbjct:  324 CNANLRSEALLALHEEQHKSRGKPYACKICGKDFTRSYHLKRHQKYSSCSSNETDTMSCKVCDRVFYRLDNLRSHLK---QHLGTQVVKKPEY----MCHTCKNCFYSLSTLNIHIRT--HTGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQ-AFAVKEVLNRHMKRHTGERPHKCDECGKSFIQATQLRTHSKTHIRPFPCEQCDEKFKTEKQLERHVKTH------SRTKRPV---FSCAE--CKRNFRTPALLKEHMD 573          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Fly
Match: su(Hw) (gene:FBgn0003567 transcript:FBtr0082946)

HSP 1 Score: 93.9745 bits (232), Expect = 1.838e-19
Identity = 74/298 (24.83%), Postives = 126/298 (42.28%), Query Frame = 2
Query:  410 YICHIQNCYKQFNHANSLTKH--YKDC--HDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESM--LIACPICNE----PGFV--HYNQLNHHITRCHS-----IKVSRKSVCRYCELIFQTETEMTDHVKEYH 1252
            Y C I  C K F  +  L +H  Y  C  ++     C+ C  +F+ L  L     R H+      +   K  Y C    +C Y  +   T   HIR H+G+KPF+CD+C K+F+    +K HR  H  EK ++C +C ++F   ++   H++    E                C  C + F +   +R H K   +     F C  CD  F   ++L++H+K H  +   + +C  C      P  +  H ++  H   +  S     +K+  ++ C  C+  F +   +  H++  H
Sbjct:  348 YACKI--CGKDFTRSYHLKRHQKYSSCSSNETDTMSCKVCDRVFYRLDNL-----RSHLKQHLGTQVVKKPEYMCHTCKNCFYSLS---TLNIHIRTHTGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQAFAVKEVLNRHMKRHTGERPHK------------CDECGKSFIQATQLRTHSKTHIRP----FPCEQCDEKFKTEKQLERHVKTHSRTKRPVFSCAECKRNFRTPALLKEHMDEGKHSPKQQRSSMRSAVKIMERTDCAICDKNFDSSDTLRRHIRTVH 619          

HSP 2 Score: 61.6178 bits (148), Expect = 2.018e-9
Identity = 69/271 (25.46%), Postives = 102/271 (37.64%), Query Frame = 2
Query:  638 CNYMTNNGGTFEHHIRAH-SGDKPFECDICHKRFTQNANMKTHRSRHV----SEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHIT-----------------------RCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIE 1366
            CN    +      H   H S  KP+ C IC K FT++ ++K H+             +C +C + F   D   +HL+     L    V+K  +    +C  C   F  L  +  H++      E  F C +CD  F     LKKH + H      +C +CN+  F     LN H+                        R HS    R   C  C+  F+TE ++  HVK +      SR    +   FSC    CK    T  L+  H++
Sbjct:  324 CNANLRSEALLALHEEQHKSRGKPYACKICGKDFTRSYHLKRHQKYSSCSSNETDTMSCKVCDRVFYRLDNLRSHLK---QHLGTQVVKKPEY----MCHTCKNCFYSLSTLNIHIRT--HTGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQ-AFAVKEVLNRHMKRHTGERPHKCDECGKSFIQATQLRTHSKTHIRPFPCEQCDEKFKTEKQLERHVKTH------SRTKRPV---FSCAE--CKRNFRTPALLKEHMD 573          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Fly
Match: su(Hw) (gene:FBgn0003567 transcript:FBtr0310002)

HSP 1 Score: 93.9745 bits (232), Expect = 1.838e-19
Identity = 74/298 (24.83%), Postives = 126/298 (42.28%), Query Frame = 2
Query:  410 YICHIQNCYKQFNHANSLTKH--YKDC--HDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESM--LIACPICNE----PGFV--HYNQLNHHITRCHS-----IKVSRKSVCRYCELIFQTETEMTDHVKEYH 1252
            Y C I  C K F  +  L +H  Y  C  ++     C+ C  +F+ L  L     R H+      +   K  Y C    +C Y  +   T   HIR H+G+KPF+CD+C K+F+    +K HR  H  EK ++C +C ++F   ++   H++    E                C  C + F +   +R H K   +     F C  CD  F   ++L++H+K H  +   + +C  C      P  +  H ++  H   +  S     +K+  ++ C  C+  F +   +  H++  H
Sbjct:  348 YACKI--CGKDFTRSYHLKRHQKYSSCSSNETDTMSCKVCDRVFYRLDNL-----RSHLKQHLGTQVVKKPEYMCHTCKNCFYSLS---TLNIHIRTHTGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQAFAVKEVLNRHMKRHTGERPHK------------CDECGKSFIQATQLRTHSKTHIRP----FPCEQCDEKFKTEKQLERHVKTHSRTKRPVFSCAECKRNFRTPALLKEHMDEGKHSPKQQRSSMRSAVKIMERTDCAICDKNFDSSDTLRRHIRTVH 619          

HSP 2 Score: 61.6178 bits (148), Expect = 2.018e-9
Identity = 69/271 (25.46%), Postives = 102/271 (37.64%), Query Frame = 2
Query:  638 CNYMTNNGGTFEHHIRAH-SGDKPFECDICHKRFTQNANMKTHRSRHV----SEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHIT-----------------------RCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIE 1366
            CN    +      H   H S  KP+ C IC K FT++ ++K H+             +C +C + F   D   +HL+     L    V+K  +    +C  C   F  L  +  H++      E  F C +CD  F     LKKH + H      +C +CN+  F     LN H+                        R HS    R   C  C+  F+TE ++  HVK +      SR    +   FSC    CK    T  L+  H++
Sbjct:  324 CNANLRSEALLALHEEQHKSRGKPYACKICGKDFTRSYHLKRHQKYSSCSSNETDTMSCKVCDRVFYRLDNLRSHLK---QHLGTQVVKKPEY----MCHTCKNCFYSLSTLNIHIRT--HTGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQ-AFAVKEVLNRHMKRHTGERPHKCDECGKSFIQATQLRTHSKTHIRPFPCEQCDEKFKTEKQLERHVKTH------SRTKRPV---FSCAE--CKRNFRTPALLKEHMD 573          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Fly
Match: crol (gene:FBgn0020309 transcript:FBtr0335473)

HSP 1 Score: 87.0409 bits (214), Expect = 2.644e-17
Identity = 74/275 (26.91%), Postives = 115/275 (41.82%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSP-DCNYMTNNGGTFEH---HIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVK 1243
            C+  F +  SL +H K     K F C  C   F         AR+EH+D        + +R H   +P  C Y        EH   H+R H+G  P +CD+C K++T+  ++  H   H +E  F C+IC KSF           +R+     + +          C  C++ F +   + NH++      ES  +CS C   F   E L  HI+ H       C  C +  F     L +H+ R H+     +  C YC+  F  +  +T+HV+
Sbjct:  282 CFNVFANNTSLERHMKRHSTDKPFACTICQKTF---------ARKEHLD--------NHFRSHTGETPFRCQYCAKTFTRKEHMVNHVRKHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGKSF-----------SRKEHFTNHILWHTAGETPHRCDFCSKTFTRKEHLLNHVR--QHTGESPHRCSYCMKTFTRKEHLVNHIRQHTGESPHKCTYCTK-TFTRKEHLTNHV-RQHTGDSPHR--CSYCKKTFTRKEHLTNHVR 522          

HSP 2 Score: 63.929 bits (154), Expect = 4.417e-10
Identity = 63/226 (27.88%), Postives = 91/226 (40.27%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSP-DCNYMTNNGGTFEH---HIRAHSGDKPFECDICHKRFTQNANMKTHRSR-HVSEKLFNCDICKKSFKTHDIYLAHLR--TREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIK-NHKESML 1084
            C K F     LT H +         C  C   F          R+EH+         +  R H   SP  C Y        EH   H+R HS D P  C++C+K FT+  ++  H SR H  ++ F C+ C KSF      L H R  T+  E+   F           C  C + F     + +HM+      E    C++C   F +   LK+H+K NH ++M+
Sbjct:  479 CTKTFTRKEHLTNHVRQHTGDSPHRCSYCKKTF---------TRKEHLT--------NHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHMSRCHTGDRPFTCETCGKSFPLKGNLLFHQRSHTKGQEMERPFA----------CEKCPKNFICKGHLVSHMR--SHSGEKPHACTLCSKAFVERGNLKRHMKMNHPDAMM 675          

HSP 3 Score: 62.003 bits (149), Expect = 1.622e-9
Identity = 63/243 (25.93%), Postives = 94/243 (38.68%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCK----LFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHI 1147
            C K F     L  H +         C  C   F     L  H R+   D        S +R  C+Y   C           +H+R H+GD P +C+ C K FT+  ++  H  +H S+    C++C K F   +  + H+ +R H     F           C  C + F      LF  R+H K   Q++E  F C  C   F     L  H+++H      AC +C++  FV    L  H+
Sbjct:  451 CMKTFTRKEHLVNHIRQHTGESPHKCTYCTKTFTRKEHLTNHVRQHTGD--------SPHR--CSY---CKKTFTRKEHLTNHVRLHTGDSPHKCEYCQKTFTRKEHLNNHMRQHSSDNPHCCNVCNKPFTRKEHLINHM-SRCHTGDRPFT----------CETCGKSFPLKGNLLFHQRSHTK--GQEMERPFACEKCPKNFICKGHLVSHMRSHSGEKPHACTLCSK-AFVERGNLKRHM 666          

HSP 4 Score: 59.6918 bits (143), Expect = 7.965e-9
Identity = 57/249 (22.89%), Postives = 98/249 (39.36%), Query Frame = 2
Query:  503 VCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEY 1249
            VC  C  +F    +L +H RR H + RKP        + C     C            H + H G   F C +C   F  N +++ H  RH ++K F C IC+K+F   +    H R+   E                C  C + F +   + NH++      ++  +C +C   +   E L  H+++H       C IC +  F       +HI    + +   +  C +C   F  +  + +HV+++
Sbjct:  222 VCDICGKMFQFRYQLIVH-RRYHSE-RKP--------FMCQV---CGQGFTTSQDLTRHGKIHIGGPMFTCIVCFNVFANNTSLERHMKRHSTDKPFACTICQKTFARKEHLDNHFRSHTGE------------TPFRCQYCAKTFTRKEHMVNHVR--KHTGQTPHQCDVCGKKYTRKEHLANHMRSHTNETPFRCEICGK-SFSRKEHFTNHILWHTAGETPHR--CDFCSKTFTRKEHLLNHVRQH 440          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Zebrafish
Match: si:cabz01032454.3 (si:cabz01032454.3 [Source:ZFIN;Acc:ZDB-GENE-161017-73])

HSP 1 Score: 100.523 bits (249), Expect = 7.356e-22
Identity = 94/328 (28.66%), Postives = 136/328 (41.46%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREY--------FVEKVNFSVKV---------ICLGCNEQFCKLFDIRNHMKV-----------CD------QKL---------ESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEY 1249
            +G+  + C +  C K F H   L KH       K+F C+QC   F +   L +H +    D     + P    Y CT   +C+    +     HH+  H+G+KPF CD C K F QN+ +K H   H  EK ++CD C KSF  ++    H+R    E R Y        F +K N  V +          C  C ++F +L  ++ H++            C       QKL         E +F C  C   FG    LK H+K H E     C  C E GF   + LN H+ R HS + S    C  C   F  +  +  H++ +
Sbjct:  179 TGERPHACTV--CGKTFYHKQKLEKHMTVHTGEKLFDCQQCGKRFGQKDSLRIHMKLHTKDKPHAKEKP----YICT---ECDKAFASKSNLNHHMVTHTGEKPFSCDECGKSFGQNSKLKVHMRVHTKEKPYSCDQCGKSFSQNEKLKVHMRVHTKE-RPYTCPQCGKSFTQKENLKVHIRVHTGEKPFPCQECGKRFMQLHVLKEHLRTHTGEKPFACPQCSKTYCQKQKLKMHMTVHAKEKLFPCQQCGKRFGYRGSLKSHMKLHAEDKRHTCSQCGE-GFTMKSHLNSHM-RTHSGEPS--YSCTQCGKTFSRKYVLNCHMRTH 492          

HSP 2 Score: 75.0998 bits (183), Expect = 1.135e-13
Identity = 99/400 (24.75%), Postives = 157/400 (39.25%), Query Frame = 2
Query:  242 LEVLAEDSNDI-INGNVNIKFNSDESLHQPILRND-------KEYAFVEKDGGFSLEEVSG-------KVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQ----KLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGK 1384
            +  + E+S D+ I     +K    E     +L+ +       KE   +E     + +E S        K  +IC    C K FNH  +L  H +     + + C QC   F +  +L +H R   V  ++ P       Y C   P C        +   HIR H+G+KPF C  C KRF+Q   +K H + H  E+   C +C K+F        H +  E  +  +  EK+       C  C ++F +   +R HMK+  +      E  + C+ CD  F     L  H+  H      +C  C +  F   ++L  H+ R H+ +  +   C  C   F    ++  H++  H  E            ++CP  G  FT    L +  HI  H   K
Sbjct:    1 MAFIKEESEDLKIEDTFTVKQEDPEQTELMVLKEETQEMNEMKEKDQIETHQDLTTDEQSSCKRSPKTKSDFIC--SQCGKGFNHQPNLIVHMRIHTGERPYSCDQCGKSFSQNEKLKVHMR---VHTKERP-------YTC---PQCGKSFTQKESLNVHIRVHTGEKPFPCQHCGKRFSQLHALKEHVTIHTGERPHACTVCGKTF-------YHKQKLEKHMTVHTGEKL-----FDCQQCGKRFGQKDSLRIHMKLHTKDKPHAKEKPYICTECDKAFASKSNLNHHMVTHTGEKPFSCDECGK-SFGQNSKLKVHM-RVHTKE--KPYSCDQCGKSFSQNEKLKVHMR-VHTKERP----------YTCPQCGKSFTQKENLKV--HIRVHTGEK 356          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Zebrafish
Match: znf985 (zinc finger protein 985 [Source:ZFIN;Acc:ZDB-GENE-110914-127])

HSP 1 Score: 95.5153 bits (236), Expect = 9.037e-21
Identity = 79/283 (27.92%), Postives = 115/283 (40.64%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVK 1243
            +G+  ++C    C K F  A+SL KH +     K F C QC GI    S       R H    KP        + CT    C    N     +HH+R H+G+KPF C  C K F +++N+  H   H  EK   C +C KSF+       H+RT   E                C  C + F +  +   HM++     E  F C+ C   F     L KH++ H       C  C +  F   + LN HI R H+ +  +   C  C   F+  + +  H++
Sbjct:   88 TGEKPFMC--TQCGKSFRQASSLNKHMRIHTGEKPFTCTQC-GISFNCSSYLKQHMRIHTG-EKP--------FTCT---QCGKSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGE------------KPFTCTQCGKSFSQSSNFNLHMRI--HTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGK-SFNRSSHLNQHI-RIHTGE--KPITCTQCGKSFRQSSSLYKHMR 337          

HSP 2 Score: 63.5438 bits (153), Expect = 3.365e-10
Identity = 45/176 (25.57%), Postives = 70/176 (39.77%), Query Frame = 2
Query:  620 CTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHI 1147
            C     C  +  +    + H+  H+G+KPF C  C K F Q +++  H   H  EK F C  C  SF        H+R    E                C  C + F +  ++ +HM++     E  F C+ C   F     L +HI+ H     I C +C +  F   + L+ H+
Sbjct:   64 CFTCTQCGKILASKSKLKIHMIIHTGEKPFMCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGE------------KPFTCTQCGKSFNRSSNLDHHMRI--HTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGK-SFRQSSSLSKHM 224          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Zebrafish
Match: znf1026 (zinc finger protein 1026 [Source:ZFIN;Acc:ZDB-GENE-110913-157])

HSP 1 Score: 93.9745 bits (232), Expect = 3.779e-20
Identity = 80/284 (28.17%), Postives = 115/284 (40.49%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSV-CRYCELIFQTETEMTDHVK 1243
            +G+  ++C    C K F  A+SL KH +     K F C QC GI    S       R H    KP        + CT    C    N     +HH+R H+G+KPF C  C K F +++N+  H   H  EK   C +C KSF+       H+RT  H   + F           C  C + F +  +   HM++     E  F C+ C   F     L KH++ H       C  C +  F   + LN HI     I    K + C  C   F+  + +  H++
Sbjct:   88 TGEKPFMC--TQCGKSFRQASSLNKHMRIHTGEKPFTCTQC-GISFNCSSYLKQHMRIHTG-EKP--------FTCT---QCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRT--HTGEKPFT----------CTQCGKSFSQSSNFNLHMRI--HTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGK-SFNRSSHLNQHI----RIHTGEKPITCTQCGKSFRQSSSLYKHMR 337          

HSP 2 Score: 78.1814 bits (191), Expect = 7.220e-15
Identity = 73/285 (25.61%), Postives = 102/285 (35.79%), Query Frame = 2
Query:  290 NIKFNSDESLHQPILRNDKEYAFVEKDGGFSLEEVS----------GKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPG 1114
             I FN    L Q +  +  E  F     G S    S          G+  + C    C K FN +++L +H +     K   C  C   F + S L  H R       KP        + CT    C    +    F  H+R H+G+KPF C  C K F Q +++  H   H  EK F C  C KSF        H+R    E              + C  C + F +   +  HM++     E  F C+ C   F        H++ H     I C  C + G
Sbjct:  127 GISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSNLDHHMRIHTGEKPFTC--TQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTH--TGEKP--------FTCT---QCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGE------------KPITCTQCGKSFRQSSSLYKHMRI--HTGEKPFTCTQCGKSFSQSSNFNLHMRIHTGEKPITCTQCGKRG 382          

HSP 3 Score: 62.3882 bits (150), Expect = 8.130e-10
Identity = 46/176 (26.14%), Postives = 71/176 (40.34%), Query Frame = 2
Query:  620 CTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHI 1147
            C     C  +  +    + H+  H+G+KPF C  C K F Q +++  H   H  EK F C  C  SF        H+R   H   + F           C  C   F +  ++ +HM++     E  F C+ C   F     L +HI+ H     I C +C +  F   + L+ H+
Sbjct:   64 CFICTQCGKILASKSKLKIHMIIHTGEKPFMCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRI--HTGEKPFT----------CTQCGRSFNRSSNLDHHMRI--HTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGK-SFRQSSSLSKHM 224          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Zebrafish
Match: znf1026 (zinc finger protein 1026 [Source:ZFIN;Acc:ZDB-GENE-110913-157])

HSP 1 Score: 93.2041 bits (230), Expect = 5.554e-20
Identity = 73/251 (29.08%), Postives = 101/251 (40.24%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHI 1147
            +G+  ++C    C K F  A+SL KH +     K F C QC GI    S       R H    KP        + CT    C    N     +HH+R H+G+KPF C  C K F +++N+  H   H  EK   C +C KSF+       H+RT   E                C  C + F +  +   HM++     E  F C+ C   F     L KH++ H       C  C +  F   + LN HI
Sbjct:   88 TGEKPFMC--TQCGKSFRQASSLNKHMRIHTGEKPFTCTQC-GISFNCSSYLKQHMRIHTG-EKP--------FTCT---QCGRSFNRSSNLDHHMRIHTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTHTGE------------KPFTCTQCGKSFSQSSNFNLHMRI--HTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGK-SFNRSSHLNQHI 308          

HSP 2 Score: 65.0846 bits (157), Expect = 1.027e-10
Identity = 56/198 (28.28%), Postives = 75/198 (37.88%), Query Frame = 2
Query:  290 NIKFNSDESLHQPILRNDKEYAFVEKDGGFSLEEVS----------GKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLR 853
             I FN    L Q +  +  E  F     G S    S          G+  + C    C K FN +++L +H +     K   C  C   F + S L  H R       KP        + CT    C    +    F  H+R H+G+KPF C  C K F Q +++  H   H  EK F C  C KSF        H+R
Sbjct:  127 GISFNCSSYLKQHMRIHTGEKPFTCTQCGRSFNRSSNLDHHMRIHTGEKPFTC--TQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGKSFRQSSSLSKHMRTH--TGEKP--------FTCT---QCGKSFSQSSNFNLHMRIHTGEKPFTCTQCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIR 309          

HSP 3 Score: 62.7734 bits (151), Expect = 4.959e-10
Identity = 45/176 (25.57%), Postives = 69/176 (39.20%), Query Frame = 2
Query:  620 CTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHI 1147
            C     C  +  +    + H+  H+G+KPF C  C K F Q +++  H   H  EK F C  C  SF        H+R    E                C  C   F +  ++ +HM++     E  F C+ C   F     L +HI+ H     I C +C +  F   + L+ H+
Sbjct:   64 CFICTQCGKILASKSKLKIHMIIHTGEKPFMCTQCGKSFRQASSLNKHMRIHTGEKPFTCTQCGISFNCSSYLKQHMRIHTGE------------KPFTCTQCGRSFNRSSNLDHHMRI--HTGEKPFTCTQCGKSFNRSSNLDQHIRIHTGEKPITCTLCGK-SFRQSSSLSKHM 224          

HSP 4 Score: 57.7658 bits (138), Expect = 2.034e-8
Identity = 37/123 (30.08%), Postives = 54/123 (43.90%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNC 799
            C K F  ++SL+KH +     K F C QC   F + S   LH R   +   + P       + CT    C        +   H+R H+G+KPF C  C K F +++++  H   H  EK   C
Sbjct:  210 CGKSFRQSSSLSKHMRTHTGEKPFTCTQCGKSFSQSSNFNLHMR---IHTGEKP-------FTCT---QCGKSFRQASSLNKHMRTHTGEKPFTCTQCGKSFNRSSHLNQHIRIHTGEKPITC 319          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Zebrafish
Match: zbtb11 (zinc finger and BTB domain containing 11 [Source:ZFIN;Acc:ZDB-GENE-030131-5055])

HSP 1 Score: 95.5153 bits (236), Expect = 1.045e-19
Identity = 67/274 (24.45%), Postives = 115/274 (41.97%), Query Frame = 2
Query:  419 HIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHV 1240
            H   C K F    SL +H         ++C  C   FH  S L  H ++        PK P    +HC++   C+         + H+  H G KPF+C +C K ++   +  +H   H   + F C++C K F    ++  H++   H  +     +V  +++  C  C  +F +L + R HM   + +    F+C  C + + D   LK+H++ H       CP+C E   +    L  HIT+ H  ++  K +     L F  +    +H 
Sbjct:  800 HCTVCEKSFVTKRSLEEHTSIHTGESKYLCTTCGASFHRASGLSKHLKKHQ------PK-PEVRSFHCSH---CDKSFFEAKDLQQHMNKHLGLKPFQCQVCGKCYSWKKDWYSHVKSHSVAEPFRCNVCGKEFFEKALFRRHVKKATHGKKG----RVKQNLERECEHCGRKFTQLREYRRHMN--NHQGVKPFECLTCGVAWADARSLKRHVRTHTGERPYVCPLCQE-AHIDARTLRKHITKFHGDQLPGKIMLEKDTLQFHNQGTQVEHA 1056          

HSP 2 Score: 67.3958 bits (163), Expect = 5.277e-11
Identity = 79/322 (24.53%), Postives = 120/322 (37.27%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLH-ARREHVDPRKPP-------------KDPSKYRYHCTYSPD-CNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLE-SMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFS------CPYEGCKFT 1330
            C   F    +L  H       +IF C  C   F   + L  H AR +H   ++                D +++R    +  D C        +   H+  H+G +P  C +C K F    ++K HR+ H S K F+C +C+KSF T      H      E             K +C  C   F +   +  H+K    K E   F CS CD  F + ++L++H+  H       C +C +      +  +H   + HS  V+    C  C   F  +     HVK         + +HG  GR        C + G KFT
Sbjct:  664 CGMVFQRRYTLIMHALKHEKARIFKCSICNKEFQYAASLRAHLARHKHQKSQRASLTRAMATEDSQGSDDQARFRTRREFVCDICGKTMPKLYSLRIHMLNHTGVRPHSCKVCGKSFATKHSLKMHRALHDSLKRFHCTVCEKSFVTKRSLEEHTSIHTGE------------SKYLCTTCGASFHRASGLSKHLKKHQPKPEVRSFHCSHCDKSFFEAKDLQQHMNKHLGLKPFQCQVCGKCYSWKKDWYSH--VKSHS--VAEPFRCNVCGKEFFEKALFRRHVK---------KATHGKKGRVKQNLERECEHCGRKFT 960          

HSP 3 Score: 52.7582 bits (125), Expect = 1.827e-6
Identity = 49/206 (23.79%), Postives = 81/206 (39.32%), Query Frame = 2
Query:  635 DCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYH 1252
            +C  +     T   H   H   + F+C IC+K F   A+++ H +RH  +K     +  ++  T D   +  + R    RE+           +C  C +   KL+ +R HM   +        C +C   F     LK H   H       C +C E  FV    L  H T  H+ +   K +C  C   F   + ++ H+K++ 
Sbjct:  663 ECGMVFQRRYTLIMHALKHEKARIFKCSICNKEFQYAASLRAHLARHKHQKSQRASLT-RAMATEDSQGSDDQARFRTRREF-----------VCDICGKTMPKLYSLRIHM--LNHTGVRPHSCKVCGKSFATKHSLKMHRALHDSLKRFHCTVC-EKSFVTKRSLEEH-TSIHTGE--SKYLCTTCGASFHRASGLSKHLKKHQ 850          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Xenopus
Match: ZBTB11 (zinc finger and BTB domain containing 11 [Source:NCBI gene;Acc:734142])

HSP 1 Score: 94.7449 bits (234), Expect = 2.594e-19
Identity = 70/270 (25.93%), Postives = 113/270 (41.85%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHV 1240
            C K F    SL +H         ++C  C   FH  S L  H ++        PK  ++  YHCT      +   +    + H+  H G KPFEC+ C K ++   +  +H   H   + + C +C K F    +Y  H+    H  +     K+NF  +  C  C + F +  + R H  V + +    F+C  C + + D   LK+H++ H       CP+CNE G++    L  H+T+ H   V  K +     L F  +    +H 
Sbjct:  748 CEKSFVTNRSLQEHVSTHTGESKYLCSVCGKAFHRASGLSKHLKKHK------PKVETR-GYHCTQCEKSFFELRD---LQQHMNKHLGVKPFECEFCGKCYSWKKDWYSHVKSHSVTEPYRCSVCGKEFYEKALYRRHVNKATHGKKGR--TKLNF--EKACEHCGKIFTQFREYRRH--VNNHEGVKPFECLTCGVAWADARSLKRHVRTHTGERPYVCPVCNE-GYIDARTLRKHMTKTHKDYVPGKIMLEKDSLQFHNQGTQVEHA 1000          

HSP 2 Score: 70.8626 bits (172), Expect = 6.564e-12
Identity = 42/145 (28.97%), Postives = 69/145 (47.59%), Query Frame = 2
Query:  677 HIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESM-FKCSICDILFGDFEELKKHIKNHKESMLIACPICNE 1108
            H+  H+G KP  C++C K FT    +K H++ H S K F CD+C+KSF T+     H+ T   E             K +C  C + F +   +  H+K    K+E+  + C+ C+  F +  +L++H+  H       C  C +
Sbjct:  705 HMLKHTGVKPHACEVCGKTFTHKHGLKMHQALHESHKQFKCDMCEKSFVTNRSLQEHVSTHTGE------------SKYLCSVCGKAFHRASGLSKHLKKHKPKVETRGYHCTQCEKSFFELRDLQQHMNKHLGVKPFECEFCGK 837          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Xenopus
Match: ZBTB11 (zinc finger and BTB domain containing 11 [Source:NCBI gene;Acc:734142])

HSP 1 Score: 93.9745 bits (232), Expect = 4.136e-19
Identity = 70/270 (25.93%), Postives = 113/270 (41.85%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHV 1240
            C K F    SL +H         ++C  C   FH  S L  H ++        PK  ++  YHCT      +   +    + H+  H G KPFEC+ C K ++   +  +H   H   + + C +C K F    +Y  H+    H  +     K+NF  +  C  C + F +  + R H  V + +    F+C  C + + D   LK+H++ H       CP+CNE G++    L  H+T+ H   V  K +     L F  +    +H 
Sbjct:  574 CEKSFVTNRSLQEHVSTHTGESKYLCSVCGKAFHRASGLSKHLKKH------KPKVETR-GYHCTQCEKSFFELRD---LQQHMNKHLGVKPFECEFCGKCYSWKKDWYSHVKSHSVTEPYRCSVCGKEFYEKALYRRHVNKATHGKKGR--TKLNF--EKACEHCGKIFTQFREYRRH--VNNHEGVKPFECLTCGVAWADARSLKRHVRTHTGERPYVCPVCNE-GYIDARTLRKHMTKTHKDYVPGKIMLEKDSLQFHNQGTQVEHA 826          

HSP 2 Score: 70.8626 bits (172), Expect = 5.712e-12
Identity = 42/145 (28.97%), Postives = 69/145 (47.59%), Query Frame = 2
Query:  677 HIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESM-FKCSICDILFGDFEELKKHIKNHKESMLIACPICNE 1108
            H+  H+G KP  C++C K FT    +K H++ H S K F CD+C+KSF T+     H+ T   E             K +C  C + F +   +  H+K    K+E+  + C+ C+  F +  +L++H+  H       C  C +
Sbjct:  531 HMLKHTGVKPHACEVCGKTFTHKHGLKMHQALHESHKQFKCDMCEKSFVTNRSLQEHVSTHTGE------------SKYLCSVCGKAFHRASGLSKHLKKHKPKVETRGYHCTQCEKSFFELRDLQQHMNKHLGVKPFECEFCGK 663          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Xenopus
Match: ZBTB11 (zinc finger and BTB domain containing 11 [Source:NCBI gene;Acc:734142])

HSP 1 Score: 93.5893 bits (231), Expect = 5.173e-19
Identity = 70/270 (25.93%), Postives = 113/270 (41.85%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHV 1240
            C K F    SL +H         ++C  C   FH  S L  H ++        PK  ++  YHCT      +   +    + H+  H G KPFEC+ C K ++   +  +H   H   + + C +C K F    +Y  H+    H  +     K+NF  +  C  C + F +  + R H  V + +    F+C  C + + D   LK+H++ H       CP+CNE G++    L  H+T+ H   V  K +     L F  +    +H 
Sbjct:  658 CEKSFVTNRSLQEHVSTHTGESKYLCSVCGKAFHRASGLSKHLKKHK------PKVETR-GYHCTQCEKSFFELRD---LQQHMNKHLGVKPFECEFCGKCYSWKKDWYSHVKSHSVTEPYRCSVCGKEFYEKALYRRHVNKATHGKKGR--TKLNF--EKACEHCGKIFTQFREYRRH--VNNHEGVKPFECLTCGVAWADARSLKRHVRTHTGERPYVCPVCNE-GYIDARTLRKHMTKTHKDYVPGKIMLEKDSLQFHNQGTQVEHA 910          

HSP 2 Score: 70.8626 bits (172), Expect = 5.983e-12
Identity = 42/145 (28.97%), Postives = 69/145 (47.59%), Query Frame = 2
Query:  677 HIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESM-FKCSICDILFGDFEELKKHIKNHKESMLIACPICNE 1108
            H+  H+G KP  C++C K FT    +K H++ H S K F CD+C+KSF T+     H+ T   E             K +C  C + F +   +  H+K    K+E+  + C+ C+  F +  +L++H+  H       C  C +
Sbjct:  615 HMLKHTGVKPHACEVCGKTFTHKHGLKMHQALHESHKQFKCDMCEKSFVTNRSLQEHVSTHTGE------------SKYLCSVCGKAFHRASGLSKHLKKHKPKVETRGYHCTQCEKSFFELRDLQQHMNKHLGVKPFECEFCGK 747          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Xenopus
Match: ENSXETT00000036804.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:757182:796022:-1 gene:ENSXETG00000015770.1 transcript:ENSXETT00000036804.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 1.128e-18
Identity = 100/380 (26.32%), Postives = 143/380 (37.63%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPR--------KPPKDPSKYRYH-----------CTYSPDCNYMTNNGGTFEH---------------------------HIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVK-----------------EYHANEINSRKSHGIIGRFSCPYEGCKFTSNTEL 1345
            +G+  + C    C K F H + L +H K     K F C QC   F   S+L +H R  H   R        K  KDPS    H           CT    C   +   G  EH                           H R+H+G+KPF C  C KRFTQ+ ++  H   H  EK ++C  C K F        H R+   E R Y            C  C + F   +++R H+++     E  F CS C+  F     LK+H+  HK     +C  C +  F H + LN H+    S K  +   C  C   F   + +  H++                 +Y++N    +++H     FSCP  G  FT+   L
Sbjct:  426 TGEKPFTC--SQCEKCFTHRSDLNRHLKSHKGEKTFSCSQCGKYFISTSDLTVHLR-IHTGERPYSCSECGKCFKDPSYLTTHQRIHTGEKPFTCTECGKC--FSGRVGLLEHQKTHTGVKSFVCSVCEKCFKYQSKLILHQRSHTGEKPFSCSECGKRFTQHVHLIEHHRTHTGEKPYSCSHCGKRFNCPSKLTVHQRSHTGE-RPY-----------SCSECGKGFKDSWNLRAHLRI--HTGEKPFTCSQCEKCFTHRSALKRHLALHKREKTFSCSRCGK-CFTHRSDLNRHLK---SHKGEKTFSCSQCGKCFSCTSALNVHLRSHSGERPYSCSECGKCFKYYSNLTVHQRTHTGEKPFSCPECGKCFTNGASL 782          

HSP 2 Score: 77.0258 bits (188), Expect = 5.926e-14
Identity = 96/375 (25.60%), Postives = 145/375 (38.67%), Query Frame = 2
Query:  197 GKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESL--HQPILRNDKEYAFVEKDGGFSLEEV--------SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREH-------ELREYFVEKVNFSV---------KVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVK 1243
            GK +  + D N    +  L +     I    N +F S   L  HQ     +  Y+  E    F+            +G+  Y C    C K F    +L  H K    VK FVC  C   F   SEL +H +R H    KP        + C+   +C            H R H+G+KP+ C  C KRF+  ++   H   H  EKL  C  CKK F +H   + H  +          E  + F  +   +V            C  C + F     +R H+++     E  F CS C+  F    +L +H+K+HK     +C  C +  F+  + L  H+ R H+ +  R   C  C   F+  + +T H +
Sbjct:  158 GKSFSRSSDFNRHCRIHRLEKS---CICSKCNKQFTSHSELIVHQSSHVGEGPYSCSECGKRFNCPSKLTIHERIHTGERPYSC--SECGKGFKERTTLN-HQKTHTGVKSFVCSVCEKHFKWQSELIVH-QRSHTG-EKP--------FSCS---ECGKRFTRHVHLIEHYRTHTGEKPYSCSDCGKRFSHGSDFNRHCRIHRLEKLCICSQCKKQFTSHSELIVHQSSHMEEGPYSCFECGKRFKRRSQLTVHRRSHTGERPYSCPKCGKDFKDRSTLRAHLRI--HTGEKPFTCSQCEKCFTHRSDLNRHLKSHKGEKTFSCSQCGKY-FISTSDLTVHL-RIHTGE--RPYSCSECGKCFKDPSYLTTHQR 507          

HSP 3 Score: 75.8702 bits (185), Expect = 1.330e-13
Identity = 74/300 (24.67%), Postives = 112/300 (37.33%), Query Frame = 2
Query:  401 KVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVK-----------------VICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEY 1249
            +++ +C    C KQF   + L  H     +   + C +C   F   S+L +H RR H   R          Y C   P C     +  T   H+R H+G+KPF C  C K FT  +++  H   H  EK F+C  C K F +      HLR    E R Y   +     K                   C  C + F     +  H K         F CS+C+  F    +L  H ++H      +C  C +    H + + HH T        +   C +C   F   +++T H + +
Sbjct:  342 RLEKLCICSQCKKQFTSHSELIVHQSSHMEEGPYSCFECGKRFKRRSQLTVH-RRSHTGERP---------YSC---PKCGKDFKDRSTLRAHLRIHTGEKPFTCSQCEKCFTHRSDLNRHLKSHKGEKTFSCSQCGKYFISTSDLTVHLRIHTGE-RPYSCSECGKCFKDPSYLTTHQRIHTGEKPFTCTECGKCFSGRVGLLEHQKT--HTGVKSFVCSVCEKCFKYQSKLILHQRSHTGEKPFSCSECGKRFTQHVHLIEHHRTH----TGEKPYSCSHCGKRFNCPSKLTVHQRSH 621          

HSP 4 Score: 69.707 bits (169), Expect = 1.261e-11
Identity = 67/243 (27.57%), Postives = 96/243 (39.51%), Query Frame = 2
Query:  668 FEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHE-------LREYFVEKVNFSV---------KVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELL 1348
            F  H + H+G KPF C +C KRF    +   H+  H  EKLF+C  C K F+     + H RT   E         + F    +F+            IC  CN+QF    ++  H        E  + CS C   F    +L  H + H      +C  C + GF     LNH  T        +  VC  CE  F+ ++E+  H           ++SH     FSC   G +FT +  L+
Sbjct:   83 FLMHQKTHTGVKPFVCSVCEKRFLWETDYIVHKRSHTGEKLFSCSECGKRFRHRVPLIEHYRTHTGEKPYSCSDCGKSFSRSSDFNRHCRIHRLEKSCICSKCNKQFTSHSELIVHQS--SHVGEGPYSCSECGKRFNCPSKLTIHERIHTGERPYSCSECGK-GFKERTTLNHQKTH----TGVKSFVCSVCEKHFKWQSELIVH-----------QRSHTGEKPFSCSECGKRFTRHVHLI 307          

HSP 5 Score: 62.7734 bits (151), Expect = 1.917e-9
Identity = 46/132 (34.85%), Postives = 57/132 (43.18%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDC-NYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFK 823
            C K F H + L +H K     K F C QC   F   S L +H R  H   R          Y C+    C  Y +N       H R H+G+KPF C  C K FT  A++  H+  H  EK F C  C K F+
Sbjct:  688 CGKCFTHRSDLNRHLKSHKGEKTFSCSQCGKCFSCTSALNVHLR-SHSGERP---------YSCSECGKCFKYYSN----LTVHQRTHTGEKPFSCPECGKCFTNGASLTYHKKCHTGEKPFTCTECGKCFR 805          

HSP 6 Score: 61.6178 bits (148), Expect = 4.143e-9
Identity = 88/398 (22.11%), Postives = 147/398 (36.93%), Query Frame = 2
Query:  206 YQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLHQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFV---------------EKVNFSVK-VICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLI 1351
            Y    ++ ++  +  L E          N + ++   LH+P  +   ++   +K         +G   ++C +  C K+F        H +     K+F C +C   F     L  H R    +  KP        Y C+   DC    +    F  H R H  +K   C  C+K+FT ++ +  H+S HV E  ++C  C K F        H R    E R Y                 +K +  VK  +C  C + F    ++  H +      E  F CS C   F     L +H + H      +C  C +  F H +  N H   C   ++ +  +C  C+  F + +E+  H           + SH   G +SC   G +F   ++L +
Sbjct:   36 YSCKGENQSDCCINPLTEQIQGTDTPTPNTETDNCSELHKPC-KTKADFLMHQKTH-------TGVKPFVCSV--CEKRFLWETDYIVHKRSHTGEKLFSCSECGKRFRHRVPLIEHYRTHTGE--KP--------YSCS---DCGKSFSRSSDFNRHCRIHRLEKSCICSKCNKQFTSHSELIVHQSSHVGEGPYSCSECGKRFNCPSKLTIHERIHTGE-RPYSCSECGKGFKERTTLNHQKTHTGVKSFVCSVCEKHFKWQSELIVHQR--SHTGEKPFSCSECGKRFTRHVHLIEHYRTHTGEKPYSCSDCGKR-FSHGSDFNRH---CRIHRLEKLCICSQCKKQFTSHSELIVH-----------QSSHMEEGPYSCFECGKRFKRRSQLTV 392          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Xenopus
Match: crp.4 (C-reactive protein, pentraxin-related, gene 4 [Source:Xenbase;Acc:XB-GENE-1018594])

HSP 1 Score: 91.6633 bits (226), Expect = 1.923e-18
Identity = 72/256 (28.12%), Postives = 109/256 (42.58%), Query Frame = 2
Query:  311 ESLHQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKES 1078
            E LH+ +     E   V  + G S  +       +C+I  C K+F H ++L  H +     K F C  C   F +   L  H RR   +  KP        Y C     C       G  + HI  H+G+KP  CDIC + F+  +N+K H   HV++K+F CD C KSF  H   + H R R    + Y            C+ C ++F    D+R H++      E  + C +C+  F     L++H   H ++
Sbjct:  485 EGLHENVEAERVESPLVPAEDGISTNK-----HCVCNI--CGKRFKHPSNLELHKRSHTGEKPFECSICGKHFSQAGNLQTHLRRHSGE--KP--------YICEI---CGKRFAVSGDVQRHIVIHTGEKPHLCDICGRGFSNVSNLKEHEKTHVADKIFTCDECGKSFNMHRKLIKH-RIRHTGEKPYN-----------CVTCGKKFAGSGDLRRHVR--SHTGERPYTCDVCNKNFSRSAVLRRHKTTHSKA 706          

HSP 2 Score: 68.1662 bits (165), Expect = 3.402e-11
Identity = 61/243 (25.10%), Postives = 89/243 (36.63%), Query Frame = 2
Query:  521 GIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEY 1249
            GIF  L E     R E   P  P +D      HC  +  C     +    E H R+H+G+KPFEC IC K F+Q  N++TH  RH  EK + C+IC                                         ++F    D++ H+ +     E    C IC   F +   LK+H K H    +  C  C +   +H   + H I         +   C  C   F    ++  HV+ +
Sbjct:  482 GIFEGLHENVEAERVE--SPLVPAEDGISTNKHCVCN-ICGKRFKHPSNLELHKRSHTGEKPFECSICGKHFSQAGNLQTHLRRHSGEKPYICEIC----------------------------------------GKRFAVSGDVQRHIVI--HTGEKPHLCDICGRGFSNVSNLKEHEKTHVADKIFTCDECGKSFNMHRKLIKHRIRHTG----EKPYNCVTCGKKFAGSGDLRRHVRSH 675          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Mouse
Match: Zbtb11 (zinc finger and BTB domain containing 11 [Source:MGI Symbol;Acc:MGI:2443876])

HSP 1 Score: 93.9745 bits (232), Expect = 3.103e-19
Identity = 69/285 (24.21%), Postives = 116/285 (40.70%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHG 1285
            C K F    SL +H         + C  C   FH  S L  H ++        PK P    YHCT    C            H+  H G KPF+C  C K ++   +  +H   H   + + C+IC K F    ++  H++   H  +     +   +++ +C  C  +F +L + R HM   + +    F+C  C + + D   LK+H++ H       CP+C+E  ++    L  H+T+ H   V  K +     L F  +    +H       ++  ++S G
Sbjct:  709 CVKSFVTKRSLQEHMSIHTGESKYFCSICGKSFHRGSGLSKHLKKHQ------PK-PEVRGYHCT---QCEKSFFEARDLRQHMNKHLGVKPFQCQFCDKCYSWKKDWYSHVKSHSVTEPYRCNICGKEFYEKALFRRHVKKATHGKKG----RAKQNLERVCDQCGRKFTQLREYRRHMN--NHEGVKPFECLTCGVAWADARSLKRHVRTHTGERPYVCPVCSE-AYIDARTLRKHMTKFHRDYVPCKIMLEKDTLQFHNQGTQVEHAVSILTADMQEQESSG 976          

HSP 2 Score: 62.003 bits (149), Expect = 2.505e-9
Identity = 65/243 (26.75%), Postives = 97/243 (39.92%), Query Frame = 2
Query:  677 HIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLE-SMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFS------CPYEGCKFTSNTELLITSHIERHENGK 1384
            H+  H+G KP  C +C K F     +K H+S H S+K F C++C KSF T      H+     E + YF           C  C + F +   +  H+K    K E   + C+ C+  F +  +L++H+  H       C  C++      +  +H   + HS  V+    C  C   F  +     HVK         + +HG  GR        C   G KFT   E     H+  HE  K
Sbjct:  666 HMLKHTGVKPHACQVCGKTFIYKHGLKLHQSLHQSQKQFQCELCVKSFVTKRSLQEHMSIHTGESK-YF-----------CSICGKSFHRGSGLSKHLKKHQPKPEVRGYHCTQCEKSFFEARDLRQHMNKHLGVKPFQCQFCDKCYSWKKDWYSH--VKSHS--VTEPYRCNICGKEFYEKALFRRHVK---------KATHGKKGRAKQNLERVCDQCGRKFTQLREY--RRHMNNHEGVK 881          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Mouse
Match: Zfp358 (zinc finger protein 358 [Source:MGI Symbol;Acc:MGI:2153740])

HSP 1 Score: 92.4337 bits (228), Expect = 5.566e-19
Identity = 69/253 (27.27%), Postives = 100/253 (39.53%), Query Frame = 2
Query:  494 KIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRT----REHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHV 1240
            + F C  C   F   S L  H RR H    KP        Y C   PDC    ++G T   H   H+G +P++C  C K F   + +  HRS H  EK  +C +C K+F    +   HLRT    R H+                C  C + F +   +  H++      E  + C  C   FG    L +H + H       CP C +  F   + L HH+ R H+ +  R   C +C   F   + +  H+
Sbjct:  152 RPFSCPDCGRAFRRSSGLSQH-RRTHSG-EKP--------YRC---PDCGKSFSHGATLAQHRGIHTGARPYQCAACGKAFGWRSTLLKHRSSHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHK----------------CPVCAKGFGQGSALLKHLRT--HTGERPYPCPQCGKAFGQSSALLQHQRTHTAERPYRCPHCGK-AFGQSSNLQHHL-RIHTGE--RPYACPHCSKAFGQSSALLQHL 369          

HSP 2 Score: 87.4261 bits (215), Expect = 1.765e-17
Identity = 65/243 (26.75%), Postives = 94/243 (38.68%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREY--------FVEKVNFS---------VKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHK 1072
            SG+  Y C   +C K F+H  +L +H       + + C  C   F   S L  H R  H    KP        +HC   P C     +G     H+R H G +P +C +C K F Q + +  H   H  E+ + C  C K+F      L H RT   E R Y        F +  N               C  C++ F +   +  H+ V     E  ++C +C   FG    L KH + H+
Sbjct:  177 SGEKPYRC--PDCGKSFSHGATLAQHRGIHTGARPYQCAACGKAFGWRSTLLKH-RSSHSG-EKP--------HHC---PVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPCPQCGKAFGQSSALLQHQRTHTAE-RPYRCPHCGKAFGQSSNLQHHLRIHTGERPYACPHCSKAFGQSSALLQHLHV--HSGERPYRCQLCGKAFGQASSLTKHKRVHE 401          

HSP 3 Score: 70.4774 bits (171), Expect = 4.286e-12
Identity = 54/218 (24.77%), Postives = 82/218 (37.61%), Query Frame = 2
Query:  692 SGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTEL 1345
            S  +PF C  C + F +++ +  HR  H  EK + C  C KSF +H   LA  R      R Y            C  C + F     +  H        E    C +C   FG    L +H++ H       CP+C + GF   + L  H+ R H+ +  R   C  C   F   + +  H + + A              + CP+ G  F  ++ L
Sbjct:  149 SPPRPFSCPDCGRAFRRSSGLSQHRRTHSGEKPYRCPDCGKSF-SHGATLAQHRGIHTGARPY-----------QCAACGKAFGWRSTLLKHRS--SHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAK-GFGQGSALLKHL-RTHTGE--RPYPCPQCGKAFGQSSALLQHQRTHTAERP-----------YRCPHCGKAFGQSSNL 337          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Mouse
Match: Zfp358 (zinc finger protein 358 [Source:MGI Symbol;Acc:MGI:2153740])

HSP 1 Score: 92.4337 bits (228), Expect = 5.566e-19
Identity = 69/253 (27.27%), Postives = 100/253 (39.53%), Query Frame = 2
Query:  494 KIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRT----REHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHV 1240
            + F C  C   F   S L  H RR H    KP        Y C   PDC    ++G T   H   H+G +P++C  C K F   + +  HRS H  EK  +C +C K+F    +   HLRT    R H+                C  C + F +   +  H++      E  + C  C   FG    L +H + H       CP C +  F   + L HH+ R H+ +  R   C +C   F   + +  H+
Sbjct:  152 RPFSCPDCGRAFRRSSGLSQH-RRTHSG-EKP--------YRC---PDCGKSFSHGATLAQHRGIHTGARPYQCAACGKAFGWRSTLLKHRSSHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHK----------------CPVCAKGFGQGSALLKHLRT--HTGERPYPCPQCGKAFGQSSALLQHQRTHTAERPYRCPHCGK-AFGQSSNLQHHL-RIHTGE--RPYACPHCSKAFGQSSALLQHL 369          

HSP 2 Score: 87.4261 bits (215), Expect = 1.765e-17
Identity = 65/243 (26.75%), Postives = 94/243 (38.68%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREY--------FVEKVNFS---------VKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHK 1072
            SG+  Y C   +C K F+H  +L +H       + + C  C   F   S L  H R  H    KP        +HC   P C     +G     H+R H G +P +C +C K F Q + +  H   H  E+ + C  C K+F      L H RT   E R Y        F +  N               C  C++ F +   +  H+ V     E  ++C +C   FG    L KH + H+
Sbjct:  177 SGEKPYRC--PDCGKSFSHGATLAQHRGIHTGARPYQCAACGKAFGWRSTLLKH-RSSHSG-EKP--------HHC---PVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPCPQCGKAFGQSSALLQHQRTHTAE-RPYRCPHCGKAFGQSSNLQHHLRIHTGERPYACPHCSKAFGQSSALLQHLHV--HSGERPYRCQLCGKAFGQASSLTKHKRVHE 401          

HSP 3 Score: 70.4774 bits (171), Expect = 4.286e-12
Identity = 54/218 (24.77%), Postives = 82/218 (37.61%), Query Frame = 2
Query:  692 SGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTEL 1345
            S  +PF C  C + F +++ +  HR  H  EK + C  C KSF +H   LA  R      R Y            C  C + F     +  H        E    C +C   FG    L +H++ H       CP+C + GF   + L  H+ R H+ +  R   C  C   F   + +  H + + A              + CP+ G  F  ++ L
Sbjct:  149 SPPRPFSCPDCGRAFRRSSGLSQHRRTHSGEKPYRCPDCGKSF-SHGATLAQHRGIHTGARPY-----------QCAACGKAFGWRSTLLKHRS--SHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAK-GFGQGSALLKHL-RTHTGE--RPYPCPQCGKAFGQSSALLQHQRTHTAERP-----------YRCPHCGKAFGQSSNL 337          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Mouse
Match: Zfp948 (zinc finger protein 948 [Source:MGI Symbol;Acc:MGI:3040683])

HSP 1 Score: 90.8929 bits (224), Expect = 1.711e-18
Identity = 69/225 (30.67%), Postives = 106/225 (47.11%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNH 1069
            +G+  Y C  + C K F   + L +H K     K + C +C   F +L+ L  H R   V  ++ P       Y+CT    C+     G T   H R H+G++P+ C  C K F +   ++TH+  H  EK +NC +C KSF    I  +HL+  +   R +  EK        C+ C++ F + F +R H ++     E  +KC  CD+ F     L+KH KNH
Sbjct:  460 TGEKPYKC--KECDKSFTRNSILRQHQKIHTKEKPYKCVECDKSFTQLTYLRTHQR---VHTKEKP-------YNCTV---CDKSFTTGATLRIHQRVHTGERPYRCTECGKSFREGTTLRTHKKIHTGEKPYNCTVCDKSF----IRYSHLQRHQ---RVHTGEKP-----YKCMECDKSFTECFLLRKHQRI--HTEEKPYKCKDCDLAFVCISNLRKHQKNH 655          

HSP 2 Score: 72.0182 bits (175), Expect = 1.706e-12
Identity = 87/331 (26.28%), Postives = 123/331 (37.16%), Query Frame = 2
Query:  299 FNSDESLHQPILRNDKEYAFVEKDGGFSLEEV--------SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSEL---------------------FLH----ARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRT-------REHELREYFVEKVNFSV-KVI--------CLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHH 1144
            F SD  LH      +  Y   E D  F   E+        S ++ Y C  + C K F     L +HYK      ++ CR C   F + S L                     FLH     R + V   + P       Y C    +C+           H + H+ +KP++C  C K FTQ   ++TH+  H  EK +NC +C KSF T      H R        R  E  + F E       K I        C  C++ F +   ++ H +V     E  +KC  CD  F +   L+KH + H E     C  C+   FV  + L  H
Sbjct:  340 FKSDHRLHT----GENPYKCSECDRSFPHYELFRIHQKTHSSEIDYEC--EECGKSFTELLQLRRHYKIHSGATLYKCRDCDKSFTQYSHLQKHQTIHTGERPYKCKDCEKSFLHNSLLRRHQSVHTGEKP-------YKC---KECDKSFTRNSILRQHQKIHTKEKPYKCVECDKSFTQLTYLRTHQRVHTKEKPYNCTVCDKSFTTGATLRIHQRVHTGERPYRCTECGKSFREGTTLRTHKKIHTGEKPYNCTVCDKSFIRYSHLQRHQRV--HTGEKPYKCMECDKSFTECFLLRKHQRIHTEEKPYKCKDCD-LAFVCISNLRKH 651          

HSP 3 Score: 64.6994 bits (156), Expect = 3.169e-10
Identity = 77/325 (23.69%), Postives = 124/325 (38.15%), Query Frame = 2
Query:  299 FNSDESL-HQPILRNDKEYAFVEKDGGFSLEEV--------SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSV-CRYCELIFQTETEMTDHVK 1243
            F+S  SL  Q I   +K Y   +    FS            +G+  Y C+   C K F    +L  H +     K + C++C   F +LS L  H +    +     K+  ++  HC+             +F  H + H   K    D C K   Q ++ K+    H  E  + C  C +SF  ++++  H +T   E            +   C  C + F +L  +R H K+      +++KC  CD  F  +  L+KH   H       C  C E  F+H + L  H     S+    K   C+ C+  F   + +  H K
Sbjct:  196 FSSTHSLMQQAIFNREKRYQCGQCQRCFSTSANLTIHQRIHTGEKPYKCNF--CDKSFAQCTTLKTHQRLHTGEKPYKCKECGKSFPQLSALKSHQKMHTGEKPYKCKECDRFFAHCS-------------SFRRHQKTHRAKKHTGPD-CGKDLHQLSHFKSDHRLHTGENPYKCSECDRSFPHYELFRIHQKTHSSE------------IDYECEECGKSFTELLQLRRHYKI--HSGATLYKCRDCDKSFTQYSHLQKHQTIHTGERPYKCKDC-EKSFLHNSLLRRH----QSVHTGEKPYKCKECDKSFTRNSILRQHQK 485          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Mouse
Match: Zfp26 (zinc finger protein 26 [Source:MGI Symbol;Acc:MGI:99173])

HSP 1 Score: 91.2781 bits (225), Expect = 1.826e-18
Identity = 74/272 (27.21%), Postives = 111/272 (40.81%), Query Frame = 2
Query:  425 QNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHV 1240
            + C K F H   L  H +     K + C++C   F E S L +H R +H   +          Y C    +C            H+R+H+G+KP++CD C   F  ++ + TH   H  EK F C+IC K+F      L H+RT   E          +  KV    C + F     +  H++      E  + C+ C+  F  F +L +HIK H       C +C    F + + L  H      IK  +   C YC   F   + +T HV
Sbjct:  347 KKCEKFFTHPVYLNIHMQSHTVEKPYDCKECGKAFTERSSLIVHLR-QHTREKS---------YECK---ECGKTFIQPSRLTEHMRSHTGEKPYQCDQCGNAFASSSYLTTHLRTHTGEKPFECNICGKAFTRSSYLLGHIRTHTGE--------KPYECKV----CGKAFSGRSWLTIHLR--KHTGERPYPCTECEKAFTSFAQLTEHIKTHTGEKPFRCKVCART-FRNSSCLKTHFRIHTGIKPYK---CNYCGKAFTARSGLTKHV 587          

HSP 2 Score: 89.3521 bits (220), Expect = 8.762e-18
Identity = 71/285 (24.91%), Postives = 121/285 (42.46%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEY 1249
            +G+  Y C  + C K F   + LTKH +     + + C++C   F   ++L +H +             S+  + C     C     N  + E H R H+G KP++C  C K FT  + +  H   H  EK + C  C K+F T    +AH+R+ + E                C  C + F     +  H+K+     E  F+C++C   F     L  H++ H       C IC +  F+  + L  H+ R H+ +  +  VC+YC   F   + +  H++++
Sbjct:  675 TGEKPYEC--KECGKTFPERSCLTKHIRTHTGERPYECKECGKGFISFAQLTVHIKTH----------SSERPFQCKV---CTKSFRNSSSLETHFRIHTGVKPYKCSYCGKAFTARSGLTIHLRNHTGEKSYACQECGKAFSTSSGLIAHIRSHKGE------------KPFECDHCGKAFASSSYLNVHLKI--HTGEKPFQCTVCGKTFTCSSYLPVHMRTHTGEKPFQCIICGK-SFLWSSYLRVHM-RIHTGE--KPYVCQYCGKAFTEHSGLNKHLRKH 926          

HSP 3 Score: 83.9593 bits (206), Expect = 4.070e-16
Identity = 82/318 (25.79%), Postives = 128/318 (40.25%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGK 1384
            C K F   + LTKH    +  K + C++C   F   S L  H R   +   + P       + C     C     +  +   H+R H+G+KPFEC+ C K FT+++ ++ H   H  EK + C  C K+F        H+RT   E R Y            C  C + F     +  H+K      E  F+C +C   F +   L+ H + H       C  C +  F   + L  H+ R H+ + S    C+ C   F T + +  H+           +SH     F C + G  F S++ L +  H++ H   K
Sbjct:  573 CGKAFTARSGLTKHVLIHNGEKPYECKECGKAFSTSSGLVEHIR---IHTGEKP-------FECY---QCGKALAHSSSLVGHLRTHTGEKPFECNQCDKTFTRSSYLRIHMRTHTGEKPYECKECGKTFPERSCLTKHIRTHTGE-RPY-----------ECKECGKGFISFAQLTVHIKT--HSSERPFQCKVCTKSFRNSSSLETHFRIHTGVKPYKCSYCGK-AFTARSGLTIHL-RNHTGEKSY--ACQECGKAFSTSSGLIAHI-----------RSHKGEKPFECDHCGKAFASSSYLNV--HLKIHTGEK 846          

HSP 4 Score: 67.0106 bits (162), Expect = 5.986e-11
Identity = 49/168 (29.17%), Postives = 71/168 (42.26%), Query Frame = 2
Query:  353 AFVEKDG-GFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLR 853
            AF  + G    L   +G+  Y C  Q C K F+ ++ L  H +     K F C  C   F   S L +H +   +   + P       + CT    C            H+R H+G+KPF+C IC K F  ++ ++ H   H  EK + C  C K+F  H     HLR
Sbjct:  772 AFTARSGLTIHLRNHTGEKSYAC--QECGKAFSTSSGLIAHIRSHKGEKPFECDHCGKAFASSSYLNVHLK---IHTGEKP-------FQCTV---CGKTFTCSSYLPVHMRTHTGEKPFQCIICGKSFLWSSYLRVHMRIHTGEKPYVCQYCGKAFTEHSGLNKHLR 924          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q96JL9|ZN333_HUMAN (Zinc finger protein 333 OS=Homo sapiens OX=9606 GN=ZNF333 PE=2 SV=3)

HSP 1 Score: 104.375 bits (259), Expect = 6.719e-22
Identity = 78/281 (27.76%), Postives = 116/281 (41.28%), Query Frame = 2
Query:  425 QNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHE-LREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEI 1264
            Q C + F ++++L +H +     K F C QC   F     L LH +R H    KP        Y C    DC    N   +   H+R H+G+KPFEC  C K F +++++KTH   H  EK + C+ C K F+T      H R    E L E             C  C +   +L  +++HM+      E  + C  C   F +   L+KH + H      AC  C       + Q +H I    +    R   C  CE  F+  + +T H + +   E 
Sbjct:  397 QECGQAFKYSSNLRRHMRTHTGEKPFECSQCGKTFTRNFNLILH-QRNHTG-EKP--------YECK---DCGKAFNQPSSLRSHVRTHTGEKPFECSQCGKAFREHSSLKTHLRTHTREKPYECNQCGKPFRTSTHLNVHKRIHTGEKLYE-------------CATCGQVLSRLSTLKSHMRT--HTGEKPYVCQECGRAFSEPSSLRKHARTHSGKKPYACQECGR----AFGQSSHLIVHVRTHSAGRPYQCNQCEKAFRHSSSLTVHKRTHVGRET 645          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|P08970|SUHW_DROME (Protein suppressor of hairy wing OS=Drosophila melanogaster OX=7227 GN=su(Hw) PE=1 SV=2)

HSP 1 Score: 93.9745 bits (232), Expect = 1.843e-18
Identity = 74/298 (24.83%), Postives = 126/298 (42.28%), Query Frame = 2
Query:  410 YICHIQNCYKQFNHANSLTKH--YKDC--HDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESM--LIACPICNE----PGFV--HYNQLNHHITRCHS-----IKVSRKSVCRYCELIFQTETEMTDHVKEYH 1252
            Y C I  C K F  +  L +H  Y  C  ++     C+ C  +F+ L  L     R H+      +   K  Y C    +C Y  +   T   HIR H+G+KPF+CD+C K+F+    +K HR  H  EK ++C +C ++F   ++   H++    E                C  C + F +   +R H K   +     F C  CD  F   ++L++H+K H  +   + +C  C      P  +  H ++  H   +  S     +K+  ++ C  C+  F +   +  H++  H
Sbjct:  348 YACKI--CGKDFTRSYHLKRHQKYSSCSSNETDTMSCKVCDRVFYRLDNL-----RSHLKQHLGTQVVKKPEYMCHTCKNCFYSLS---TLNIHIRTHTGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQAFAVKEVLNRHMKRHTGERPHK------------CDECGKSFIQATQLRTHSKTHIRP----FPCEQCDEKFKTEKQLERHVKTHSRTKRPVFSCAECKRNFRTPALLKEHMDEGKHSPKQQRSSMRSAVKIMERTDCAICDKNFDSSDTLRRHIRTVH 619          

HSP 2 Score: 61.6178 bits (148), Expect = 2.023e-8
Identity = 69/271 (25.46%), Postives = 102/271 (37.64%), Query Frame = 2
Query:  638 CNYMTNNGGTFEHHIRAH-SGDKPFECDICHKRFTQNANMKTHRSRHV----SEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHIT-----------------------RCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIE 1366
            CN    +      H   H S  KP+ C IC K FT++ ++K H+             +C +C + F   D   +HL+     L    V+K  +    +C  C   F  L  +  H++      E  F C +CD  F     LKKH + H      +C +CN+  F     LN H+                        R HS    R   C  C+  F+TE ++  HVK +      SR    +   FSC    CK    T  L+  H++
Sbjct:  324 CNANLRSEALLALHEEQHKSRGKPYACKICGKDFTRSYHLKRHQKYSSCSSNETDTMSCKVCDRVFYRLDNLRSHLK---QHLGTQVVKKPEY----MCHTCKNCFYSLSTLNIHIRT--HTGEKPFDCDLCDKKFSALVALKKHRRYHTGEKPYSCTVCNQ-AFAVKEVLNRHMKRHTGERPHKCDECGKSFIQATQLRTHSKTHIRPFPCEQCDEKFKTEKQLERHVKTH------SRTKRPV---FSCAE--CKRNFRTPALLKEHMD 573          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|G5E8B9|ZBT11_MOUSE (Zinc finger and BTB domain-containing protein 11 OS=Mus musculus OX=10090 GN=Zbtb11 PE=2 SV=1)

HSP 1 Score: 93.9745 bits (232), Expect = 2.171e-18
Identity = 69/285 (24.21%), Postives = 116/285 (40.70%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHG 1285
            C K F    SL +H         + C  C   FH  S L  H ++        PK P    YHCT    C            H+  H G KPF+C  C K ++   +  +H   H   + + C+IC K F    ++  H++   H  +     +   +++ +C  C  +F +L + R HM   + +    F+C  C + + D   LK+H++ H       CP+C+E  ++    L  H+T+ H   V  K +     L F  +    +H       ++  ++S G
Sbjct:  709 CVKSFVTKRSLQEHMSIHTGESKYFCSICGKSFHRGSGLSKHLKKHQ------PK-PEVRGYHCT---QCEKSFFEARDLRQHMNKHLGVKPFQCQFCDKCYSWKKDWYSHVKSHSVTEPYRCNICGKEFYEKALFRRHVKKATHGKKG----RAKQNLERVCDQCGRKFTQLREYRRHMN--NHEGVKPFECLTCGVAWADARSLKRHVRTHTGERPYVCPVCSE-AYIDARTLRKHMTKFHRDYVPCKIMLEKDTLQFHNQGTQVEHAVSILTADMQEQESSG 976          

HSP 2 Score: 62.003 bits (149), Expect = 1.752e-8
Identity = 65/243 (26.75%), Postives = 97/243 (39.92%), Query Frame = 2
Query:  677 HIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLE-SMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFS------CPYEGCKFTSNTELLITSHIERHENGK 1384
            H+  H+G KP  C +C K F     +K H+S H S+K F C++C KSF T      H+     E + YF           C  C + F +   +  H+K    K E   + C+ C+  F +  +L++H+  H       C  C++      +  +H   + HS  V+    C  C   F  +     HVK         + +HG  GR        C   G KFT   E     H+  HE  K
Sbjct:  666 HMLKHTGVKPHACQVCGKTFIYKHGLKLHQSLHQSQKQFQCELCVKSFVTKRSLQEHMSIHTGESK-YF-----------CSICGKSFHRGSGLSKHLKKHQPKPEVRGYHCTQCEKSFFEARDLRQHMNKHLGVKPFQCQFCDKCYSWKKDWYSH--VKSHS--VTEPYRCNICGKEFYEKALFRRHVK---------KATHGKKGRAKQNLERVCDQCGRKFTQLREY--RRHMNNHEGVK 881          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q9NW07|ZN358_HUMAN (Zinc finger protein 358 OS=Homo sapiens OX=9606 GN=ZNF358 PE=1 SV=2)

HSP 1 Score: 93.2041 bits (230), Expect = 2.215e-18
Identity = 69/253 (27.27%), Postives = 100/253 (39.53%), Query Frame = 2
Query:  494 KIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRT----REHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHV 1240
            + F C  C   F   S L  H RR H    KP        Y C   PDC    ++G T   H   H+G +P++C  C K F   + +  HRS H  EK  +C +C K+F    +   HLRT    R H+                C  C + F +   +  H++      E  + C  C   FG    L +H + H       CP C +  F   + L HH+ R H+ +  R   C +C   F   + +  H+
Sbjct:  149 RPFSCPDCGRAFRRSSGLSQH-RRTHSG-EKP--------YRC---PDCGKSFSHGATLAQHRGIHTGARPYQCAACGKAFGWRSTLLKHRSSHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHK----------------CPVCAKGFGQGSALLKHLRT--HTGERPYPCPQCGKAFGQSSALLQHQRTHTAERPYRCPHCGK-AFGQSSNLQHHL-RIHTGE--RPYACPHCSKAFGQSSALLQHL 366          

HSP 2 Score: 88.1965 bits (217), Expect = 6.863e-17
Identity = 65/243 (26.75%), Postives = 94/243 (38.68%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREY--------FVEKVNFS---------VKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHK 1072
            SG+  Y C   +C K F+H  +L +H       + + C  C   F   S L  H R  H    KP        +HC   P C     +G     H+R H G +P +C +C K F Q + +  H   H  E+ + C  C K+F      L H RT   E R Y        F +  N               C  C++ F +   +  H+ V     E  ++C +C   FG    L KH + H+
Sbjct:  174 SGEKPYRC--PDCGKSFSHGATLAQHRGIHTGARPYQCAACGKAFGWRSTLLKH-RSSHSG-EKP--------HHC---PVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAKGFGQGSALLKHLRTHTGERPYPCPQCGKAFGQSSALLQHQRTHTAE-RPYRCPHCGKAFGQSSNLQHHLRIHTGERPYACPHCSKAFGQSSALLQHLHV--HSGERPYRCQLCGKAFGQASSLTKHKRVHE 398          

HSP 3 Score: 71.2478 bits (173), Expect = 1.653e-11
Identity = 54/218 (24.77%), Postives = 82/218 (37.61%), Query Frame = 2
Query:  692 SGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTEL 1345
            S  +PF C  C + F +++ +  HR  H  EK + C  C KSF +H   LA  R      R Y            C  C + F     +  H        E    C +C   FG    L +H++ H       CP+C + GF   + L  H+ R H+ +  R   C  C   F   + +  H + + A              + CP+ G  F  ++ L
Sbjct:  146 SPPRPFSCPDCGRAFRRSSGLSQHRRTHSGEKPYRCPDCGKSF-SHGATLAQHRGIHTGARPY-----------QCAACGKAFGWRSTLLKHRS--SHSGEKPHHCPVCGKAFGHGSLLAQHLRTHGGPRPHKCPVCAK-GFGQGSALLKHL-RTHTGE--RPYPCPQCGKAFGQSSALLQHQRTHTAERP-----------YRCPHCGKAFGQSSNL 334          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|O95625|ZBT11_HUMAN (Zinc finger and BTB domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZBTB11 PE=1 SV=2)

HSP 1 Score: 92.4337 bits (228), Expect = 5.755e-18
Identity = 62/243 (25.51%), Postives = 103/243 (42.39%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCH 1159
            C K F    SL +H         ++C  C   FH  S L  H ++        PK P    YHCT    C            H+  H G KPF+C  C K ++   +  +H   H   + + C+IC K F    ++  H++   H  +     +   +++ +C  C  +F +L + R HM   + +    F+C  C + + D   LK+H++ H       CP+C+E  ++    L  H+T+ H
Sbjct:  712 CVKSFVTKRSLQEHMSIHTGESKYLCSVCGKSFHRGSGLSKHFKKHQ------PK-PEVRGYHCT---QCEKSFFEARDLRQHMNKHLGVKPFQCQFCDKCYSWKKDWYSHVKSHSVTEPYRCNICGKEFYEKALFRRHVKKATHGKKG----RAKQNLERVCEKCGRKFTQLREYRRHMN--NHEGVKPFECLTCGVAWADARSLKRHVRTHTGERPYVCPVCSE-AYIDARTLRKHMTKFH 937          

HSP 2 Score: 61.6178 bits (148), Expect = 2.266e-8
Identity = 64/243 (26.34%), Postives = 95/243 (39.09%), Query Frame = 2
Query:  677 HIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLE-SMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFS------CPYEGCKFTSNTELLITSHIERHENGK 1384
            H+  H+G KP  C +C K F     +K H+S H S+K F C++C KSF T      H+     E             K +C  C + F +   +  H K    K E   + C+ C+  F +  +L++H+  H       C  C++      +  +H   + HS  V+    C  C   F  +     HVK         + +HG  GR        C   G KFT   E     H+  HE  K
Sbjct:  669 HMLKHTGVKPHACQVCGKTFIYKHGLKLHQSLHQSQKQFQCELCVKSFVTKRSLQEHMSIHTGE------------SKYLCSVCGKSFHRGSGLSKHFKKHQPKPEVRGYHCTQCEKSFFEARDLRQHMNKHLGVKPFQCQFCDKCYSWKKDWYSH--VKSHS--VTEPYRCNICGKEFYEKALFRRHVK---------KATHGKKGRAKQNLERVCEKCGRKFTQLREY--RRHMNNHEGVK 884          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. TrEMBL
Match: A0A0R3UFZ1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS6086 PE=4 SV=1)

HSP 1 Score: 359.762 bits (922), Expect = 9.885e-111
Identity = 171/399 (42.86%), Postives = 251/399 (62.91%), Query Frame = 2
Query:  227 NNEVYLEVLAEDSNDIINGNVNIKFNSDESLHQPILRND-KEYAFVEKDGGFSLEEVS--GKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHV-SEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCD--QKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSS 1405
            + E   E L      +++G   I+ +       P  +        V   GGF        G + Y C   +C   +++AN+ TKH ++ H VK++ CRQC   F  LS+LFLHARR HVDP+KP ++P+ Y++HC     CNYMTNNGGT EHH RAH+G+KPF CD+C+KRF Q ANMKTHR+RH+  +K+F CD C K+F ++DIYLAHLRTREHELRE+F    +  + + CLGC+  F  ++++  H + C   + L++ F+C  C+    D   LK H+K H+ S +I+CP+C E GF  +NQLNHHITR H++KV+R+ VCRYCE  F+ + ++  H++  HA E N+R+S G +GR  C Y  C+FT+N+ +L+  H ++H   + + E ++
Sbjct:   78 SGEGGTEFLQLSDQGLVDGTQLIEVSDQMQFFDPATKTYYGAPGIVSGAGGFLTLAGGQPGGITYRC--PSCPAMYSNANAFTKHMREKHFVKVYTCRQCEEFFETLSQLFLHARRSHVDPKKPKRNPANYKFHCD---QCNYMTNNGGTMEHHKRAHTGEKPFVCDVCNKRFAQKANMKTHRNRHIYRDKIFRCDTCNKAFSSYDIYLAHLRTREHELREHFAMMASSQLSLECLGCSLTFDSIYNLNKHTRSCRIVRTLQTKFRCLPCNAYVSDVASLKAHVKAHEGSHIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFEMKKDLDAHIRSMHAEERNARQSRGAVGRLKCRYSQCEFTTNSIMLLDRHHDQHRRQEEDGEDTA 471          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. TrEMBL
Match: A0A2H1C8Z0 (Zinc finger, C2H2 type OS=Fasciola hepatica OX=6192 GN=D915_08997 PE=4 SV=1)

HSP 1 Score: 354.755 bits (909), Expect = 1.668e-110
Identity = 178/417 (42.69%), Postives = 262/417 (62.83%), Query Frame = 2
Query:  143 VNDALDLEQYLNQIIEINGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLHQPILRNDKEY---AFVEKDGGF-SLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHV-SEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCD--QKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERH 1372
             +D +D+    N I   +G    +  ++  E YL+     ++  + G   I+ ++D+   Q +  N K Y     V    GF +L      V Y C   +C   + +AN+ TKH ++ H VK++ CRQC   F  LS+LFLHARR HVDP+KP ++P+ Y++HC     CNYMTNNGGT EHH RAH+G+KPF CD+C+KRF Q ANMKTHR+RH+  +K+F C+ C K+F ++DIYLAHLRTREHELRE+F    +  + + CLGC   F  ++++  H + C   + L++ F+C  C+    D   LK H+K H+ S +I+CP+C E GF  +NQLNHHITR H++KV+R+ VCRYCE  F+ + ++  H++  HA E N+R+S G +GR  C Y  C+FT+N+ +L+  H ++H
Sbjct:   58 ADDNMDMATLENLIA--SGAVTTVTAENGTE-YLQF----ADPSMEGAQIIELSADQM--QLLDPNSKAYFGATGVAPGAGFVTLAGQPNGVTYRC--PSCPAMYANANAFTKHMREKHFVKVYTCRQCEEFFETLSQLFLHARRSHVDPKKPKRNPANYKFHCD---QCNYMTNNGGTMEHHKRAHTGEKPFVCDVCNKRFAQKANMKTHRNRHIHRDKIFRCETCNKAFSSYDIYLAHLRTREHELREHFAMMASSQLALECLGCAVTFDSIYNLNKHTRSCRIVRTLQTKFRCLPCNAYVSDVASLKAHVKAHEGSQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFEVKKDLDAHIRSMHAEERNARQSRGAVGRLKCRYSHCEFTTNSIMLLDRHHDQH 460          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. TrEMBL
Match: A0A0R3W5T8 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS5506 PE=4 SV=2)

HSP 1 Score: 358.992 bits (920), Expect = 2.168e-110
Identity = 162/338 (47.93%), Postives = 233/338 (68.93%), Query Frame = 2
Query:  398 GKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHV-SEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCD--QKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKS 1402
            G + Y C   +C   +++AN+ TKH ++ H VK++ CRQC   F  LS+LFLHARR HVDP+KP ++P+ Y++HC     CNYMTNNGGT EHH RAH+G+KPF CD+C+KRF Q ANMKTHR+RH+  +K+F CD C K+F ++DIYLAHLRTREHELRE+F    +  + + CLGC+  F  ++++  H + C   + L++ F+C  C+    D   LK H+K H+ S +I+CP+C E GF  +NQLNHHITR H++KV+R+ VCRYCE  F+ + ++  H++  HA E N+R+S G +GR  C Y  C+FT+N+ +L+  H ++H   + + E S
Sbjct:  139 GGITYKC--PSCPAMYSNANAFTKHMREKHFVKVYTCRQCEEFFETLSQLFLHARRCHVDPKKPKRNPANYKFHCD---QCNYMTNNGGTMEHHKRAHTGEKPFVCDVCNKRFAQKANMKTHRNRHIYRDKIFRCDTCNKAFSSYDIYLAHLRTREHELREHFAMMASSQLSLECLGCSLTFDSIYNLNKHTRSCRIVRTLQTKFRCLPCNAYVSDVASLKAHVKAHEGSQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFEMKKDLDTHIRSMHAEERNARQSRGAVGRLKCRYSQCEFTTNSIMLLDRHHDQHRRQEEDGEDS 471          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. TrEMBL
Match: U6J2H9 (Zinc finger and SCAN domain-containing protein 2 OS=Echinococcus granulosus OX=6210 GN=EGR_06219 PE=4 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 2.423e-110
Identity = 162/338 (47.93%), Postives = 233/338 (68.93%), Query Frame = 2
Query:  398 GKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHV-SEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCD--QKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKS 1402
            G + Y C   +C   +++AN+ TKH ++ H VK++ CRQC   F  LS+LFLHARR HVDP+KP ++P+ Y++HC     CNYMTNNGGT EHH RAH+G+KPF CD+C+KRF Q ANMKTHR+RH+  +K+F CD C K+F ++DIYLAHLRTREHELRE+F    +  + + CLGC+  F  ++++  H + C   + L++ F+C  C+    D   LK H+K H+ S +I+CP+C E GF  +NQLNHHITR H++KV+R+ VCRYCE  F+ + ++  H++  HA E N+R+S G +GR  C Y  C+FT+N+ +L+  H ++H   + + E S
Sbjct:  139 GGITYKC--PSCPAMYSNANAFTKHMREKHFVKVYTCRQCEEFFETLSQLFLHARRCHVDPKKPKRNPANYKFHCD---QCNYMTNNGGTMEHHKRAHTGEKPFVCDVCNKRFAQKANMKTHRNRHIYRDKIFRCDTCNKAFSSYDIYLAHLRTREHELREHFAMMASSQLSLECLGCSLTFDSIYNLNKHTRSCRIVRTLQTKFRCLPCNAYVSDVASLKAHVKAHEGSQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFEMKKDLDTHIRSMHAEERNARQSRGAVGRLKCRYSQCEFTTNSIMLLDRHHDQHRRQEEDGEDS 471          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. TrEMBL
Match: A0A0R3WKD6 (Uncharacterized protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS1174 PE=4 SV=1)

HSP 1 Score: 358.992 bits (920), Expect = 2.996e-110
Identity = 162/338 (47.93%), Postives = 233/338 (68.93%), Query Frame = 2
Query:  398 GKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHV-SEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCD--QKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKS 1402
            G + Y C   +C   +++AN+ TKH ++ H VK++ CRQC   F  LS+LFLHARR HVDP+KP ++P+ Y++HC     CNYMTNNGGT EHH RAH+G+KPF CD+C+KRF Q ANMKTHR+RH+  +K+F CD C K+F ++DIYLAHLRTREHELRE+F    +  + + CLGC+  F  ++++  H + C   + L++ F+C  C+    D   LK H+K H+ S +I+CP+C E GF  +NQLNHHITR H++KV+R+ VCRYCE  F+ + ++  H++  HA E N+R+S G +GR  C Y  C+FT+N+ +L+  H ++H   + + E S
Sbjct:  139 GGITYRC--PSCPAVYSNANAFTKHMREKHFVKVYTCRQCEEFFETLSQLFLHARRCHVDPKKPKRNPANYKFHCD---QCNYMTNNGGTMEHHKRAHTGEKPFVCDVCNKRFAQKANMKTHRNRHIYRDKIFRCDTCNKAFSSYDIYLAHLRTREHELREHFAMMASSQLSLECLGCSLTFDSIYNLNKHTRSCRIVRTLQTKFRCLPCNAYVSDVASLKAHVKAHEGSQIISCPVCGERGFPGFNQLNHHITRAHALKVNRRHVCRYCESTFEMKKDLDTHIRSMHAEERNARQSRGAVGRLKCRYSQCEFTTNSIMLLDRHHDQHRRQEEDGEDS 471          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Cavefish
Match: GZF1 (GDNF inducible zinc finger protein 1 [Source:HGNC Symbol;Acc:HGNC:15808])

HSP 1 Score: 97.8265 bits (242), Expect = 1.096e-20
Identity = 96/392 (24.49%), Postives = 158/392 (40.31%), Query Frame = 2
Query:  146 NDALDLEQYLNQIIEINGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFN---SDESLHQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKI---FVCRQCPGIFHELSELFLHARREHVDPRKPP-----------KDPSKYR----------YHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHV 1240
            ++ALD+ +  N+      +   +N+ ++ E   +V  E+   + +G+    FN   +DE  H P     +     E+      E+ SG  KY C  Q C + F +  S  KH K  H ++    + C  C   F     L +H R  H D R  P           KD +++R          Y+CT    C    ++      H R H+GDKP+ C+ C  RF+Q++ ++TH+  H  EK F CD+C   F  + +   H R    E               +C  C + F     +++H ++        +KC  C   F     L +H+K H       C  C++  F   N L  H  R H+ +  +  +C  C   F  ++ +  H 
Sbjct:  203 SEALDITESPNESETRTTQEEPLNICESKEASDKVFPENEALMDSGSEAGSFNIDLADEEFHDPEFLPAEAK---EETDEAEKEQKSGSSKYDC--QKCCRSFRYEKSYLKHVKVSHGIETDTTYRCDICQQTFANRCNLKIHKRHVHNDDRLFPCDVCKKAFKRKKDVTRHRRQVHEGGTERYYCTI---CGKSLSSRTALTLHERTHTGDKPYSCNECEARFSQSSALRTHQRIHTGEKPFACDMCDAKFTQNHMLAYHKRCHTGE------------KPFMCENCGKSFASKEYLKHHARI--HSGFKPYKCDNCGRAFAQRNSLHQHMKIHTGERPYHCKECDKQ-FTQLNALQRH-QRIHTGE--KPYMCSVCGRTFTDKSTVRRHA 568          

HSP 2 Score: 57.7658 bits (138), Expect = 3.050e-8
Identity = 60/244 (24.59%), Postives = 100/244 (40.98%), Query Frame = 2
Query:  527 FHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSG---DKPFECDICHKRFTQNANMKTHRSRHV--SEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVK 1243
            FH+   L   A+ E  +  K  K  S  +Y C     C        ++  H++   G   D  + CDIC + F    N+K H+ RHV   ++LF CD+CKK+FK       H R    ++ E   E+        C  C +       +  H +      +  + C+ C+  F     L+ H + H      AC +C+   F   + L +H  RCH+ +  +  +C  C   F ++  +  H +
Sbjct:  263 FHDPEFLPAEAKEETDEAEKEQKSGSS-KYDCQ---KCCRSFRYEKSYLKHVKVSHGIETDTTYRCDICQQTFANRCNLKIHK-RHVHNDDRLFPCDVCKKAFKRKKDVTRHRR----QVHEGGTERY------YCTICGKSLSSRTALTLHERT--HTGDKPYSCNECEARFSQSSALRTHQRIHTGEKPFACDMCD-AKFTQNHMLAYH-KRCHTGE--KPFMCENCGKSFASKEYLKHHAR 485          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000011224.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000150.1:481345:489652:-1 gene:ENSAMXG00000010930.2 transcript:ENSAMXT00000011224.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 2.877e-19
Identity = 81/284 (28.52%), Postives = 118/284 (41.55%), Query Frame = 2
Query:  317 LHQPILRNDKEYAFVEKDGGFSLEEV--------SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHH 1144
            +HQ I   +K Y  ++    FS +          +G+  Y  H  +C   F   + L  H +    VK + C +C   F   SE  +H R   +   + P       YHC+   DC       GT + H R H+G+KP+ C  C K FTQ  N++ H+  H  EK + C  CKKSF THD    H R        +  EK N+     C  C ++F    D++ H ++     E  + CS C   F     L++H + H       C  C E  F   + L  H
Sbjct:  507 IHQRIHTGEKPYNCLDCGNSFSAQSDLKRHQRIHTGEKPY--HCSDCGNSFTTQSHLKLHQRIHTGVKPYHCSECERFFTTHSEFKIHQR---IHTGEKP-------YHCS---DCGKSFTQKGTLQQHQRIHTGEKPYHCSDCGKSFTQKGNLQQHQRIHTGEKPYYCSTCKKSFITHDTLKIHQRI-------HTGEKPNY-----CSMCKKRFITQSDLKKHQRI--HTGEKPYHCSDCGKSFTQKGALQQHQRVHTGEKPYYCSDC-EKCFTTQSDLKRH 760          

HSP 2 Score: 75.8702 bits (185), Expect = 9.021e-14
Identity = 63/237 (26.58%), Postives = 92/237 (38.82%), Query Frame = 2
Query:  437 KQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHI 1147
            K     + L KH +    VK + C  C   +   S L +H R   +   + P       YHC+   DC       G  + H R H+G+KP+ C  C K F     +K H+  H  +K + C  C KSF +      H R    E + Y            C  C + F +  D++ H ++     +  + CS C   F     LK H + H       CP C E  F H + L  H+
Sbjct:  116 KSLTAQSKLKKHQRVHTGVKPYSCSDCGKSYTTQSYLRIHQR---IHKEEKP-------YHCS---DCGQSFKRKGNLQQHQRIHTGEKPYHCSDCGKTFKTQNYLKIHQHHHTGKKPYKCSDCGKSFASQGTLKLHQRIHTGE-KPYH-----------CSDCGKSFTQQHDLKMHQRI--HTGDKPYYCSNCGKNFSQLSTLKIHQRIHTGEKPYHCPEC-EKSFPHLSHLKQHL 324          

HSP 3 Score: 71.2478 bits (173), Expect = 2.134e-12
Identity = 92/362 (25.41%), Postives = 140/362 (38.67%), Query Frame = 2
Query:  317 LHQPILRNDKEYAFVEKDGGFSLEEV--------SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKT----HDIY------------------LAHLRTRE--HELREYFVEKVNFSV---------KVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDH------VKEYHANE 1261
            LHQ I   +K Y   +    F+ +          +G   Y C   NC K F+  ++L  H +     K + C +C   F  LS L  H R   +   + P       YHC+   DC    N+ G  + H+R H+G+KP++C  C K FT  + +  H+  H  EK F C  CKK F      + IY                    HL   E  H   + F  +++ S+            C  C + F +  +++ H ++     E  + CS C+  F     LK H + H       C  C    F   + L  H  R H+ +  +   C  C   F T++ +  H      VK YH +E
Sbjct:  238 LHQRIHTGEKPYHCSDCGKSFTQQHDLKMHQRIHTGDKPYYC--SNCGKNFSQLSTLKIHQRIHTGEKPYHCPECEKSFPHLSHLKQHLR---IHTGEKP-------YHCS---DCGKSFNSQGALKLHLRIHTGEKPYQCSDCGKSFTLKSTLNIHQRLHTGEKPFQCLDCKKRFTQRKSENSIYNVKLLEERRKLFSTCKYCFLHLTDMEKHHHPVKSFTAQIDLSIDQRIHTGEKPYHCSDCGKSFPRQGNLQRHQRI--HTGEKPYYCSDCEKSFTTQSYLKIHQRIHTGEKPYNCLDCGN-SFSAQSDLKRH-QRIHTGE--KPYHCSDCGNSFTTQSHLKLHQRIHTGVKPYHCSE 578          

HSP 4 Score: 69.707 bits (169), Expect = 6.630e-12
Identity = 64/242 (26.45%), Postives = 98/242 (40.50%), Query Frame = 2
Query:  419 HIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHH 1144
            H  +C + F    +L +H +     K + C  C   F   + L +H  + H   +KP        Y C+   DC     + GT + H R H+G+KP+ C  C K FTQ  ++K H+  H  +K + C  C K+F        H R    E + Y            C  C + F  L  ++ H+++     E  + CS C   F     LK H++ H       C  C +  F   + LN H
Sbjct:  166 HCSDCGQSFKRKGNLQQHQRIHTGEKPYHCSDCGKTFKTQNYLKIH--QHHHTGKKP--------YKCS---DCGKSFASQGTLKLHQRIHTGEKPYHCSDCGKSFTQQHDLKMHQRIHTGDKPYYCSNCGKNFSQLSTLKIHQRIHTGE-KPYH-----------CPECEKSFPHLSHLKQHLRI--HTGEKPYHCSDCGKSFNSQGALKLHLRIHTGEKPYQCSDCGK-SFTLKSTLNIH 379          

HSP 5 Score: 53.9138 bits (128), Expect = 5.965e-7
Identity = 49/192 (25.52%), Postives = 76/192 (39.58%), Query Frame = 2
Query:  302 NSDESLHQPILRNDKEY-------AFVEKDGGFSLEEV-SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLR 853
            +S+  +HQ I   +K Y       +F +K      + + +G+  Y  H  +C K F    +L +H +     K + C  C   F     L +H R   +   + P           Y   C          + H R H+G+KP+ C  C K FTQ   ++ H+  H  EK + C  C+K F T      H R
Sbjct:  586 HSEFKIHQRIHTGEKPYHCSDCGKSFTQKGTLQQHQRIHTGEKPY--HCSDCGKSFTQKGNLQQHQRIHTGEKPYYCSTCKKSFITHDTLKIHQR---IHTGEKP----------NYCSMCKKRFITQSDLKKHQRIHTGEKPYHCSDCGKSFTQKGALQQHQRVHTGEKPYYCSDCEKCFTTQSDLKRHQR 762          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Cavefish
Match: ENSAMXT00000033814.1 (gastrula zinc finger protein XlCGF53.1-like [Source:NCBI gene;Acc:103031168])

HSP 1 Score: 89.7373 bits (221), Expect = 7.690e-19
Identity = 88/329 (26.75%), Postives = 122/329 (37.08%), Query Frame = 2
Query:  305 SDESLHQPILRNDKEYAFVEKDGGFSLEEV--------SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEIN 1267
            SD   HQ I   ++ +        F+L           SG   + C  Q C K F H ++LT H +     K F C  C   F+ +  L   A++  V  +  PK  +  R+ C+Y P      NN  T   H R H+G+KPF C +C KRF    N+ TH   H   K + C  C KSF       AH R    E                C  C + F        H ++     E  F CS+C   F     L  H + H  S    C  C +  F H   L  H  R H+ +  +   C  C   F        H+  +  N ++
Sbjct:   74 SDLKRHQRIHTGERPFGCAVCGKRFALRGNLITHERGHSGSKPFSC--QQCGKSFAHGSNLTAHQRVHTGEKPFCCSLCGKTFNSVGSL--SAKQTKV--KNQPKTRTHKRWTCSYCPK---SFNNTSTLNRHQRIHTGEKPFGCAVCGKRFADRGNLITHERGHSGSKPYTCQQCGKSFAHCSNLTAHQRVHTGE------------KPFCCSLCGKSF-------RHQRI--HTGEKPFGCSVCGKRFAHRGNLITHERGHSGSKPYTCQQCGK-SFAHGPNLTAH-QRVHTGE--KPFCCSLCGKTFAWHYPFKRHMALHGQNGLS 368          

HSP 2 Score: 71.2478 bits (173), Expect = 8.897e-13
Identity = 56/207 (27.05%), Postives = 77/207 (37.20%), Query Frame = 2
Query:  590 PKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHE-------LREYFVEKVNFSVK---------------VICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHH 1144
            PK  ++    CT+ P      NN    + H R H+G++PF C +C KRF    N+ TH   H   K F+C  C KSF       AH R    E         + F    + S K                 C  C + F     +  H ++     E  F C++C   F D   L  H + H  S    C  C +  F H + L  H
Sbjct:   53 PKTSAQKPLPCTFCPK---SFNNASDLKRHQRIHTGERPFGCAVCGKRFALRGNLITHERGHSGSKPFSCQQCGKSFAHGSNLTAHQRVHTGEKPFCCSLCGKTFNSVGSLSAKQTKVKNQPKTRTHKRWTCSYCPKSFNNTSTLNRHQRI--HTGEKPFGCAVCGKRFADRGNLITHERGHSGSKPYTCQQCGK-SFAHCSNLTAH 253          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Cavefish
Match: zbtb11 (zinc finger and BTB domain containing 11 [Source:NCBI gene;Acc:103037019])

HSP 1 Score: 91.2781 bits (225), Expect = 1.986e-18
Identity = 68/274 (24.82%), Postives = 113/274 (41.24%), Query Frame = 2
Query:  419 HIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHV 1240
            H   C K F    SL +H         + C QC   FH  S L  H ++        PK P    + CT+   C+         + H+  H G KPF+C +C K ++   +  +H   H   + F C++C K F    ++  H++   H  +     +V  +++  C  C  +F +L + R HM   + +    F+C  C + + D   LK+H++ H       CP+C E   +    L  HIT+ H   +  K +     L F  +    +H 
Sbjct:  806 HCTICEKSFVTKRSLDEHTSIHTGESKYSCSQCGTSFHRASGLSKHLKKHQ------PK-PMVRAFQCTH---CDKSFFELKDLQQHMNKHLGLKPFQCQVCGKCYSWKKDWYSHVKSHTVAEPFRCNVCGKEFFEKALFRRHVKKATHGKKG----RVKQNLERECEHCGRKFTQLREYRRHMN--NHQGVKPFECLTCGVAWADARSLKRHVRTHTGERPYVCPLCEE-AHIDARTLRKHITKYHGDHLPGKIMLEKDTLQFHNQGTQVEHA 1062          

HSP 2 Score: 66.6254 bits (161), Expect = 6.754e-11
Identity = 58/228 (25.44%), Postives = 91/228 (39.91%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPD-CNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQK-LESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNE 1108
            C K+F +A SL  H    H              H+ S+    +R   V+  + P+  SK R    +  D C        +   H+  H+G +P  C +C K F    ++  HR+ H S K F+C IC+KSF T      H      E             K  C  C   F +   +  H+K    K +   F+C+ CD  F + ++L++H+  H       C +C +
Sbjct:  698 CNKEFQYATSLRAHLAR-HK-------------HQKSQRVAASRGPAVEDAEEPEGQSKGRTKREFVCDICGKTLPKLYSLRIHMLTHTGVRPHACRLCGKSFATKHSLNMHRALHDSVKRFHCTICEKSFVTKRSLDEHTSIHTGE------------SKYSCSQCGTSFHRASGLSKHLKKHQPKPMVRAFQCTHCDKSFFELKDLQQHMNKHLGLKPFQCQVCGK 899          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Cavefish
Match: zbtb11 (zinc finger and BTB domain containing 11 [Source:NCBI gene;Acc:103037019])

HSP 1 Score: 90.8929 bits (224), Expect = 2.003e-18
Identity = 68/274 (24.82%), Postives = 113/274 (41.24%), Query Frame = 2
Query:  419 HIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHV 1240
            H   C K F    SL +H         + C QC   FH  S L  H ++        PK P    + CT+   C+         + H+  H G KPF+C +C K ++   +  +H   H   + F C++C K F    ++  H++   H  +     +V  +++  C  C  +F +L + R HM   + +    F+C  C + + D   LK+H++ H       CP+C E   +    L  HIT+ H   +  K +     L F  +    +H 
Sbjct:  621 HCTICEKSFVTKRSLDEHTSIHTGESKYSCSQCGTSFHRASGLSKHLKKHQ------PK-PMVRAFQCTH---CDKSFFELKDLQQHMNKHLGLKPFQCQVCGKCYSWKKDWYSHVKSHTVAEPFRCNVCGKEFFEKALFRRHVKKATHGKKG----RVKQNLERECEHCGRKFTQLREYRRHMN--NHQGVKPFECLTCGVAWADARSLKRHVRTHTGERPYVCPLCEE-AHIDARTLRKHITKYHGDHLPGKIMLEKDTLQFHNQGTQVEHA 877          

HSP 2 Score: 66.6254 bits (161), Expect = 7.179e-11
Identity = 76/308 (24.68%), Postives = 116/308 (37.66%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPD-CNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQK-LESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFS------CPYEGCKFT 1330
            C K+F +A SL  H    H              H+ S+    +R   V+  + P+  SK R    +  D C        +   H+  H+G +P  C +C K F    ++  HR+ H S K F+C IC+KSF T      H      E             K  C  C   F +   +  H+K    K +   F+C+ CD  F + ++L++H+  H       C +C +     Y+      +   S  V+    C  C   F  +     HVK         + +HG  GR        C + G KFT
Sbjct:  513 CNKEFQYATSLRAHLAR-HK-------------HQKSQRVAASRGPAVEDAEEPEGQSKGRTKREFVCDICGKTLPKLYSLRIHMLTHTGVRPHACRLCGKSFATKHSLNMHRALHDSVKRFHCTICEKSFVTKRSLDEHTSIHTGE------------SKYSCSQCGTSFHRASGLSKHLKKHQPKPMVRAFQCTHCDKSFFELKDLQQHMNKHLGLKPFQCQVCGKC----YSWKKDWYSHVKSHTVAEPFRCNVCGKEFFEKALFRRHVK---------KATHGKKGRVKQNLERECEHCGRKFT 781          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008822.1 (pep scaffold:Pmarinus_7.0:GL477256:50027:56378:-1 gene:ENSPMAG00000007983.1 transcript:ENSPMAT00000008822.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 87.0409 bits (214), Expect = 1.373e-18
Identity = 86/330 (26.06%), Postives = 126/330 (38.18%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAH----------LRTREHELREYFV-------EKVNFSVKVICLGCNE------QFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYE 1315
            +G+  Y C    C   F    +L  H +     K FVC  C   F   S L +H RR H   R          Y CT    C        + + H+R H+G+KPFEC++C K F    N+ +H   H  E+LF C+ C K F        H          ++     L    V       E    +   +  GC E      QF +  +   HM      LE +  C++C  L    E L++H K HK      C IC +  F   N L  H+     +   R   C+YC++ F     +  H+K  H   + + +      RF+ P +
Sbjct:   28 TGEKPYKC--SQCDASFTIQTNLRTHMRKHSGEKPFVCESCGQCFRNRSTLTVH-RRRHTQERP---------YACTV---CGARFRQSDSCKTHMRIHTGEKPFECNVCGKTFANRGNLPSHMRLHTGERLFQCEYCGKKFTLKGTMQKHVNSIHNPQNVVKPSSSSLGRRLVKVETVQEEYCGVTTSTLAGGCFECSACALQFSRQTEFVVHMAG-HNGLE-VLSCTVCKKLCVGQEALERHTKAHKH----VCEICGK-NFTSSNNLTQHMNLHLDV---RPYKCQYCDVAFHRNNSLWSHIKARHNYGLPAYQCTHCNKRFATPSQ 332          

HSP 2 Score: 72.7886 bits (177), Expect = 6.829e-14
Identity = 60/233 (25.75%), Postives = 98/233 (42.06%), Query Frame = 2
Query:  665 TFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHS----IKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLI 1351
            +F  H R H+G+KP++C  C   FT   N++TH  +H  EK F C+ C + F+       H R R  + R Y            C  C  +F +    + HM++     E  F+C++C   F +   L  H++ H    L  C  C +  F     +  H+   H+    +K S  S+ R    + + ET     V+E +     S  + G    F C     +F+  TE ++
Sbjct:   19 SFNEHQRLHTGEKPYKCSQCDASFTIQTNLRTHMRKHSGEKPFVCESCGQCFRNRSTLTVH-RRRHTQERPY-----------ACTVCGARFRQSDSCKTHMRI--HTGEKPFECNVCGKTFANRGNLPSHMRLHTGERLFQCEYCGKK-FTLKGTMQKHVNSIHNPQNVVKPSSSSLGRR---LVKVET-----VQEEYCGVTTSTLAGGC---FECSACALQFSRQTEFVV 225          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008540.1 (pep scaffold:Pmarinus_7.0:GL486672:772:1638:-1 gene:ENSPMAG00000007731.1 transcript:ENSPMAT00000008540.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.411 bits (189), Expect = 1.899e-16
Identity = 47/149 (31.54%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  647 MTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKL-----ESMFKCSICDILFGDFEELKKHIKNHKES 1078
             +++  T + H+  H+G+KPF C+IC++ FTQNA +KTH   H  EK F C IC + F        HLR    E          +  K+    CN+ F + F+++ H+      L     +S ++C +CD  F     LK H+  H++S
Sbjct:   81 FSHSTATLKTHMHTHTGEKPFRCEICNRGFTQNATLKTHLHVHTGEKPFRCKICNRGFTQSSKLKVHLRLHTGE--------KPYRCKI----CNQAFTQSFNLKIHLSTLKTHLRRHAGKSPYQCGVCDREF----LLKAHLSAHQQS 213          

HSP 2 Score: 67.3958 bits (163), Expect = 5.066e-13
Identity = 54/189 (28.57%), Postives = 83/189 (43.92%), Query Frame = 2
Query:  698 DKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYL---AHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEP---GF---VHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDH 1237
            ++P  CD+C  RF+Q+A++++HR  H  +K F CD C K F      L    H  T E   R              C  CN  F +   ++ H+ V     E  F+C IC+  F    +LK H++ H       C ICN+     F   +H + L  H+ R H+ K   +  C  C+  F  +  ++ H
Sbjct:   41 ERPHRCDVCELRFSQHAHLESHRRTHTGDKPFGCDACGKRFSHSTATLKTHMHTHTGEKPFR--------------CEICNRGFTQNATLKTHLHV--HTGEKPFRCKICNRGFTQSSKLKVHLRLHTGEKPYRCKICNQAFTQSFNLKIHLSTLKTHLRR-HAGKSPYQ--CGVCDREFLLKAHLSAH 210          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009055.1 (pep scaffold:Pmarinus_7.0:GL477074:18725:22562:1 gene:ENSPMAG00000008196.1 transcript:ENSPMAT00000009055.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 3.312e-16
Identity = 42/142 (29.58%), Postives = 65/142 (45.77%), Query Frame = 2
Query:  683 RAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNE 1108
            R H+G+KP+ C++C++ F Q+ N+K H   H  +K + CDIC  SF        H RT+                +  C  C E  C    ++ H +V     E  F+CS+C+  F +   L+ H + H       C ICN+
Sbjct:    1 RIHTGEKPYRCEMCNRSFAQSCNLKVHERTHTGQKPYRCDICNSSFSRSHHLTGHQRTQ------------TGHKEPFCAECEEAACTRPTLQYHHRV--HTGEKPFRCSVCNRSFSNSGNLRVHERTHTGEKPYRCKICNK 128          

HSP 2 Score: 61.6178 bits (148), Expect = 1.377e-11
Identity = 42/156 (26.92%), Postives = 66/156 (42.31%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARRE--HVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRT 856
            +G+  Y C +  C + F  + +L  H +     K + C  C   F     L  H R +  H +P               +  +C        T ++H R H+G+KPF C +C++ F+ + N++ H   H  EK + C IC K FK       H RT
Sbjct:    4 TGEKPYRCEM--CNRSFAQSCNLKVHERTHTGQKPYRCDICNSSFSRSHHLTGHQRTQTGHKEP---------------FCAECEEAACTRPTLQYHHRVHTGEKPFRCSVCNRSFSNSGNLRVHERTHTGEKPYRCKICNKCFKQSQHLKGHERT 142          

HSP 3 Score: 48.1358 bits (113), Expect = 5.668e-7
Identity = 36/133 (27.07%), Postives = 56/133 (42.11%), Query Frame = 2
Query:  677 HIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLR--TREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNH 1069
            H R H+G KP+ CDIC+  F+++ ++  H+      K   C  C+++  T      H R  T E   R              C  CN  F    ++R H +      E  ++C IC+  F   + LK H + H
Sbjct:   27 HERTHTGQKPYRCDICNSSFSRSHHLTGHQRTQTGHKEPFCAECEEAACTRPTLQYHHRVHTGEKPFR--------------CSVCNRSFSNSGNLRVHERT--HTGEKPYRCKICNKCFKQSQHLKGHERTH 143          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007433.1 (pep scaffold:Pmarinus_7.0:GL498585:318:1981:-1 gene:ENSPMAG00000006708.1 transcript:ENSPMAT00000007433.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.8702 bits (185), Expect = 3.870e-16
Identity = 50/172 (29.07%), Postives = 83/172 (48.26%), Query Frame = 2
Query:  632 PDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKL-FNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHH 1144
            P C  +  +  + + H   H+G KPFECD C K FT   ++++H+  H+ +K  + C  C++S+      L  LRT  H  R +  +K      ++CL C + F +L  +R H +    K +    CS C   F + + L++H + HKE   + C  C +  F   + L  H
Sbjct:   20 PVCTKVFASPESVQSHRAVHNGKKPFECDACGKAFTHAKDLRSHQRVHLRKKKGYKCKRCERSY----TRLGALRT--HHERSHEEQKP-----LLCLECGDAFTELDSLRRHERT--HKEQKPLLCSECGEAFTELDSLRRHERTHKEQKPLLCSECGK-AFTELDSLRQH 177          

HSP 2 Score: 46.595 bits (109), Expect = 4.213e-6
Identity = 34/151 (22.52%), Postives = 59/151 (39.07%), Query Frame = 2
Query:  743 NANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLR-----------------TREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHH 1144
            +  +KTH   H SEK + C +C K F + +   +H                   T   +LR +    +       C  C   + +L  +R H +   ++ + +  C  C   F + + L++H + HKE   + C  C E  F   + L  H
Sbjct:    1 SGTLKTHEKSHTSEKTYKCPVCTKVFASPESVQSHRAVHNGKKPFECDACGKAFTHAKDLRSHQRVHLRKKKGYKCKRCERSYTRLGALRTHHERSHEEQKPLL-CLECGDAFTELDSLRRHERTHKEQKPLLCSECGE-AFTELDSLRRH 149          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001529.1 (pep scaffold:Pmarinus_7.0:GL483083:8841:14719:-1 gene:ENSPMAG00000001385.1 transcript:ENSPMAT00000001529.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 5.752e-16
Identity = 75/303 (24.75%), Postives = 125/303 (41.25%), Query Frame = 2
Query:  323 QPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKY-------RYHCTYSPD----CNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLR------------------TREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHH 1144
            +P+L ++   AF E D      E S K +       C + F   +SL +H +   D K  +C +C   F EL  L  H R             + +       + H +  P+    C  +  + GT   H ++H+ +K ++C +C K F    N+++HR+ H  +K F CD C K F       +H R                  TR   LR +     N     +C  C E F +L  +R H +  +++   +F  S C   F + + L++H ++H+E   + C  C E  F   + L+ H
Sbjct:  335 KPLLCSECGEAFTELDS-LRQHERSHKDQKPLLCSECGEAFTELDSLRQHERTHKDQKPLLCSECGEAFTELDSLRQHERSHTRMVMMVRMVVAHFGKLRRHEKSHTSEKPNKCATCGKVFAHLGTLRSHEKSHTSEKTYKCPVCTKVFATLQNVQSHRAVHNGKKPFECDACGKVFANAKDLCSHQRVHLCKKKGYKCKRCERSYTRLGALRTHEKTHTN-DAPHVCSECGEVFTELDSLRQHERTHEEQKPLLF--SECGEEFTELDSLRRHERSHEEQKPLLCSECGE-AFTELDSLHQH 632          

HSP 2 Score: 69.707 bits (169), Expect = 1.250e-12
Identity = 53/200 (26.50%), Postives = 87/200 (43.50%), Query Frame = 2
Query:  611 RYHCTYSPD----CNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLR------------------TREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHH 1144
            R H +  P+    C  +  N GT   H ++H+ +K ++C +C K F    N+++HR+ H  +K F CD C K F       +H R                  TR   LR +     N     +C  C E F +L  +R H +   ++ + +  CS C   F + + L++H ++H+E   + C  C E  F   + L  H
Sbjct:    6 RTHTSEKPNKCATCGKVFVNLGTLRSHEKSHTSEKTYKCPVCTKVFATLQNVQSHRAVHNGKKPFECDACGKVFANAKDLCSHQRVHLCKKKGYKCKRCERSYTRLGALRTHEKTHTN-DAPHVCSECGEVFTELDSLRRHHERSHEEQKPLL-CSECGEAFTELDSLRQHERSHEEQKPLLCSECGE-AFTELDSLRQH 202          

HSP 3 Score: 69.3218 bits (168), Expect = 1.633e-12
Identity = 67/282 (23.76%), Postives = 108/282 (38.30%), Query Frame = 2
Query:  323 QPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHAR--------REHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHH 1144
            +P+L ++   AF E D     E    + K +     C + F   +SL +H +   + K  +C +C   F EL  L  H R        R+H    +  K             +C        +   H R+H   KP  C  C + FT+  ++  H   H  +K   C  C ++F   D    H RT + +              ++C  C E F +L  +R H +    K +    CS C   F + + L++H + HK+   + C  C E  F   + L  H
Sbjct:  154 KPLLCSECGEAFTELDSLRQHERSHEEQKPLL-CSECGEAFTELDSLRQHERTHEEQKPLLCSECGEAFTELDSLRRHERIHTELDSLRQHERSHEEQKP--------LLCSECGEAFTELDSLRQHERSHEEQKPLLCSECGEAFTELDSLHQHERTHEEQKPLLCSECGEAFTELDSLRQHERTHKDQ------------KPLLCSECGEAFTELDSLRQHER--SHKDQKPLLCSECGEAFTELDSLRQHERTHKDQKPLLCSECGE-AFTELDSLRQH 411          

HSP 4 Score: 68.5514 bits (166), Expect = 3.063e-12
Identity = 64/251 (25.50%), Postives = 103/251 (41.04%), Query Frame = 2
Query:  401 KVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLR--TREHELREYFVEKVNFSVK-VICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHH 1144
            K  Y C  + C + +    +L  H K   +    VC +C  +F EL  L  H  R H + +KP               +C        +   H R+H   KP  C  C + FT+  +++ H   H  +K   C  C ++F   D    H R  T    LR++  E+ +   K ++C  C E F +L  +R H +  ++  +    CS C   F + + L +H + H+E   + C  C E  F   + L  H
Sbjct:   96 KKGYKC--KRCERSYTRLGALRTHEKTHTNDAPHVCSECGEVFTELDSLRRHHERSH-EEQKP-----------LLCSECGEAFTELDSLRQHERSHEEQKPLLCSECGEAFTELDSLRQHERTHEEQKPLLCSECGEAFTELDSLRRHERIHTELDSLRQH--ERSHEEQKPLLCSECGEAFTELDSLRQHERSHEE--QKPLLCSECGEAFTELDSLHQHERTHEEQKPLLCSECGE-AFTELDSLRQH 327          

HSP 5 Score: 60.8474 bits (146), Expect = 8.291e-10
Identity = 55/247 (22.27%), Postives = 86/247 (34.82%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKV----------------------CDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICN 1105
            C + F   +SL +H +   + K  +C +C   F EL  L  H R    + +KP               +C        +   H R H   KP  C  C + FT+  +++ H   H  +K   C  C ++F   D    H RT + +              ++C  C E F +L  +R H +                            E   KC+ C  +F     L+ H K+H       CP+C 
Sbjct:  258 CGEAFTELDSLRQHERSHEEQKPLLCSECGEAFTELDSLHQHERTH--EEQKP-----------LLCSECGEAFTELDSLRQHERTHKDQKPLLCSECGEAFTELDSLRQHERSHKDQKPLLCSECGEAFTELDSLRQHERTHKDQ------------KPLLCSECGEAFTELDSLRQHERSHTRMVMMVRMVVAHFGKLRRHEKSHTSEKPNKCATCGKVFAHLGTLRSHEKSHTSEKTYKCPVCT 479          

HSP 6 Score: 58.151 bits (139), Expect = 5.080e-9
Identity = 65/275 (23.64%), Postives = 110/275 (40.00%), Query Frame = 2
Query:  410 YICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHC----------TYSPDCNYMTNNGGTF--------EHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFK------------CSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHH 1144
            Y C +  C K F    ++  H    +  K F C  C  +F    +L  H +R H+  +K  K     R +           T++ D  ++ +  G           HH R+H   KP  C  C + FT+  +++ H   H  +K   C  C ++F   D    H RT E +              ++C  C E F +L  +R H ++   +L+S+ +            CS C   F + + L++H ++H+E   + C  C E  F   + L+ H
Sbjct:   42 YKCPV--CTKVFATLQNVQSHRAVHNGKKPFECDACGKVFANAKDLCSH-QRVHLCKKKGYKCKRCERSYTRLGALRTHEKTHTNDAPHVCSECGEVFTELDSLRRHHERSHEEQKPLLCSECGEAFTELDSLRQHERSHEEQKPLLCSECGEAFTELDSLRQHERTHEEQ------------KPLLCSECGEAFTELDSLRRHERI-HTELDSLRQHERSHEEQKPLLCSECGEAFTELDSLRQHERSHEEQKPLLCSECGE-AFTELDSLHQH 299          

HSP 7 Score: 56.225 bits (134), Expect = 1.795e-8
Identity = 46/163 (28.22%), Postives = 65/163 (39.88%), Query Frame = 2
Query:  677 HIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKV--CDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCH 1159
            H R H+ +KP +C  C K F     +++H   H SEK + C +C K F T     +H        R     K  F     C  C + F    D+ +H +V  C +K    +KC  C+  +     L+ H K H       C  C E  F   + L  H  R H
Sbjct:    4 HKRTHTSEKPNKCATCGKVFVNLGTLRSHEKSHTSEKTYKCPVCTKVFATLQNVQSH--------RAVHNGKKPFE----CDACGKVFANAKDLCSHQRVHLCKKK---GYKCKRCERSYTRLGALRTHEKTHTNDAPHVCSECGEV-FTELDSLRRHHERSH 150          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 79.337 bits (194), Expect = 1.038e-15
Identity = 88/326 (26.99%), Postives = 139/326 (42.64%), Query Frame = 2
Query:   95 NLENFETDFLETSEYNVNDALDLEQYLNQIIEINGKHYQINVDDNNEVYLEVLAE--DSNDIINGNVNIKFNSDESLHQPIL----RNDKEYAFVE-----------KDG-----GFSLEEVSGKVKYICHIQNCYKQFNHANSLTK---------HYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYR----YHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNH 967
            N+ N E   L +++   N   DL++   ++     KH  +N +DN   Y   ++   D ND+I G+  +  + DES  QP +    + D    +V+           KD      G ++   SGK   I  I +      +    TK           K     K+   +    +F++  ++ L  + E V   + PK     R    + C Y   C+ + +     E H+R+H G KPF CD C KRFTQ  N++TH   H  EK ++CDIC K F       AHL T  H+  + FV K+          CN+ F +L +++ H
Sbjct:  395 NIPNQEDHSLASTDTTSNSRKDLKEIEQRLR----KH--LNDEDN---YSSAISRPLDKNDVIEGSEGLNKHIDESGMQPNIIKKRKKDDSTVYVKNEMPRTDPPMSKDNSTSAEGAAMANFSGKEPPIPDISSVSDDATNLIGATKVDQLMLIIQARKKGFTEKVNTTQDGDLLFNQTMDI-LPPKSELVGGVEKPKGTQNTRAVKKHECPY---CHRLFSQATHLEVHVRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHLVT--HQKLKPFVCKLE--------NCNKTFTQLGNMKAH 697          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Yeast
Match: PZF1 (Transcription factor IIIA (TFIIIA); essential DNA binding protein required for transcription of 5S rRNA by RNA polymerase III; not involved in transcription of other RNAP III genes; nine conserved zinc fingers; may also bind 5S rRNA [Source:SGD;Acc:S000006390])

HSP 1 Score: 69.707 bits (169), Expect = 5.408e-13
Identity = 62/236 (26.27%), Postives = 100/236 (42.37%), Query Frame = 2
Query:  614 YHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAH----------------LRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHM-KVCDQKLESMFKCSI--CDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYC-ELIFQTETEMTDHVKEYHANE 1261
            Y C Y       T      EH +  H G + F+CD C K F + ++++ H   H   K F C  C K   T      H                LR  +H      +  V+   K+ C  CN+ F + + +RNH+ K  D ++E+ ++C+   C   F  + +L+ HIKN  +   + CPIC++P  V  N L  H+       V++   C  C ++ F  + ++  H    H  E
Sbjct:   49 YFCDYDGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHEVTHTKSFICPEEGCNLRFYKHPQLRAHILSVHLH-KLTCPHCNKSFQRPYRLRNHISKHHDPEVENPYQCTFAGCCKEFRIWSQLQSHIKN--DHPKLKCPICSKP-CVGENGLQMHMIIHDDSLVTKNWKCHICPDMSFSRKHDLLTHYGSIHTEE 280          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 64.3142 bits (155), Expect = 4.177e-11
Identity = 44/141 (31.21%), Postives = 64/141 (45.39%), Query Frame = 2
Query:  398 GKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSF 820
            GK +Y C   +C++ F     L +H K     K + C+ C   F     L  H R    +  KP      Y+ H      CN       + + HIR H+G+KP +C IC KRF +++N+  H   H  +K + C  C KSF
Sbjct:  734 GKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHTRTHSGE--KP------YKCHI-----CNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTH--QKKYKCSDCSKSF 859          

HSP 2 Score: 62.3882 bits (150), Expect = 1.902e-10
Identity = 46/155 (29.68%), Postives = 71/155 (45.81%), Query Frame = 2
Query:  407 KYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARR--EHVDPRKPPKDPSKYR-YHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTRE 862
            + IC    C K F+ A  L  H +  H  +     QC  ++H+    F   ++   H+      K  SKY+ Y C     C    ++  T   H R HSG+KP++C IC+K+F  ++++K H   H  EK   C IC K F        H++T +
Sbjct:  704 QVICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQC--LWHDCHRTFPQRQKLIRHL------KVHSKYKPYKCKT---CKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHIKTHQ 847          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Yeast
Match: RGM1 (Putative zinc finger DNA binding transcription factor; contains two N-terminal C2H2 zinc fingers and C-terminal proline rich domain; overproduction impairs cell growth and induces expression of genes involved in monosaccharide catabolism and aldehyde metabolism; regulates expression of of Y' telomeric elements and subtelomeric COS genes; relocalizes to the cytosol in response to hypoxia; RGM1 has a paralog, USV1, that arose from the whole genome duplication [Source:SGD;Acc:S000004794])

HSP 1 Score: 51.9878 bits (123), Expect = 5.375e-8
Identity = 24/55 (43.64%), Postives = 33/55 (60.00%), Query Frame = 2
Query:  605 KYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRS 769
            K  Y C   PDCN   N       HIR H+G+KPF+C+IC K F++  N++ H+S
Sbjct:   16 KRNYRCVGYPDCNMSFNRTEHLARHIRKHTGEKPFQCNICLKFFSRIDNLRQHQS 70          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO42127 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2E0])

HSP 1 Score: 88.9669 bits (219), Expect = 8.502e-19
Identity = 93/363 (25.62%), Postives = 151/363 (41.60%), Query Frame = 2
Query:  299 FNSDESLHQPILRNDKEYAFV-EKDGGFSLEEVSGKVK-----------YICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPK------------DPSKYRYHCTYSPD-------CNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREY--------FVEKVNFSVKVI---------CLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVK 1243
            FN+  SL   +L + +E  FV +++G        G ++           +IC  + C K F  A  L++H       K   C QC   F    +L  H R    +  KP K            D  K+++  T+S D       C            H+R H+G+KP+ CD+C K F     +K+H++ H  +K F CD C+K+F+T     AH+  R   ++ +        F+  + F    I         C  C  +F +  D++ H+ V     +  +KC  C+ +F  F  LK+HI+ H       C  C    F H +  N+H+ R H+ +   K  C  C+  F  +  +  H+K
Sbjct:   72 FNNPSSLRSHVLSHSEERPFVCDQEGCGKSFNNPGSLRVHRRVHQEDKPHICEHEGCDKAFKTAAELSRHAFRHTGEKPHKCDQCEKAFIRYDDLKRHYRIHTGE--KPFKCDQCDFACIQSFDLVKHKF--THSGDKPYKCDSCPKQFTRPARLRDHMRTHTGEKPYVCDVCGKGFAIQTGLKSHQAIHTGDKPFKCDECEKTFRTALELQAHM-GRHTGVKPFKCDICDKEFISAITFKRHAIVHTGEKPYECQECGRRFARSTDLKVHLPV--HSEDKPYKCGECEKMFTRFSTLKEHIRTHTGERPFKCDECGRE-FNHRSHFNNHL-RIHTGEKPFK--CDTCDKDFSRKASLRYHMK 423          

HSP 2 Score: 56.6102 bits (135), Expect = 1.890e-8
Identity = 64/267 (23.97%), Postives = 104/267 (38.95%), Query Frame = 2
Query:  638 CNYMTNNGGTFEHHIRAHSG-DKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDI--CKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEI-------------NSRKSHGIIGRFSCPY--EGCKFTSNTELLITSHIERHENGK 1384
            C  + N       H+  H+G +KP+EC+ C K F   +++++H   H  E+ F CD   C KSF        H R  + E + +  E           GC++ F    ++  H        E   KC  C+  F  +++LK+H + H       C  C+      ++ + H  T  HS     K  C  C   F     + DH++ +   +                 KSH  I     P+  + C+ T  T L + +H+ RH   K
Sbjct:   39 CGKVFNYASNLRQHMLIHTGSEKPYECEYCDKAFNNPSSLRSHVLSHSEERPFVCDQEGCGKSFNNPGSLRVHRRVHQ-EDKPHICEHE---------GCDKAFKTAAELSRH--AFRHTGEKPHKCDQCEKAFIRYDDLKRHYRIHTGEKPFKCDQCDFACIQSFDLVKHKFT--HSGDKPYK--CDSCPKQFTRPARLRDHMRTHTGEKPYVCDVCGKGFAIQTGLKSHQAIHTGDKPFKCDECEKTFRTALELQAHMGRHTGVK 289          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO41082 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5G4])

HSP 1 Score: 88.9669 bits (219), Expect = 1.078e-18
Identity = 81/308 (26.30%), Postives = 127/308 (41.23%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREH--VDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREY--------FVEKVNFSVKVI---------CLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANE 1261
            SG+  ++C I  C K F+ A++L +H     D K +VC +C   F   + L  H R  H  V P           Y C     C    ++      H R H+G++PFEC  CH  F+    +  H   H  ++ + C+ C  +F   D   +HLR    E R Y        FV+    S  ++         CL C + F    ++  H +    + E+ F+C  C  +F   + L KH+  H       C +C E GF   + L  H  R   IK  +   C  C+  F +  E T H++ +  ++
Sbjct:   78 SGERSHMCDI--CSKSFSRASTLVRHMISHTDDKPYVCTKCNKAFAYSASLVKHDRVYHRGVKP-----------YECDI---CGRAFSDRSGLVKHERTHTGERPFECSFCHMMFSLKGLLTRHMRSHTGQRPYKCEYCSAAFSVSDTLKSHLRLHTGE-RPYKCEICNKGFVQSSALSSHLLTHSGKRPYECLTCGQTFRSRSNLLYHER--RHRGEAPFECQTCGKVFVRSDNLSKHMLCHTGEKPYKCQVC-ERGFACTSALKSHQRRHDGIKPYK---CERCDKRFTSSNERTRHMRTHTGDK 362          

HSP 2 Score: 82.4185 bits (202), Expect = 1.198e-16
Identity = 79/305 (25.90%), Postives = 125/305 (40.98%), Query Frame = 2
Query:  398 GKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHEL-------REYFVEKVNFSVKVICLG---------CNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSV-CRYCELIFQTETEMTDHVKEYHANE 1261
            G   Y C I  C + F+  + L KH +     + F C  C  +F  L  L     R H   R          Y C Y   C+   +   T + H+R H+G++P++C+IC+K F Q++ + +H   H  ++ + C  C ++F++    L H R    E         + FV   N S  ++C           C   F     +++H +  D      +KC  CD  F    E  +H++ H       C IC E  F++   L  H      I    K   C  CE  F++ +E+T HVK  H  +
Sbjct:  136 GVKPYECDI--CGRAFSDRSGLVKHERTHTGERPFECSFCHMMF-SLKGLLTRHMRSHTGQRP---------YKCEY---CSAAFSVSDTLKSHLRLHTGERPYKCEICNKGFVQSSALSSHLLTHSGKRPYECLTCGQTFRSRSNLLYHERRHRGEAPFECQTCGKVFVRSDNLSKHMLCHTGEKPYKCQVCERGFACTSALKSHQRRHDGI--KPYKCERCDKRFTSSNERTRHMRTHTGDKPYTCDICKE-NFMYTTSLARHKL----IHSGAKPFKCDTCEKAFRSSSELTRHVKLVHVKK 418          

HSP 3 Score: 72.0182 bits (175), Expect = 2.920e-13
Identity = 66/246 (26.83%), Postives = 100/246 (40.65%), Query Frame = 2
Query:  506 CRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVK 1243
            C +C   F   S+L  H +R H D  KP        Y C     C+           HIR H+G++P+EC  C KRF+Q ++   H  +H  E+   CDIC KSF      + H+ +   +               +C  CN+ F     +  H +V  + ++  ++C IC   F D   L KH + H       C  C+   F     L  H+ R H+ +  R   C YC   F     +  H++
Sbjct:    1 CSECSRAFKNKSDLVKH-KRVHCDD-KP--------YSCR---TCDKEFTRRDALTCHIRIHTGERPYECRYCDKRFSQPSHRVQHEFKHSGERSHMCDICSKSFSRASTLVRHMISHTDD------------KPYVCTKCNKAFAYSASLVKHDRVYHRGVKP-YECDICGRAFSDRSGLVKHERTHTGERPFECSFCHM-MFSLKGLLTRHM-RSHTGQ--RPYKCEYCSAAFSVSDTLKSHLR 216          

HSP 4 Score: 53.1434 bits (126), Expect = 2.364e-7
Identity = 45/159 (28.30%), Postives = 69/159 (43.40%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHEL 871
            +G+  Y C +  C + F   ++L  H +    +K + C +C   F   +E   H R    D  KP        Y C    + N+M     +   H   HSG KPF+CD C K F  ++ +  H      +K F CD CK++F++ D    H  T   +L
Sbjct:  303 TGEKPYKCQV--CERGFACTSALKSHQRRHDGIKPYKCERCDKRFTSSNERTRHMRTHTGD--KP--------YTCDICKE-NFMYTT--SLARHKLIHSGAKPFKCDTCEKAFRSSSELTRHVKLVHVKKPFPCDTCKQAFRSEDALARHKNTHAGDL 446          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO38419 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCX8])

HSP 1 Score: 85.1149 bits (209), Expect = 2.852e-17
Identity = 71/245 (28.98%), Postives = 93/245 (37.96%), Query Frame = 2
Query:  428 NCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHS 1162
             C K F  A+ LT+H +     K   C QC  +F     L  H R       KP K        CT    C  +    G    H+R HSG+KP +C  C K F Q +N+ TH   H  EK   C  C K F        H+RT   E                C  C + F +  ++  HM+      E   KC+ C   F     L KH++ H       C  C +  F H + L  H+ R HS
Sbjct:  321 QCGKAFARASVLTRHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMRTH--SGEKPHK--------CT---QCGKVFAQAGILTTHMRTHSGEKPHKCTQCGKAFAQASNLTTHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMRTHSGEKPHK------------CTQCGKVFAQAGNLTTHMRT--HSGEKPHKCTQCGKAFAHASNLTKHMRIHSGEKPYKCTQCGKV-FAHTSHLTKHM-RTHS 536          

HSP 2 Score: 72.4034 bits (176), Expect = 2.713e-13
Identity = 81/321 (25.23%), Postives = 117/321 (36.45%), Query Frame = 2
Query:  368 DGGFSLEEVSGK---VKYICHIQN-----CYKQFNHANSLTKHYKDCHDVKI---FVCRQCPGIFHELSELFLHARREHVD--PRKPP---KDPSKYRY-------HCTYSP----DCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEY 1249
            D G +LE+V         +C+ ++     C + F  +N+L  H K C+         C+ C         L  H   EH +   R  P   KD   YRY       H  Y P     C     +  +   H+R HSG+KP +C  C K F + + +  H   H  EK   C  C K F        H+RT   E                C  C + F +   +  HM+      E   KC+ C   F     L  H++ H       C  C +  F H   L  H+ R HS +   K  C  C  +F     +T H++ +
Sbjct:  177 DLGIALEDVEDSNIIASELCYTKDYTCKKCSRCFTSSNALLWHRKRCYIEPTGDELKCKLCQQQCATPKTLTGHIVSEHCENSSRVCPICEKDFCDYRYMIMHILTHTKYKPYKCTQCGKAFAHASSLTEHMRTHSGEKPHKCTQCGKAFARASVLTRHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMRTHSGEKPHK------------CTQCGKVFAQAGILTTHMRT--HSGEKPHKCTQCGKAFAQASNLTTHMRTHSGEKPHKCTQCGKV-FAHAGNLTTHM-RTHSGEKPHK--CTQCGKVFAQAGNLTTHMRTH 479          

HSP 3 Score: 64.6994 bits (156), Expect = 6.751e-11
Identity = 46/147 (31.29%), Postives = 58/147 (39.46%), Query Frame = 2
Query:  428 NCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHE 868
             C K F  A++LT H +     K   C QC  +F     L  H R       KP K        CT    C  +    G    H+R HSG+KP +C  C K F   +N+  H   H  EK + C  C K F        H+RT   E
Sbjct:  405 QCGKAFAQASNLTTHMRTHSGEKPHKCTQCGKVFAHAGNLTTHMRTH--SGEKPHK--------CT---QCGKVFAQAGNLTTHMRTHSGEKPHKCTQCGKAFAHASNLTKHMRIHSGEKPYKCTQCGKVFAHTSHLTKHMRTHSRE 538          

HSP 4 Score: 51.9878 bits (123), Expect = 6.130e-7
Identity = 37/120 (30.83%), Postives = 49/120 (40.83%), Query Frame = 2
Query:  428 NCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEK 787
             C K F HA +LT H +     K   C QC  +F +   L  H R       KP K        CT    C     +      H+R HSG+KP++C  C K F   +++  H   H  EK
Sbjct:  433 QCGKVFAHAGNLTTHMRTHSGEKPHKCTQCGKVFAQAGNLTTHMRTH--SGEKPHK--------CT---QCGKAFAHASNLTKHMRIHSGEKPYKCTQCGKVFAHTSHLTKHMRTHSREK 539          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO33478 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS19])

HSP 1 Score: 77.7962 bits (190), Expect = 7.566e-17
Identity = 43/112 (38.39%), Postives = 55/112 (49.11%), Query Frame = 2
Query:  638 CNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMK 973
            C    N   T   HIR H+G KPF+CDIC K F Q  N K HR  H  EK F C IC K+F  H +Y        H  ++ F           CL C + FC+ FD++ H++
Sbjct:   43 CGKAFNRSSTLNTHIRIHAGYKPFQCDICGKGFHQKGNYKNHRLTHTGEKPFKCHICGKAF--HQVYNLTFHMHTHNEKKPFT----------CLECGKGFCRNFDLKKHVR 142          

HSP 2 Score: 56.225 bits (134), Expect = 2.354e-9
Identity = 47/162 (29.01%), Postives = 65/162 (40.12%), Query Frame = 2
Query:  686 AHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKV 1171
             H+G +PF+C IC K F Q + +  H+  H  EK   C+IC K+F        H+R   H   + F           C  C + F +  + +NH        E  FKC IC   F     L  H+  H E     C  C + GF     L  H+ + H  K 
Sbjct:    3 VHTGARPFKCKICGKGFRQASTLCRHKIIHTKEKPHKCNICGKAFNRSSTLNTHIRI--HAGYKPFQ----------CDICGKGFHQKGNYKNHRLT--HTGEKPFKCHICGKAFHQVYNLTFHMHTHNEKKPFTCLECGK-GFCRNFDLKKHVRKLHENKT 149          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO46374 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQI8])

HSP 1 Score: 80.1073 bits (196), Expect = 1.499e-16
Identity = 84/299 (28.09%), Postives = 121/299 (40.47%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDI-YLA---HLRTREHELREYFV-----EKVNFSVKVI---------CLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYH--ANEIN 1267
            C K F+ +N+L  H +     K F C QC   F +   L  H +  H    KP        Y C   P CN   N       H+R H+  KPF CD C K F Q  +MK HR  H  EK   C     +F   +I Y     H +TR+ +   ++V     +K++  +            C  C   F +L  +  HM+        ++KC+IC   F     L+ HI  H       C IC + GF   + LN H  R H++K  +   C+ C   F  +  +  H    H  AN ++
Sbjct:    6 CLKSFSRSNTLITHKRIHTGDKPFNCDQCGRAFRQPGNLTRH-KLTHTTV-KP--------YVC---PQCNKAFNRASNLHTHMRTHTNYKPFVCDFCKKGFHQKIDMKIHRYTHTGEKPHKCQS-STTFSIFNISYFTDSLHSQTRDFDFLGFYVFLGFHQKIDMKIHRYTHTGEKPHKCQKCGRGFKQLTHLTYHMRT--HAETRLYKCTICGKGFNQKGNLQAHIYGHTGERPFKCEICGK-GFTLASTLNTH-KRTHAMK--KPFECQVCGKSFYQKNALKTHYISSHPFANGVS 284          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000024795.2 (pep primary_assembly:ASM223467v1:2:6353588:6393021:-1 gene:ENSORLG00000027186.1 transcript:ENSORLT00000024795.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.3673 bits (246), Expect = 3.876e-22
Identity = 85/316 (26.90%), Postives = 139/316 (43.99%), Query Frame = 2
Query:  209 QINVDDNNEVYLEVLAEDSN------DIINGNVNIKFN--SDESLHQPILRNDKEYAFVEKDGGFS--------LEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNE 1108
            ++++    E  +E+   D N      D  N +    F+  S    H      +K ++ VE + GFS        +   +G+  + C  + C K+F+  ++LT H +     K F C +C  IF  LS L  H R   +   + P       + C    +C+   ++    + HIR H+G++PF C  C K+F+Q ++++ H   H  EK F+C  C KSF        H+RT   E          FS    C  C+  F  + D+++HM+      E  F CS+CD  FG    L+KH + H      +C  C++
Sbjct:   17 RLHLKQETETLMEIPTYDENENNEETDPQNRDQKKSFSYLSHLRTHLRSHTGEKHFSCVECNKGFSHVSDLKKHIRTHTGEKPFSC--KECDKRFSCGSNLTTHMRIHTGEKPFSCTECGKIFSCLSNLITHMR---IHTGEKP-------FSC---KECDRRFSHVSDLKKHIRTHTGERPFSCKECKKQFSQTSSLQRHMRIHTGEKPFSCKECDKSFSCLSTLKKHVRTHTGE--------KPFS----CKECDRSFSHISDLKSHMRT--HTGEKPFSCSVCDKSFGQISSLQKHRRTHTGEKPFSCIYCHK 303          

HSP 2 Score: 79.7221 bits (195), Expect = 1.284e-15
Identity = 80/292 (27.40%), Postives = 120/292 (41.10%), Query Frame = 2
Query:  437 KQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPY 1312
            K F++ + L  H +     K F C +C   F  +S+L  H R       KP        + C    +C+   + G     H+R H+G+KPF C  C K F+  +N+ TH   H  EK F+C  C + F        H+RT   E          FS    C  C +QF +   ++ HM++     E  F C  CD  F     LKKH++ H      +C  C+   F H + L  H+ R H+ +  +   C  C+  F   + +  H           R++H     FSC Y
Sbjct:   51 KSFSYLSHLRTHLRSHTGEKHFSCVECNKGFSHVSDLKKHIRTH--TGEKP--------FSC---KECDKRFSCGSNLTTHMRIHTGEKPFSCTECGKIFSCLSNLITHMRIHTGEKPFSCKECDRRFSHVSDLKKHIRTHTGER--------PFS----CKECKKQFSQTSSLQRHMRI--HTGEKPFSCKECDKSFSCLSTLKKHVRTHTGEKPFSCKECDR-SFSHISDLKSHM-RTHTGE--KPFSCSVCDKSFGQISSLQKH-----------RRTHTGEKPFSCIY 300          

HSP 3 Score: 73.559 bits (179), Expect = 1.251e-13
Identity = 57/187 (30.48%), Postives = 86/187 (45.99%), Query Frame = 2
Query:  320 HQPILRNDKEYAFVEKDGGFS--------LEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRT 856
            H  I   +K ++  E D  FS        +   +G+  + C  + C KQF+  +SL +H +     K F C++C   F  LS L  H R       KP        + C    +C+   ++    + H+R H+G+KPF C +C K F Q ++++ HR  H  EK F+C  C KSF       AH RT
Sbjct:  146 HMRIHTGEKPFSCKECDRRFSHVSDLKKHIRTHTGERPFSC--KECKKQFSQTSSLQRHMRIHTGEKPFSCKECDKSFSCLSTLKKHVRTH--TGEKP--------FSC---KECDRSFSHISDLKSHMRTHTGEKPFSCSVCDKSFGQISSLQKHRRTHTGEKPFSCIYCHKSFSDISNLKAHART 317          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000017686.2 (pep primary_assembly:ASM223467v1:3:9540654:9578150:1 gene:ENSORLG00000023806.1 transcript:ENSORLT00000017686.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 5.312e-22
Identity = 79/294 (26.87%), Postives = 128/294 (43.54%), Query Frame = 2
Query:  341 DKEYAFVEKDGGFS--------LEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSK-----------YRYHCTYSP----DCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVI-----------------CLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPIC 1102
            +K Y+  E D GFS        +   +G+  + C  + C K FN  + L +H +     + ++C++C   F + S   +H R    D R   K+  K            R H    P    +CN   ++  T + H+R H+G+KPF C  C K F+  +++KTH   H  EK F+C  CKKSF        H+RT   E + +  ++ + S + +                 C  CN+ FC + ++++HM+      E  F C  C+  F D   LK H++ H      +C  C
Sbjct:   94 NKPYSCKECDKGFSRISNLKRHMRTHTGEKPFSC--KECEKSFNQISDLNRHMRTHTGERCYICKECGKSFCDKSLFRIHTRIHAEDERFSCKECEKSFNYISHLKQHMRTHTGEKPFSCKECNKSFSHASTLKTHMRIHTGEKPFSCKECKKSFSHVSHLKTHMRTHTGEKPFSCKECKKSFSRVSHLQTHMRTHTGE-KPFSCKECDKSFRDVSTLKKHMRTHTGEKPFSCKECNKSFCDVSNLKSHMRT--HTGEKPFSCKECNKSFCDVSNLKTHMRTHTGEKPFSCKEC 382          

HSP 2 Score: 70.8626 bits (172), Expect = 1.658e-12
Identity = 52/159 (32.70%), Postives = 74/159 (46.54%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPR--------KPPKDPSK----YRYHCTYSP----DCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFK 823
            +G+  + C  + C K F+H + L  H +     K F C++C   F  +S L  H R  H   +        K  +D S      R H    P    +CN    +    + H+R H+G+KPF C  C+K F   +N+KTH   H  EK F+C  CKKSFK
Sbjct:  232 TGEKPFSC--KECKKSFSHVSHLKTHMRTHTGEKPFSCKECKKSFSRVSHLQTHMR-THTGEKPFSCKECDKSFRDVSTLKKHMRTHTGEKPFSCKECNKSFCDVSNLKSHMRTHTGEKPFSCKECNKSFCDVSNLKTHMRTHTGEKPFSCKECKKSFK 387          

HSP 3 Score: 68.9366 bits (167), Expect = 5.312e-12
Identity = 56/192 (29.17%), Postives = 89/192 (46.35%), Query Frame = 2
Query:  680 IRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFC--KLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEY 1249
            +R H+ +KP+ C  C K F++ +N+K H   H  EK F+C  C+KSF        H+RT   E R Y           IC  C + FC   LF I   +   D++    F C  C+  F     LK+H++ H      +C  CN+  F H + L  H+ R H+ +  +   C+ C+  F   + +  H++ +
Sbjct:   88 MRTHTENKPYSCKECDKGFSRISNLKRHMRTHTGEKPFSCKECEKSFNQISDLNRHMRTHTGE-RCY-----------ICKECGKSFCDKSLFRIHTRIHAEDER----FSCKECEKSFNYISHLKQHMRTHTGEKPFSCKECNK-SFSHASTLKTHM-RIHTGE--KPFSCKECKKSFSHVSHLKTHMRTH 259          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000037663.1 (pep primary_assembly:ASM223467v1:2:11598888:11652036:1 gene:ENSORLG00000001749.2 transcript:ENSORLT00000037663.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 6.379e-22
Identity = 95/368 (25.82%), Postives = 144/368 (39.13%), Query Frame = 2
Query:  140 NVNDALDLEQYLNQIIEI--NGKHYQINVDDNNEVYLEVLA---------EDSNDIINGNVNIKFNSDESLHQPILR------NDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKD-----------PSKYRYHCTYSP-DCNYMTN---NGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHI 1147
             V + LDL+Q  + ++EI    +H     D NN+    V           E+S    +G  +      +S+ Q   R      N  E   + ++   S+   S    Y+C  + C K F++ +    H +     K F C+QC   F E S L  H R    +     K+               R H    P  C Y      +    + HIR H+G++PF C+ C K F+  +N+KTH   H  EK F+C  C  SF+       H+ T   E            +  +C  C + F   F  RNH++      E  F C  CD  F D  +LK+H K H      +C  C +  F   ++L  H+
Sbjct:   61 QVEEQLDLKQETDTLMEILTYEEHESSEADLNNQQRFNVTDSQNEEGSQHEESTSTTDGETD-----PQSIDQRKRRDSLFCVNSSEGTRMTQNESVSMRTESDDRPYVC--EECGKTFSYVSRFRIHMRTHTGEKPFACKQCDKRFRENSNLIRHVRTHTGEKPFSCKECDTSFNQKSSLTRHMRTHTGEKPFSCKYCDKSFCDKSLLKRHIRTHTGERPFSCNECDKSFSHISNLKTHMRIHTREKAFSCKECDTSFRQISYLKRHMMTHTGE------------IPHVCEECGKGFGYWFKFRNHLRT--HTGEKPFSCEECDKSFCDRSKLKRHTKTHTGEKPFSCNECGK-SFCEKSKLKAHL 406          

HSP 2 Score: 81.2629 bits (199), Expect = 9.620e-16
Identity = 69/258 (26.74%), Postives = 102/258 (39.53%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSP----DCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFD----IRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHH 1144
            +G+  + C+   C K F+H ++L  H +     K F C++C   F ++S L  H                    H    P    +C         F +H+R H+G+KPF C+ C K F   + +K H   H  EK F+C+ C KSF       AHLRT   E                C  C+  F ++F     ++ HM+      E  + C  C+  F     LK H++ H      +C  CN   F H   L  H
Sbjct:  270 TGERPFSCN--ECDKSFSHISNLKTHMRIHTREKAFSCKECDTSFRQISYLKRHMM-----------------THTGEIPHVCEECGKGFGYWFKFRNHLRTHTGEKPFSCEECDKSFCDRSKLKRHTKTHTGEKPFSCNECGKSFCEKSKLKAHLRTHTGE------------KPFSCNECDTSFSQIFSEKSCLKRHMRT--HTGEKPYSCKECNKSFSCKSNLKTHMRTHTGEKPFSCKECN-TSFSHVTSLKRH 493          

HSP 3 Score: 78.9518 bits (193), Expect = 5.844e-15
Identity = 56/210 (26.67%), Postives = 91/210 (43.33%), Query Frame = 2
Query:  668 FEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHE----------------LREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEY 1249
            F  H+R H+G+KPF C  C KRF +N+N+  H   H  EK F+C  C  SF        H+RT   E                L +  +          C  C++ F  + +++ HM++     E  F C  CD  F     LK+H+  H   +   C  C + GF ++ +  +H+ R H+ +  +   C  C+  F   +++  H K +
Sbjct:  178 FRIHMRTHTGEKPFACKQCDKRFRENSNLIRHVRTHTGEKPFSCKECDTSFNQKSSLTRHMRTHTGEKPFSCKYCDKSFCDKSLLKRHIRTHTGERPFSCNECDKSFSHISNLKTHMRI--HTREKAFSCKECDTSFRQISYLKRHMMTHTGEIPHVCEECGK-GFGYWFKFRNHL-RTHTGE--KPFSCEECDKSFCDRSKLKRHTKTH 381          

HSP 4 Score: 68.5514 bits (166), Expect = 1.190e-11
Identity = 60/231 (25.97%), Postives = 95/231 (41.13%), Query Frame = 2
Query:  572 VDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEI 1264
             DP+   +   +    C  S +   MT N       +R  S D+P+ C+ C K F+  +  + H   H  EK F C  C K F+ +   + H+RT   E                C  C+  F +   +  HM+      E  F C  CD  F D   LK+HI+ H      +C  C++  F H + L  H+ R H+ +  +   C+ C+  F+  + +  H+   H  EI
Sbjct:  121 TDPQSIDQRKRRDSLFCVNSSEGTRMTQNESV---SMRTESDDRPYVCEECGKTFSYVSRFRIHMRTHTGEKPFACKQCDKRFRENSNLIRHVRTHTGE------------KPFSCKECDTSFNQKSSLTRHMRT--HTGEKPFSCKYCDKSFCDKSLLKRHIRTHTGERPFSCNECDK-SFSHISNLKTHM-RIHTRE--KAFSCKECDTSFRQISYLKRHMM-THTGEI 329          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000043613.1 (pep primary_assembly:ASM223467v1:17:11345264:11348091:-1 gene:ENSORLG00000007097.2 transcript:ENSORLT00000043613.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 6.638e-22
Identity = 63/198 (31.82%), Postives = 97/198 (48.99%), Query Frame = 2
Query:  656 NGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEY 1249
            N G    H+R H+G++PF C +C K FTQ++ +  H   H  E+ ++CDICKK+F   +    H+RT   E R Y            C  C + F +  D++ HM+      E  F C +C   F    +LK HI+ H    L  C IC +  F+H N L  H+ R H+ K  +   C  C+ +F +   +T H++ +
Sbjct:  122 NSGALTCHMRTHTGERPFTCKVCQKSFTQSSYLNIHMRSHTGERPYSCDICKKTFIHANSLTYHMRTHTGE-RPY-----------SCKLCQKGFMQSKDLKVHMRT--HTGERPFTCEVCGKSFTTGSDLKVHIRTHTAKKLFPCDICKKT-FIHVNSLTSHM-RTHTAK--KLFSCDICKKVFVSSRNLTYHMRTH 301          

HSP 2 Score: 98.5969 bits (244), Expect = 2.344e-21
Identity = 85/330 (25.76%), Postives = 146/330 (44.24%), Query Frame = 2
Query:  365 KDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPD-CNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLI 1351
            K+    +   +G+  + C I  C K F ++ +LT H +     + F C+ C   F + S L +H  R H   R              YS D C     +  +  +H+R H+G++P+ C +C K F Q+ ++K H   H  E+ F C++C KSF T      H+RT  H  ++ F           C  C + F  +  + +HM+      + +F C IC  +F     L  H++ H +    +C +C +  F  ++ LN H+ R H+ +  +   C+ CE  F  ++ +  H++  H  E            F+C   G  FT+ ++L I
Sbjct:   96 KNVKLHMRTQTGEKLFSCDI--CSKGFINSGALTCHMRTHTGERPFTCKVCQKSFTQSSYLNIHM-RSHTGERP-------------YSCDICKKTFIHANSLTYHMRTHTGERPYSCKLCQKGFMQSKDLKVHMRTHTGERPFTCEVCGKSFTTGSDLKVHIRT--HTAKKLFP----------CDICKKTFIHVNSLTSHMRT--HTAKKLFSCDICKKVFVSSRNLTYHMRTHTDERPYSCKVCKK-CFTQHSCLNVHM-RTHTGE--KPYSCKVCEKHFTQKSSLNVHMR-IHTGE----------RPFTCEVCGKSFTTGSDLKI 380          

HSP 3 Score: 94.3597 bits (233), Expect = 5.156e-20
Identity = 84/299 (28.09%), Postives = 129/299 (43.14%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHE-------LREYFVEKVNFSVKV---------ICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVK 1243
            +G+  Y C I  C K F HANSLT H +     + + C+ C   F +  +L +H R  H   R          + C     C      G   + HIR H+  K F CDIC K F    ++ +H   H ++KLF+CDICKK F +      H+RT   E        ++ F +    +V +          C  C + F +   +  HM++     E  F C +C   F    +LK H++ H       C +C + GF   + L  HI R H+ K  +   C  C+ +F +   +T H++
Sbjct:  162 TGERPYSCDI--CKKTFIHANSLTYHMRTHTGERPYSCKLCQKGFMQSKDLKVHMR-THTGERP---------FTCEV---CGKSFTTGSDLKVHIRTHTAKKLFPCDICKKTFIHVNSLTSHMRTHTAKKLFSCDICKKVFVSSRNLTYHMRTHTDERPYSCKVCKKCFTQHSCLNVHMRTHTGEKPYSCKVCEKHFTQKSSLNVHMRI--HTGERPFTCEVCGKSFTTGSDLKIHMRIHTGERPFTCEVCGK-GFTTGSDLKAHI-RTHTAK--KLFPCDICKKVFVSLRNLTCHMR 439          

HSP 4 Score: 92.0485 bits (227), Expect = 3.176e-19
Identity = 68/239 (28.45%), Postives = 98/239 (41.00%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHI 1147
            C K F H NSLT H +     K+F C  C  +F     L  H R  H D R          Y C     C            H+R H+G+KP+ C +C K FTQ +++  H   H  E+ F C++C KSF T      H+R    E R +            C  C + F    D++ H++      + +F C IC  +F     L  H++ H      +C +C + GF     L  H+
Sbjct:  256 CKKTFIHVNSLTSHMRTHTAKKLFSCDICKKVFVSSRNLTYHMR-THTDERP---------YSCKVCKKCF---TQHSCLNVHMRTHTGEKPYSCKVCEKHFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKIHMRIHTGE-RPF-----------TCEVCGKGFTTGSDLKAHIRT--HTAKKLFPCDICKKVFVSLRNLTCHMRIHTGERPYSCKLCQK-GFRQSRDLKVHM 466          

HSP 5 Score: 72.4034 bits (176), Expect = 6.404e-13
Identity = 66/235 (28.09%), Postives = 97/235 (41.28%), Query Frame = 2
Query:  683 RAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKL 1387
            R  S  K F C +C K FT+  N+K H      EKLF+CDIC K F        H+RT   E          F+ KV    C + F +   +  HM+      E  + C IC   F     L  H++ H      +C +C + GF+    L  H+ R H+ +  R   C  C   F T +++  H++ + A ++              P + CK T      +TSH+  H   KL
Sbjct:   75 RPFSCKKHFSCKVCKKDFTKRKNVKLHMRTQTGEKLFSCDICSKGFINSGALTCHMRTHTGER--------PFTCKV----CQKSFTQSSYLNIHMR--SHTGERPYSCDICKKTFIHANSLTYHMRTHTGERPYSCKLCQK-GFMQSKDLKVHM-RTHTGE--RPFTCEVCGKSFTTGSDLKVHIRTHTAKKLF-------------PCDICKKTFIHVNSLTSHMRTHTAKKL 278          

HSP 6 Score: 68.9366 bits (167), Expect = 8.078e-12
Identity = 56/197 (28.43%), Postives = 85/197 (43.15%), Query Frame = 2
Query:  431 CYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKY-----------RYHCTYSP----DCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKV 976
            C K F  + +LT H +   D + + C+ C   F + S L +H R    +     K   K+           R H    P     C      G   + H+R H+G++PF C++C K FT  +++K H   H ++KLF CDICKK F +      H+R    E R Y            C  C + F +  D++ HM+ 
Sbjct:  284 CKKVFVSSRNLTYHMRTHTDERPYSCKVCKKCFTQHSCLNVHMRTHTGEKPYSCKVCEKHFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKIHMRIHTGERPFTCEVCGKGFTTGSDLKAHIRTHTAKKLFPCDICKKVFVSLRNLTCHMRIHTGE-RPY-----------SCKLCQKGFRQSRDLKVHMRT 468          

HSP 7 Score: 60.4622 bits (145), Expect = 3.615e-9
Identity = 45/154 (29.22%), Postives = 64/154 (41.56%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRT 856
            +G+  Y C +  C K F   +SL  H +     + F C  C   F   S+L +H R  H   R          + C     C      G   + HIR H+  K F CDIC K F    N+  H   H  E+ ++C +C+K F+       H+RT
Sbjct:  330 TGEKPYSCKV--CEKHFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKIHMR-IHTGERP---------FTCEV---CGKGFTTGSDLKAHIRTHTAKKLFPCDICKKVFVSLRNLTCHMRIHTGERPYSCKLCQKGFRQSRDLKVHMRT 468          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000039104.1 (pep primary_assembly:ASM223467v1:17:11164388:11168149:-1 gene:ENSORLG00000007097.2 transcript:ENSORLT00000039104.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 1.032e-21
Identity = 97/374 (25.94%), Postives = 145/374 (38.77%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPR------------KPPKDPSKYRYHCTYSP----DCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMK-----------VCDQKL---------------ESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEP-GFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKL 1387
            +G   + C +  C K F+  + L  H +     K+F C  C  +F  L  L  H +  H   R            +        R H    P     C      G   + H+R H+G+KP+ C +C K FTQ  ++K H   H  E+LF C++C+K F T     AH+ T  H   E F           C  C + F +  D++ HM+           VC+++                E  F C +C   F    +LK HI+ H       C IC +  GF+    LN H+     I    K  C+ CE  F   + +  H++  H  E            F+C   G  FT+ ++L +  HI  H  GK+
Sbjct:  203 TGDTPFTCEV--CGKFFSQRSKLKAHIRSHTGEKLFSCDICKKVFVSLRNLTYHMK-THTGERPYSCKICLKRFTQKSSLNVHMRIHTGERPFTCEVCGKSFTTGRDLKAHMRTHTGEKPYSCKVCEKHFTQKYSLKVHMRIHTGERLFTCEVCRKCFTTGSELKAHIGT--HTAEEPFT----------CQLCQKGFMQSRDLKIHMRIHTGERPYSCEVCEKQFSYKSSLNIHMGTHTGERPFTCEVCGKNFSQRSKLKAHIRTHTAENPFLCDICKKVFGFMDSRALNVHM----RIHTGEKPYCKVCEKKFAHNSSLNVHMR-IHTGERP----------FTCEVCGKSFTTGSDLKV--HIRTHTAGKI 544          

HSP 2 Score: 99.3673 bits (246), Expect = 2.167e-21
Identity = 88/289 (30.45%), Postives = 127/289 (43.94%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANE 1261
            +G+  Y C I  C K F +ANSLT H +     + F C  C   F +  +L  H    H D R          Y C     C     +      H+R H+GD PF C++C K F+Q + +K H   H  EKLF+CDICKK F +      H++T   E R Y       S K+    C ++F +   +  HM++     E  F C +C   F    +LK H++ H      +C +C E  F     L  H+ R H+ +  R   C  C   F T +E+  H+  + A E
Sbjct:  119 TGERPYSCDI--CKKAFIYANSLTYHMRTHTSERHFTCEICQKDFMQNRDLKAHMG-THTDERP---------YSCKV---CEKQFTHKSNLNVHMRIHTGDTPFTCEVCGKFFSQRSKLKAHIRSHTGEKLFSCDICKKVFVSLRNLTYHMKTHTGE-RPY-------SCKI----CLKRFTQKSSLNVHMRI--HTGERPFTCEVCGKSFTTGRDLKAHMRTHTGEKPYSCKVC-EKHFTQKYSLKVHM-RIHTGE--RLFTCEVCRKCFTTGSELKAHIGTHTAEE 374          

HSP 3 Score: 87.8113 bits (216), Expect = 1.120e-17
Identity = 68/259 (26.25%), Postives = 118/259 (45.56%), Query Frame = 2
Query:  656 NGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHE-------LREYFVEKVNFSVKV---------ICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGK 1384
            + G    H+R H+G+KP+ C++C K F QN ++  H   H  E+ ++CDICKK+F   +    H+RT   E        ++ F++  +    +          C  C +QF    ++  HM++     ++ F C +C   F    +LK HI++H    L +C IC +  FV    L +H+ + H+ +  R   C+ C   F  ++ +  H++  H  E            F+C   G  FT+  +L   +H+  H   K
Sbjct:   79 SSGALTGHMRTHTGEKPYSCEVCQKCFAQNYSLNVHMRIHTGERPYSCDICKKAFIYANSLTYHMRTHTSERHFTCEICQKDFMQNRDLKAHMGTHTDERPYSCKVCEKQFTHKSNLNVHMRI--HTGDTPFTCEVCGKFFSQRSKLKAHIRSHTGEKLFSCDICKKV-FVSLRNLTYHM-KTHTGE--RPYSCKICLKRFTQKSSLNVHMR-IHTGERP----------FTCEVCGKSFTTGRDL--KAHMRTHTGEK 318          

HSP 4 Score: 77.7962 bits (190), Expect = 1.746e-14
Identity = 67/251 (26.69%), Postives = 102/251 (40.64%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHI 1147
            +G+  + C +  C K F   + L  H       + F C+ C   F +  +L +H R  H   R          Y C     C    +   +   H+  H+G++PF C++C K F+Q + +K H   H +E  F CDICKK F   D    ++  R H              K  C  C ++F     +  HM++     E  F C +C   F    +LK HI+ H    +  C IC +  FV    L  H+
Sbjct:  343 TGERLFTCEV--CRKCFTTGSELKAHIGTHTAEEPFTCQLCQKGFMQSRDLKIHMR-IHTGERP---------YSCEV---CEKQFSYKSSLNIHMGTHTGERPFTCEVCGKNFSQRSKLKAHIRTHTAENPFLCDICKKVFGFMDSRALNVHMRIHT-----------GEKPYCKVCEKKFAHNSSLNVHMRI--HTGERPFTCEVCGKSFTTGSDLKVHIRTHTAGKIFPCDICKKV-FVSLRNLTCHM 564          

HSP 5 Score: 67.0106 bits (162), Expect = 3.509e-11
Identity = 51/171 (29.82%), Postives = 75/171 (43.86%), Query Frame = 2
Query:  395 SGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSK--------------YRYHCTYSPDCNYMTN---NGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRT 856
            +G+  Y C +  C KQF++ +SL  H       + F C  C   F + S+L  H R  H        D  K               R H    P C        +  +   H+R H+G++PF C++C K FT  +++K H   H + K+F CDICKK F +      H+RT
Sbjct:  399 TGERPYSCEV--CEKQFSYKSSLNIHMGTHTGERPFTCEVCGKNFSQRSKLKAHIR-THTAENPFLCDICKKVFGFMDSRALNVHMRIHTGEKPYCKVCEKKFAHNSSLNVHMRIHTGERPFTCEVCGKSFTTGSDLKVHIRTHTAGKIFPCDICKKVFVSLRNLTCHMRT 566          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000031902.1 (SMESG000031902.1)

HSP 1 Score: 1127.08 bits (2914), Expect = 0.000e+0
Identity = 551/551 (100.00%), Postives = 551/551 (100.00%), Query Frame = 2
Query:  191 INGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLHQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPXXXXXXXXLIDGNLNGGFNLEMPTIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV 1843
            INGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLHQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPKKRGRKRKLIDGNLNGGFNLEMPTIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV
Sbjct:   89 INGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLHQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPKKRGRKRKLIDGNLNGGFNLEMPTIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV 639          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000049972.1 (SMESG000049972.1)

HSP 1 Score: 1126.31 bits (2912), Expect = 0.000e+0
Identity = 555/571 (97.20%), Postives = 560/571 (98.07%), Query Frame = 2
Query:  134 EYNVNDALDLE-QYLNQIIEINGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLHQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPXXXXXXXXLIDGNLNGGFNLEMPTIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV 1843
            E  +N +L  + + L   +EINGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESL QPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPKKRGRKRKLIDGNLNGGFNLEMPTIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV
Sbjct:   62 ERQLNQSLRTQIRGLEVALEINGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLLQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPKKRGRKRKLIDGNLNGGFNLEMPTIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV 632          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000031902.1 (SMESG000031902.1)

HSP 1 Score: 1122.07 bits (2901), Expect = 0.000e+0
Identity = 551/553 (99.64%), Postives = 551/553 (99.64%), Query Frame = 2
Query:  191 INGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLHQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPXXXXXXXXLIDGNLNGGFNLEMP--TIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV 1843
            INGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLHQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPKKRGRKRKLIDGNLNGGFNLEMP  TIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV
Sbjct:   89 INGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLHQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPKKRGRKRKLIDGNLNGGFNLEMPSRTIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV 641          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000049972.1 (SMESG000049972.1)

HSP 1 Score: 1118.22 bits (2891), Expect = 0.000e+0
Identity = 552/567 (97.35%), Postives = 559/567 (98.59%), Query Frame = 2
Query:  143 VNDALDLEQYLNQIIEINGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLHQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPXXXXXXXXLIDGNLNGGFNLEMPTIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV 1843
            ++D L ++  +  + +INGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESL QPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPKKRGRKRKLIDGNLNGGFNLEMPTIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV
Sbjct:    6 LDDDLYIDNLIKALNQINGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLLQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPKKRGRKRKLIDGNLNGGFNLEMPTIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV 572          
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000049972.1 (SMESG000049972.1)

HSP 1 Score: 1115.14 bits (2883), Expect = 0.000e+0
Identity = 552/569 (97.01%), Postives = 559/569 (98.24%), Query Frame = 2
Query:  143 VNDALDLEQYLNQIIEINGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLHQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPXXXXXXXXLIDGNLNGGFNLEMP--TIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV 1843
            ++D L ++  +  + +INGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESL QPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPKKRGRKRKLIDGNLNGGFNLEMP  TIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV
Sbjct:    6 LDDDLYIDNLIKALNQINGKHYQINVDDNNEVYLEVLAEDSNDIINGNVNIKFNSDESLLQPILRNDKEYAFVEKDGGFSLEEVSGKVKYICHIQNCYKQFNHANSLTKHYKDCHDVKIFVCRQCPGIFHELSELFLHARREHVDPRKPPKDPSKYRYHCTYSPDCNYMTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFNCDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCKLFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACPICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKEYHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAEKSSPKKRGRKRKLIDGNLNGGFNLEMPSRTIKNEPISSHDFVKKPRGRPRKVVELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKKRGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV 574          
The following BLAST results are available for this feature:
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF3331.399e-2227.76zinc finger protein 333 [Source:HGNC Symbol;Acc:HG... [more]
ZNF3584.612e-1927.27zinc finger protein 358 [Source:HGNC Symbol;Acc:HG... [more]
ZBTB111.198e-1825.51zinc finger and BTB domain containing 11 [Source:H... [more]
ZNF571.721e-1825.44zinc finger protein 57 [Source:HGNC Symbol;Acc:HGN... [more]
ZNF4971.842e-1825.95zinc finger protein 497 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fezf-17.870e-1832.04FEZ Family zinc finger protein [Source:UniProtKB/... [more]
Y55F3AM.141.590e-1523.58pep chromosome:WBcel235:IV:1058845:1063187:-1 gene... [more]
Y55F3AM.141.590e-1523.58pep chromosome:WBcel235:IV:1058695:1067525:-1 gene... [more]
blmp-11.248e-1229.03B lymphocyte-induced maturation protein 1 homolog ... [more]
blmp-11.311e-1229.03B lymphocyte-induced maturation protein 1 homolog ... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG122996.343e-2026.19gene:FBgn0032295 transcript:FBtr0080113[more]
su(Hw)1.838e-1924.83gene:FBgn0003567 transcript:FBtr0082945[more]
su(Hw)1.838e-1924.83gene:FBgn0003567 transcript:FBtr0082946[more]
su(Hw)1.838e-1924.83gene:FBgn0003567 transcript:FBtr0310002[more]
crol2.644e-1726.91gene:FBgn0020309 transcript:FBtr0335473[more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:cabz01032454.37.356e-2228.66si:cabz01032454.3 [Source:ZFIN;Acc:ZDB-GENE-161017... [more]
znf9859.037e-2127.92zinc finger protein 985 [Source:ZFIN;Acc:ZDB-GENE-... [more]
znf10263.779e-2028.17zinc finger protein 1026 [Source:ZFIN;Acc:ZDB-GENE... [more]
znf10265.554e-2029.08zinc finger protein 1026 [Source:ZFIN;Acc:ZDB-GENE... [more]
zbtb111.045e-1924.45zinc finger and BTB domain containing 11 [Source:Z... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZBTB112.594e-1925.93zinc finger and BTB domain containing 11 [Source:N... [more]
ZBTB114.136e-1925.93zinc finger and BTB domain containing 11 [Source:N... [more]
ZBTB115.173e-1925.93zinc finger and BTB domain containing 11 [Source:N... [more]
ENSXETT00000036804.11.128e-1826.32pep primary_assembly:Xenopus_tropicalis_v9.1:9:757... [more]
crp.41.923e-1828.13C-reactive protein, pentraxin-related, gene 4 [Sou... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zbtb113.103e-1924.21zinc finger and BTB domain containing 11 [Source:M... [more]
Zfp3585.566e-1927.27zinc finger protein 358 [Source:MGI Symbol;Acc:MGI... [more]
Zfp3585.566e-1927.27zinc finger protein 358 [Source:MGI Symbol;Acc:MGI... [more]
Zfp9481.711e-1830.67zinc finger protein 948 [Source:MGI Symbol;Acc:MGI... [more]
Zfp261.826e-1827.21zinc finger protein 26 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96JL9|ZN333_HUMAN6.719e-2227.76Zinc finger protein 333 OS=Homo sapiens OX=9606 GN... [more]
sp|P08970|SUHW_DROME1.843e-1824.83Protein suppressor of hairy wing OS=Drosophila mel... [more]
sp|G5E8B9|ZBT11_MOUSE2.171e-1824.21Zinc finger and BTB domain-containing protein 11 O... [more]
sp|Q9NW07|ZN358_HUMAN2.215e-1827.27Zinc finger protein 358 OS=Homo sapiens OX=9606 GN... [more]
sp|O95625|ZBT11_HUMAN5.755e-1825.51Zinc finger and BTB domain-containing protein 11 O... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UFZ19.885e-11142.86Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A2H1C8Z01.668e-11042.69Zinc finger, C2H2 type OS=Fasciola hepatica OX=619... [more]
A0A0R3W5T82.168e-11047.93Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
U6J2H92.423e-11047.93Zinc finger and SCAN domain-containing protein 2 O... [more]
A0A0R3WKD62.996e-11047.93Uncharacterized protein OS=Hydatigena taeniaeformi... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GZF11.096e-2024.49GDNF inducible zinc finger protein 1 [Source:HGNC ... [more]
ENSAMXT00000011224.22.877e-1928.52pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000033814.17.690e-1926.75gastrula zinc finger protein XlCGF53.1-like [Sourc... [more]
zbtb111.986e-1824.82zinc finger and BTB domain containing 11 [Source:N... [more]
zbtb112.003e-1824.82zinc finger and BTB domain containing 11 [Source:N... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008822.11.373e-1826.06pep scaffold:Pmarinus_7.0:GL477256:50027:56378:-1 ... [more]
ENSPMAT00000008540.11.899e-1631.54pep scaffold:Pmarinus_7.0:GL486672:772:1638:-1 gen... [more]
ENSPMAT00000009055.13.312e-1629.58pep scaffold:Pmarinus_7.0:GL477074:18725:22562:1 g... [more]
ENSPMAT00000007433.13.870e-1629.07pep scaffold:Pmarinus_7.0:GL498585:318:1981:-1 gen... [more]
ENSPMAT00000001529.15.752e-1624.75pep scaffold:Pmarinus_7.0:GL483083:8841:14719:-1 g... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
AZF11.038e-1526.99Zinc-finger transcription factor; involved in diau... [more]
PZF15.408e-1326.27Transcription factor IIIA (TFIIIA); essential DNA ... [more]
ZAP14.177e-1131.21Zinc-regulated transcription factor; binds to zinc... [more]
RGM15.375e-843.64Putative zinc finger DNA binding transcription fac... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO421278.502e-1925.62Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO410821.078e-1826.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384192.852e-1728.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334787.566e-1738.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463741.499e-1628.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000024795.23.876e-2226.90pep primary_assembly:ASM223467v1:2:6353588:6393021... [more]
ENSORLT00000017686.25.312e-2226.87pep primary_assembly:ASM223467v1:3:9540654:9578150... [more]
ENSORLT00000037663.16.379e-2225.82pep primary_assembly:ASM223467v1:2:11598888:116520... [more]
ENSORLT00000043613.16.638e-2231.82pep primary_assembly:ASM223467v1:17:11345264:11348... [more]
ENSORLT00000039104.11.032e-2125.94pep primary_assembly:ASM223467v1:17:11164388:11168... [more]
back to top
BLAST of Zinc finger and SCAN domain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000031902.10.000e+0100.00SMESG000031902.1[more]
SMESG000049972.10.000e+097.20SMESG000049972.1[more]
SMESG000031902.10.000e+099.64SMESG000031902.1[more]
SMESG000049972.10.000e+097.35SMESG000049972.1[more]
SMESG000049972.10.000e+097.01SMESG000049972.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031507 ID=SMED30031507|Name=Zinc finger and SCAN domain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=2131bp
GTTTTTTAGTAATTTTAAATTTAAAGCACGCGATATGTATCAAAATTCAC
ACGAAATCCAAATCAAAAATTCACTAAATTTTGTTTAGGGTGAAAATTTA
GAAAATTTTGAAACTGATTTTCTTGAAACATCAGAGTATAATGTCAATGA
CGCATTGGACTTAGAACAATATTTAAATCAAATAATTGAAATAAATGGAA
AGCATTATCAAATAAATGTCGATGATAACAATGAAGTGTATTTAGAAGTT
TTAGCTGAAGATTCTAACGATATTATAAATGGAAACGTGAATATTAAATT
TAATTCAGACGAGTCATTACACCAACCTATTTTAAGGAATGATAAAGAAT
ATGCATTTGTCGAAAAAGATGGTGGTTTTTCTCTTGAAGAGGTATCTGGT
AAAGTCAAATATATTTGCCATATACAAAATTGTTATAAGCAATTTAACCA
TGCAAATTCTCTTACAAAGCATTACAAAGATTGTCACGATGTCAAGATTT
TCGTATGTCGTCAGTGCCCGGGAATATTTCATGAATTATCAGAACTATTT
CTTCACGCTCGCAGAGAACACGTTGATCCAAGAAAGCCACCAAAAGACCC
CAGCAAATACCGCTACCATTGTACCTATTCGCCGGATTGTAATTACATGA
CAAATAACGGTGGGACATTTGAACATCACATTCGTGCTCATTCTGGTGAT
AAACCGTTTGAATGTGATATTTGTCATAAACGATTCACCCAGAATGCCAA
CATGAAAACTCACCGAAGTCGACATGTATCAGAAAAATTATTCAATTGTG
ATATTTGCAAGAAAAGTTTCAAAACCCATGACATATATTTGGCTCATTTG
CGAACCAGAGAGCACGAATTACGGGAATATTTTGTTGAGAAAGTCAATTT
TTCGGTAAAAGTAATTTGCCTCGGTTGCAATGAGCAATTTTGTAAATTAT
TCGATATCCGTAATCATATGAAAGTCTGTGATCAGAAACTAGAAAGCATG
TTTAAATGTTCGATTTGTGATATATTGTTCGGAGATTTTGAAGAATTAAA
AAAGCACATTAAAAATCATAAAGAAAGCATGTTAATTGCTTGCCCGATTT
GTAATGAGCCCGGTTTCGTTCATTATAACCAACTCAATCATCACATCACC
CGTTGTCACAGTATTAAAGTTTCCCGAAAAAGCGTCTGTAGATATTGTGA
ATTGATCTTCCAAACCGAAACCGAAATGACTGACCACGTGAAAGAATACC
ACGCTAATGAAATAAACTCCCGGAAATCCCATGGGATAATCGGCAGGTTT
TCGTGCCCCTATGAAGGCTGTAAATTCACCTCAAATACTGAATTGCTTAT
CACAAGTCACATTGAACGTCACGAGAACGGTAAACTAGAAGCAGAGAAAA
GCTCACCGAAAAAGCGCGGCAGGAAACGAAAGTTAATCGATGGGAATTTA
AACGGTGGTTTTAACTTAGAAATGCCAACCATTAAGAATGAGCCAATATC
GTCTCATGATTTTGTGAAGAAACCTAGAGGAAGACCGAGGAAAGTAGTGG
AATTATGCGCAATTGAAAATAAAGAAGAAATTGTCTGTCGAGAACACCCG
GTGGATTTAGAGGAATTCTGTAGAAATGATTTGGATTATGAGAATCTGGC
TGAAACGTTTTTTAAAAGTGAGACACAAAATGATTCCGTTAAGAAAAGAG
GGAGACCAAAGAAATCTGTTGTCGCTATTCAATCGAACGCTACTCAAGGA
AATATCCCTGCTATTAAGGTAGATGAGCAATTTACCCCGTATATAAAAAC
AGAAACCGTAACTGATAACGTTGATCAAGATTGTTTATATGTGTAGAGTT
TATTTAGAATATATATATGTCAATGATTTTTTGGCTGGGTTTCGTTTTTA
TAATGGTCATCTTAAATATTTTAGCAAAACCTTGAAAATTAAATATTGAT
TATGTGTGGTTTATGGTTTCGATAAACTTGACCCCAGATATAACTATTCT
TTGCCCCAATGGTTACCCGTCACTAAGCAACGTTGGTAATGCAACCATTG
GTTTTGAGGTCGCCAAAAGTGAGCGCTACATAGGAACTACTCTGGTCTGA
CCTCAATCTGGGTTCAACGCACTACCGTTAG
back to top

protein sequence of SMED30031507-orf-1

>SMED30031507-orf-1 ID=SMED30031507-orf-1|Name=SMED30031507-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=400bp
MTNNGGTFEHHIRAHSGDKPFECDICHKRFTQNANMKTHRSRHVSEKLFN
CDICKKSFKTHDIYLAHLRTREHELREYFVEKVNFSVKVICLGCNEQFCK
LFDIRNHMKVCDQKLESMFKCSICDILFGDFEELKKHIKNHKESMLIACP
ICNEPGFVHYNQLNHHITRCHSIKVSRKSVCRYCELIFQTETEMTDHVKE
YHANEINSRKSHGIIGRFSCPYEGCKFTSNTELLITSHIERHENGKLEAE
KSSPKKRGRKRKLIDGNLNGGFNLEMPTIKNEPISSHDFVKKPRGRPRKV
VELCAIENKEEIVCREHPVDLEEFCRNDLDYENLAETFFKSETQNDSVKK
RGRPKKSVVAIQSNATQGNIPAIKVDEQFTPYIKTETVTDNVDQDCLYV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR015880Znf_C2H2-like
IPR017956AT_hook_DNA-bd_motif
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003676nucleic acid binding
GO:0046872metal ion binding