Leucine zipper transcription factor like 1

Overview
NameLeucine zipper transcription factor like 1
Smed IDSMED30031496
Length (bp)1042
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Leucine zipper transcription factor like 1 (SMED30031496) t-SNE clustered cells

Violin plots show distribution of expression levels for Leucine zipper transcription factor like 1 (SMED30031496) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Leucine zipper transcription factor like 1 (SMED30031496) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Leucine zipper transcription factor like 1 (SMED30031496) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031496

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30031496SMESG000020499.1 SmedASXL_019789SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031496SMESG000020499.1 dd_Smed_v4_8415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031496SMESG000020499.1 dd_Smed_v4_8415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031496SMESG000020499.1 dd_Smed_v4_8415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031496SMESG000020499.1 dd_Smed_v4_8415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031496SMESG000020499.1 dd_Smed_v4_8415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30031496SMESG000020499.1 dd_Smed_v4_8415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
non-ciliated neuronSMED30031496SMESG000020499.1 dd_Smed_v4_8415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031496SMESG000020499.1 Contig30840newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031496SMESG000020499.1 Contig30840uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031496SMESG000020499.1 SMESG000020498.1 Contig29289newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031496SMESG000020499.1 SMESG000020498.1 Contig29289uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30031496SMESG000020499.1 dd_Smed_v6_8415_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30031496SMESG000020499.1 dd_Smed_v4_8415_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Human
Match: LZTFL1 (leucine zipper transcription factor like 1 [Source:HGNC Symbol;Acc:HGNC:6741])

HSP 1 Score: 189.119 bits (479), Expect = 3.813e-57
Identity = 125/308 (40.58%), Postives = 186/308 (60.39%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDE--RNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRV--------------NLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            + H + V+NYMRFAR +R  RL+ VD+CF+DLK  RL++DT FT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ + +  +K      +K  L PLNE G + LL  EI RLQ+EN++L+ RL ++E  A      KS L   L+ L  D+  +K  I                     DLS+ +++ A  +               +LEE+L   K +LL +Q  L M EKELEKK  +T  ++N+K +L KKN+Q+KD R+RL ++E
Sbjct:    8 EHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDT-FTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLNKEILRLQEENEKLKSRLKTIEIQATNALDEKSKLEKALQDLQLDQGNQKDFI------------------KAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYE 296          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Human
Match: LZTFL1 (leucine zipper transcription factor like 1 [Source:HGNC Symbol;Acc:HGNC:6741])

HSP 1 Score: 177.948 bits (450), Expect = 4.852e-53
Identity = 121/298 (40.60%), Postives = 179/298 (60.07%), Query Frame = 1
Query:  109 MRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDE--RNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRV--------------NLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            MRFAR +R  RL+ VD+CF+DLK  RL++DT FT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ + +  +K      +K  L PLNE G + LL  EI RLQ+EN++L+ RL ++E  A      KS L   L+ L  D+  +K  I                     DLS+ +++ A  +               +LEE+L   K +LL +Q  L M EKELEKK  +T  ++N+K +L KKN+Q+KD R+RL ++E
Sbjct:    1 MRFARSKRGLRLKTVDSCFQDLKESRLVEDT-FTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLNKEILRLQEENEKLKSRLKTIEIQATNALDEKSKLEKALQDLQLDQGNQKDFI------------------KAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYE 279          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Human
Match: LZTFL1 (leucine zipper transcription factor like 1 [Source:HGNC Symbol;Acc:HGNC:6741])

HSP 1 Score: 115.161 bits (287), Expect = 1.273e-29
Identity = 96/272 (35.29%), Postives = 145/272 (53.31%), Query Frame = 1
Query:  187 LMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDE--RNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRV--------------NLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            L++DT FT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ + +  +K      +K  L PLNE G + LL    + L    DE                  KS L   L+ L  D+  +K  I                     DLS+ +++ A  +               +LEE+L   K +LL +Q  L M EKELEKK  +T  ++N+K +L KKN+Q+KD R+RL ++E
Sbjct:    2 LVEDT-FTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLNKATNAL----DE------------------KSKLEKALQDLQLDQGNQKDFI------------------KAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYE 232          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Human
Match: LZTFL1 (leucine zipper transcription factor like 1 [Source:HGNC Symbol;Acc:HGNC:6741])

HSP 1 Score: 113.235 bits (282), Expect = 1.022e-28
Identity = 68/158 (43.04%), Postives = 103/158 (65.19%), Query Frame = 1
Query:  187 LMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDE--RNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKK 654
            L+ + TFT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ + +  +K      +K  L PLNE G + LL  EI RLQ+EN++L+ RL ++E  A      KS L   L+ L  D+  +K
Sbjct:   39 LLVEDTFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLNKEILRLQEENEKLKSRLKTIEIQATNALDEKSKLEKALQDLQLDQGNQK 196          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Human
Match: LZTFL1 (leucine zipper transcription factor like 1 [Source:HGNC Symbol;Acc:HGNC:6741])

HSP 1 Score: 103.99 bits (258), Expect = 3.765e-27
Identity = 50/91 (54.95%), Postives = 71/91 (78.02%), Query Frame = 1
Query:  109 MRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELEN 381
            MRFAR +R  RL+ VD+CF+DLK  RL++DT FT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELEN
Sbjct:    1 MRFARSKRGLRLKTVDSCFQDLKESRLVEDT-FTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELEN 90          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Zebrafish
Match: lztfl1 (leucine zipper transcription factor-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-945])

HSP 1 Score: 189.889 bits (481), Expect = 9.682e-58
Identity = 124/293 (42.32%), Postives = 189/293 (64.51%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSK-DERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            + H   V+NYMRFAR +R  RL+ VD+CF+DLK  RL+++T +T DE+ DIL  L+  +R E E EL++++HTNV+LL QLF QAE+++L L  DI+ELENRELL+++  FE+  F    K ++  +K  L PLNE G S LL+ EI RLQ++ND+L+ RL ++E  A+   + KS   + L+ L   + V +    +      +  LE  +  ++ D     ++N   + +L++ L+ TK +LL +Q  L + EKELEKK  +T  ++NLK +L KKNEQ+KD R+RL ++E
Sbjct:    8 EHHQHEVINYMRFARSKRALRLKTVDSCFQDLKESRLIEET-YTVDEVTDILNGLQVLVRGEVEMELINTAHTNVLLLRQLFSQAEKFYLRLQTDISELENRELLEQVAEFEKTDFKPNIKANQETTKPKLAPLNEGGVSELLQREISRLQEDNDKLKARLRTLESRAMCALEDKSKAETALKDLQKSQGVHQ----SVMCAQEIANLEDTVAAMQADFEKTLNTNITSQKDLQDSLVSTKHDLLRVQEQLSLAEKELEKKFQQTAAYRNLKEILNKKNEQIKDLRKRLLRYE 295          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Zebrafish
Match: lztfl1 (leucine zipper transcription factor-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-945])

HSP 1 Score: 159.458 bits (402), Expect = 1.617e-46
Identity = 105/271 (38.75%), Postives = 160/271 (59.04%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSK-DERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNL 888
            + H   V+NYMRFAR +R  RL+ VD+CF+DLK  RL+++T +T DE+ DIL  L+  +R E E EL++++HTNV+LL QLF QAE+++L L  DI+ELENRELL+++  FE+  F    K ++  +K  L PLNE G S LL+ EI RLQ++ND+L+ RL ++E  +V   +  ++L   +  +                                D     ++N   + +L++ L+ TK +LL +Q  L + EKELEKK  +T  ++NL
Sbjct:    8 EHHQHEVINYMRFARSKRALRLKTVDSCFQDLKESRLIEET-YTVDEVTDILNGLQVLVRGEVEMELINTAHTNVLLLRQLFSQAEKFYLRLQTDISELENRELLEQVAEFEKTDFKPNIKANQETTKPKLAPLNEGGVSELLQREISRLQEDNDKLKARLRTLESRSVMCAQEIANLEDTVAAMQA------------------------------DFEKTLNTNITSQKDLQDSLVSTKHDLLRVQEQLSLAEKELEKKFQQTAAYRNL 247          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Zebrafish
Match: lztfl1 (leucine zipper transcription factor-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-945])

HSP 1 Score: 137.502 bits (345), Expect = 5.271e-38
Identity = 105/291 (36.08%), Postives = 161/291 (55.33%), Query Frame = 1
Query:   85 HNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSK-DERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            H   V+NYMRFAR +R  RL+ VD+CF+DLK  RL+++ T+T DE                                     AE+++L L  DI+ELENRELL+++  FE+  F    K ++  +K  L PLNE G S LL+ EI RLQ++ND+L+ RL ++E  A+   + KS   + L+ L   + V +    +      +  LE  +  ++ D     ++N   + +L++ L+ TK +LL +Q  L + EKELEKK  +T  ++NLK +L KKNEQ+KD R+RL ++E
Sbjct:   10 HQHEVINYMRFARSKRALRLKTVDSCFQDLKESRLIEE-TYTVDE-------------------------------------AEKFYLRLQTDISELENRELLEQVAEFEKTDFKPNIKANQETTKPKLAPLNEGGVSELLQREISRLQEDNDKLKARLRTLESRAMCALEDKSKAETALKDLQKSQGVHQ----SVMCAQEIANLEDTVAAMQADFEKTLNTNITSQKDLQDSLVSTKHDLLRVQEQLSLAEKELEKKFQQTAAYRNLKEILNKKNEQIKDLRKRLLRYE 258          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Xenopus
Match: ube2i (ubiquitin conjugating enzyme E2 I [Source:Xenbase;Acc:XB-GENE-974017])

HSP 1 Score: 183.726 bits (465), Expect = 6.735e-55
Identity = 124/297 (41.75%), Postives = 189/297 (63.64%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDERNS--KTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVAL--NKMKS-SLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            D H + V+NY+ FAR +R  RL+ VD+CF+DLK+ RL+++T FT DE+ ++L  L+  +  E E EL++S+HTN +LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ +FS  +K       K  L PL E G S LL  EI RLQ+END+L+ RL ++E  A +   +K+K+ S   +L+K+  ++  K+ + D      ++ +L+ +     +D +            LE++L  TK ELL +Q  L   EKELEKK  +T  ++N+K++L KKN+Q+KD R+RL K+E
Sbjct:   24 DHHQNEVINYIHFARSRRALRLKTVDSCFQDLKDSRLVEET-FTVDEVAEMLQGLQAVVHGEVELELINSAHTNFLLLRQLFMQAEKWYLKLHTDISELENRELLEQVAEFEKAEFSSSNKKANTEMIKPKLAPLFESGPSELLNKEISRLQEENDKLKARLKTIEYQATSALGDKIKAESALKDLQKVQDNQKAKQNTQDINILEKTMADLKCDFEKTVNDHTVSQKY-------LEDNLASTKHELLRVQEQLSSAEKELEKKFQQTAVYRNMKDILTKKNDQIKDLRKRLQKYE 312          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Xenopus
Match: ube2i (ubiquitin conjugating enzyme E2 I [Source:Xenbase;Acc:XB-GENE-974017])

HSP 1 Score: 181.03 bits (458), Expect = 3.377e-54
Identity = 123/295 (41.69%), Postives = 187/295 (63.39%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDERNS--KTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVAL--NKMKS-SLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGK 948
            D H + V+NY+ FAR +R  RL+ VD+CF+DLK+ RL+++T FT DE+ ++L  L+  +  E E EL++S+HTN +LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ +FS  +K       K  L PL E G S LL  EI RLQ+END+L+ RL ++E  A +   +K+K+ S   +L+K+  ++  K+ + D      ++ +L+ +     +D +            LE++L  TK ELL +Q  L   EKELEKK  +T  ++N+K++L KKN+Q+KD R+RL K
Sbjct:   11 DHHQNEVINYIHFARSRRALRLKTVDSCFQDLKDSRLVEET-FTVDEVAEMLQGLQAVVHGEVELELINSAHTNFLLLRQLFMQAEKWYLKLHTDISELENRELLEQVAEFEKAEFSSSNKKANTEMIKPKLAPLFESGPSELLNKEISRLQEENDKLKARLKTIEYQATSALGDKIKAESALKDLQKVQDNQKAKQNTQDINILEKTMADLKCDFEKTVNDHTVSQKY-------LEDNLASTKHELLRVQEQLSSAEKELEKKFQQTAVYRNMKDILTKKNDQIKDLRKRLQK 297          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Xenopus
Match: ube2i (ubiquitin conjugating enzyme E2 I [Source:Xenbase;Acc:XB-GENE-974017])

HSP 1 Score: 164.081 bits (414), Expect = 1.269e-47
Identity = 115/295 (38.98%), Postives = 180/295 (61.02%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVAL--NKMKS-SLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            D H + V+NY+ FAR +R  RL+ VD+CF+DLK+ RL+++T FT DE+ ++L  L+  +  E E EL++S+HTN +LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ +FS  +K                       EI RLQ+END+L+ RL ++E  A +   +K+K+ S   +L+K+  ++  K+ + D      ++ +L+ +     +D +            LE++L  TK ELL +Q  L   EKELEKK  +T  ++N+K++L KKN+Q+KD R+RL K+E
Sbjct:   24 DHHQNEVINYIHFARSRRALRLKTVDSCFQDLKDSRLVEET-FTVDEVAEMLQGLQAVVHGEVELELINSAHTNFLLLRQLFMQAEKWYLKLHTDISELENRELLEQVAEFEKAEFSSSNKK----------------------EISRLQEENDKLKARLKTIEYQATSALGDKIKAESALKDLQKVQDNQKAKQNTQDINILEKTMADLKCDFEKTVNDHTVSQKY-------LEDNLASTKHELLRVQEQLSSAEKELEKKFQQTAVYRNMKDILTKKNDQIKDLRKRLQKYE 288          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Mouse
Match: Lztfl1 (leucine zipper transcription factor-like 1 [Source:MGI Symbol;Acc:MGI:1934860])

HSP 1 Score: 188.734 bits (478), Expect = 3.611e-57
Identity = 126/306 (41.18%), Postives = 187/306 (61.11%), Query Frame = 1
Query:   85 HNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDE--RNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRV--------------NLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            H + V+NYMRFAR +R  RL+ VD+CF+DLK+ RL+++T FT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ +F   SK      +K  L P+NE G + LL  EI RLQ+EN++L+ RL ++E  AV     KS L         +R ++ L +D            ++  L   DL   +++ A  R               +LEE+L   K +LL +Q  L M EKELEKK  +T  ++N+K +L KKN+Q+KD R+RL K+E
Sbjct:   10 HQNEVINYMRFARSKRGLRLKTVDSCFQDLKDSRLVEET-FTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFSQAEKWYLKLQTDISELENRELLEQVAEFEKAEFVSSSKKPIIDITKPKLVPINEGGTTELLNKEILRLQQENEKLKSRLKTIEIQAVNALDEKSKL---------ERVLQDLQLDQ---------ENQQDLLKAQDLDDLENTVATLRSEFQKTLNDKTENQKSLEENLAAAKHDLLRVQEQLSMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAKYE 296          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Mouse
Match: Lztfl1 (leucine zipper transcription factor-like 1 [Source:MGI Symbol;Acc:MGI:1934860])

HSP 1 Score: 158.688 bits (400), Expect = 9.901e-47
Identity = 89/190 (46.84%), Postives = 131/190 (68.95%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDE--RNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDR 642
            + H + V+NYMRFAR +R  RL+ VD+CF+DLK+ RL+++T FT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ +F   SK      +K  L P+NE G + LL  EI RLQ+EN++L+ RL ++E  AV     KS L   L+ L  D+
Sbjct:   15 EHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKDSRLVEET-FTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFSQAEKWYLKLQTDISELENRELLEQVAEFEKAEFVSSSKKPIIDITKPKLVPINEGGTTELLNKEILRLQQENEKLKSRLKTIEIQAVNALDEKSKLERVLQDLQLDQ 203          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Mouse
Match: Lztfl1 (leucine zipper transcription factor-like 1 [Source:MGI Symbol;Acc:MGI:1934860])

HSP 1 Score: 148.288 bits (373), Expect = 1.020e-41
Identity = 109/288 (37.85%), Postives = 162/288 (56.25%), Query Frame = 1
Query:  139 RLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDE--RNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRV--------------NLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            R R    CF        + + TFT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ +F   SK      +K  L P+NE G + LL  EI RLQ+EN++L+ RL ++E  AV     KS L         +R ++ L +D            ++  L   DL   +++ A  R               +LEE+L   K +LL +Q  L M EKELEKK  +T  ++N+K +L KKN+Q+KD R+RL K+E
Sbjct:   18 RPRCRPPCFLSDPPPPWLVEETFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFSQAEKWYLKLQTDISELENRELLEQVAEFEKAEFVSSSKKPIIDITKPKLVPINEGGTTELLNKEILRLQQENEKLKSRLKTIEIQAVNALDEKSKL---------ERVLQDLQLDQ---------ENQQDLLKAQDLDDLENTVATLRSEFQKTLNDKTENQKSLEENLAAAKHDLLRVQEQLSMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAKYE 287          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Mouse
Match: Lztfl1 (leucine zipper transcription factor-like 1 [Source:MGI Symbol;Acc:MGI:1934860])

HSP 1 Score: 135.576 bits (340), Expect = 8.412e-39
Identity = 67/133 (50.38%), Postives = 99/133 (74.44%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDERNSKTTLNPL 477
            + H + V+NYMRFAR +R  RL+ VD+CF+DLK+ RL+++T FT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ +F   SK     K+ LNPL
Sbjct:    8 EHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKDSRLVEET-FTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFSQAEKWYLKLQTDISELENRELLEQVAEFEKAEFVSSSK-----KSILNPL 134          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Mouse
Match: Lztfl1 (leucine zipper transcription factor-like 1 [Source:MGI Symbol;Acc:MGI:1934860])

HSP 1 Score: 115.161 bits (287), Expect = 6.883e-30
Identity = 94/265 (35.47%), Postives = 141/265 (53.21%), Query Frame = 1
Query:  202 TFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDE--RNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISV---EETAVALNKMK---------SSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            TFT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ +F   SK      +K  L P+NE G + LL   ++ L  E  +L R L  +   +E    L K +         ++L SE +K   D+   + S+                                     EE+L   K +LL +Q  L M EKELEKK  +T  ++N+K +L KKN+Q+KD R+RL K+E
Sbjct:    6 TFTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFSQAEKWYLKLQTDISELENRELLEQVAEFEKAEFVSSSKKPIIDITKPKLVPINEGGTTELLNKAVNALD-EKSKLERVLQDLQLDQENQQDLLKAQDLDDLENTVATLRSEFQKTLNDKTENQKSL-------------------------------------EENLAAAKHDLLRVQEQLSMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAKYE 232          
BLAST of Leucine zipper transcription factor like 1 vs. UniProt/SwissProt
Match: sp|Q562C6|LZTL1_RAT (Leucine zipper transcription factor-like protein 1 OS=Rattus norvegicus OX=10116 GN=Lztfl1 PE=2 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 2.656e-57
Identity = 122/299 (40.80%), Postives = 190/299 (63.55%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDE--RNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRA-----VKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            + H + V+NYMRFAR +R  RL+ VD+CF+DLK  RL+++T FT DE+ ++L  L+  + +E ESEL++++HTNV+LL QLF QAE+W+L L  D++ELENRELL+++  FE+ +F+  +K      +K  L P+NE G + LL  EI RLQ+EN++L+ RL ++E  AV     KS L   L+ L  D+      +K   +D+ ++ ++  +          +     +   + + +LEE+L   K +LL +Q  L M EKELEKK  +T  ++N+K +L KKN+Q+KD R+RL K+E
Sbjct:    8 EHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEET-FTIDEVSEVLNGLQAVVHSEVESELINTAHTNVLLLRQLFSQAEKWYLKLQTDVSELENRELLEQVAEFEKAEFASSNKKPIIDITKPKLVPINEGGTTELLNKEILRLQQENEKLKSRLKTIETQAVNALDEKSKLERVLQDLQLDQGNQQDFIKAQDLDDLENTVAALKS---------EFQKTLNDKTENQKSLEENLAAAKHDLLRVQEQLSMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAKYE 296          
BLAST of Leucine zipper transcription factor like 1 vs. UniProt/SwissProt
Match: sp|Q3ZBL4|LZTL1_BOVIN (Leucine zipper transcription factor-like protein 1 OS=Bos taurus OX=9913 GN=LZTFL1 PE=2 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 2.773e-57
Identity = 124/294 (42.18%), Postives = 186/294 (63.27%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDE--RNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            + H + V+NYMRFAR +R  RL+ VD+CF+DLK  RL+++T FT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ +F+  +K     + K  L PL+E G + LL  EI RLQ+EN++L+ RL ++E  A      KS L   L+ L  +   +K  I  +        +    +  +  L+  D +  Q   +LEE+L   K +LL +Q  L M EKELEKK  +T  F+N+K +L KKN+Q+KD R+RL K+E
Sbjct:    8 EHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEET-FTVDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFSQAEKWYLKLQTDISELENRELLEQVAEFEKAEFTSSNKKSIIDSMKPKLAPLHEGGAAELLNKEIIRLQEENEKLKSRLKTIESQATDALDEKSKLERALQDLQLEHGSQKDFIKAQDLSDLENTVAALKSEFQKTLN--DQTENQ--KSLEENLATAKHDLLRVQEQLSMAEKELEKKFQQTAAFRNMKEILTKKNDQIKDLRKRLAKYE 296          
BLAST of Leucine zipper transcription factor like 1 vs. UniProt/SwissProt
Match: sp|Q9NQ48|LZTL1_HUMAN (Leucine zipper transcription factor-like protein 1 OS=Homo sapiens OX=9606 GN=LZTFL1 PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.831e-56
Identity = 125/308 (40.58%), Postives = 186/308 (60.39%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDE--RNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRV--------------NLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            + H + V+NYMRFAR +R  RL+ VD+CF+DLK  RL++DT FT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ + +  +K      +K  L PLNE G + LL  EI RLQ+EN++L+ RL ++E  A      KS L   L+ L  D+  +K  I                     DLS+ +++ A  +               +LEE+L   K +LL +Q  L M EKELEKK  +T  ++N+K +L KKN+Q+KD R+RL ++E
Sbjct:    8 EHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEDT-FTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLNKEILRLQEENEKLKSRLKTIEIQATNALDEKSKLEKALQDLQLDQGNQKDFI------------------KAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYE 296          
BLAST of Leucine zipper transcription factor like 1 vs. UniProt/SwissProt
Match: sp|Q9JHQ5|LZTL1_MOUSE (Leucine zipper transcription factor-like protein 1 OS=Mus musculus OX=10090 GN=Lztfl1 PE=1 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 2.526e-56
Identity = 126/306 (41.18%), Postives = 187/306 (61.11%), Query Frame = 1
Query:   85 HNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDE--RNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRV--------------NLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            H + V+NYMRFAR +R  RL+ VD+CF+DLK+ RL+++T FT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ +F   SK      +K  L P+NE G + LL  EI RLQ+EN++L+ RL ++E  AV     KS L         +R ++ L +D            ++  L   DL   +++ A  R               +LEE+L   K +LL +Q  L M EKELEKK  +T  ++N+K +L KKN+Q+KD R+RL K+E
Sbjct:   10 HQNEVINYMRFARSKRGLRLKTVDSCFQDLKDSRLVEET-FTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFSQAEKWYLKLQTDISELENRELLEQVAEFEKAEFVSSSKKPIIDITKPKLVPINEGGTTELLNKEILRLQQENEKLKSRLKTIEIQAVNALDEKSKL---------ERVLQDLQLDQ---------ENQQDLLKAQDLDDLENTVATLRSEFQKTLNDKTENQKSLEENLAAAKHDLLRVQEQLSMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAKYE 296          
BLAST of Leucine zipper transcription factor like 1 vs. UniProt/SwissProt
Match: sp|Q5RBR4|LZTL1_PONAB (Leucine zipper transcription factor-like protein 1 OS=Pongo abelii OX=9601 GN=LZTFL1 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 6.281e-56
Identity = 125/308 (40.58%), Postives = 186/308 (60.39%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDE--RNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRV--------------NLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE 954
            + H + V+NYMRFAR +R  RL+ VD+CF+DLK  RL+++T FT DE+ ++L  L+  + +E ESEL+++++TNV+LL QLF QAE+W+L L  DI+ELENRELL+++  FE+ + +  +K      +K  L PLNE G + LL  EI RLQ+EN++L+ RL +VE  A      KS L   L+ L  D+  +K  I                     DLS+ +++ A  +               +LEE+L   K +LL +Q  L M EKELEKK  +T  ++N+K +L KKN+Q+KD R+RL ++E
Sbjct:    8 EHHQNEVINYMRFARSKRGLRLKTVDSCFQDLKESRLVEET-FTIDEVSEVLNGLQAVVHSEVESELINTAYTNVLLLRQLFAQAEKWYLKLQTDISELENRELLEQVAEFEKAEITSSNKKPILDVTKPKLAPLNEGGTAELLNKEILRLQEENEKLKSRLKTVEIQATNALDEKSKLEKALQDLQLDQGNQKDFI------------------KAQDLSNLENTVAALKSEFQKTLNDKTENQKSLEENLATAKHDLLRVQEQLHMAEKELEKKFQQTAAYRNMKEILTKKNDQIKDLRKRLAQYE 296          
BLAST of Leucine zipper transcription factor like 1 vs. TrEMBL
Match: A0A1S3INS5 (leucine zipper transcription factor-like protein 1 isoform X3 OS=Lingula unguis OX=7574 GN=LOC106165757 PE=4 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 8.631e-73
Identity = 145/297 (48.82%), Postives = 203/297 (68.35%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKD----ERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHEE 957
            D H + V+NYMRFARYQR QRLR VDACF DLK+ RL+D+T FT DE+ ++L  L   +R E ESEL++++HTNV+LL QL +QAE+WHL L  DI+ELENR+LL+KIK FE+ +F+   +D      +  + L PLNE   S LL MEI+RL++EN++L+ RL +VE  A+ + + K+ L+S+LEK     +  K ++  +     +E L K++  LK ++       +     LE DL  TK ELL ++A L++ EKELEKKVS+T PFKNLK ML KKN+Q+KD R+RL K+E+
Sbjct:    9 DHHQATVINYMRFARYQRGQRLRAVDACFDDLKDSRLIDET-FTVDEVTEMLDGLLAVVRGEMESELINTAHTNVLLLRQLCQQAEKWHLKLQADISELENRDLLEKIKDFEDAEFTGTKRDTDFSALSGPSKLEPLNESSASALLHMEIERLKEENEKLKDRLKAVESQALGIQQEKNLLSSDLEKTKNALSSAKGTVIRQDSGEEVEALRKQMAGLKSEIDKSRKHGSAAAEMLEGDLADTKHELLKVRADLELAEKELEKKVSQTAPFKNLKQMLTKKNDQIKDLRRRLAKYED 304          
BLAST of Leucine zipper transcription factor like 1 vs. TrEMBL
Match: V3ZR86 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_128288 PE=4 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 8.845e-73
Identity = 139/290 (47.93%), Postives = 198/290 (68.28%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGK 948
            + H + V+NYMRFARYQR QRLR VDACF++L++ RL +D TFTRDE+ D+L  L   +R E ESEL++++HTNV+++ Q+F+Q+E+WHL L  DI+ELENR LL++IK FEE +F+   +D   + + L PLNE GG+ LL M ID + K+NDELR+RL   E+   +  K + +L+S+LEK   +   +K ++  +       ++    + L+    +GD + A    NL  DL  TK ELL ++ ML+M EKELEKKVS+T PFKNLK ML KKN+Q+K+ R+RL K
Sbjct:    8 EHHQNQVVNYMRFARYQRGQRLRAVDACFEELQDSRL-NDATFTRDEMVDMLDGLLAVVRGEVESELINTAHTNVLMMRQMFQQSEKWHLKLQADISELENRNLLEQIKEFEEREFTGTKRDTDFTPSKLTPLNETGGTALLHMRIDEITKDNDELRKRLSKYEKVVKSRFKTQ-ALSSDLEKAEAELRARKSNVTQEDLEDLHRKMSGLQSDLERTKRAGDDTAA----NLTHDLSGTKHELLKVREMLEMAEKELEKKVSQTNPFKNLKQMLQKKNDQMKELRKRLSK 291          
BLAST of Leucine zipper transcription factor like 1 vs. TrEMBL
Match: A0A1S3IPS9 (leucine zipper transcription factor-like protein 1 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106165757 PE=4 SV=1)

HSP 1 Score: 237.654 bits (605), Expect = 1.284e-72
Identity = 145/297 (48.82%), Postives = 203/297 (68.35%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKD----ERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHEE 957
            D H + V+NYMRFARYQR QRLR VDACF DLK+ RL+D+T FT DE+ ++L  L   +R E ESEL++++HTNV+LL QL +QAE+WHL L  DI+ELENR+LL+KIK FE+ +F+   +D      +  + L PLNE   S LL MEI+RL++EN++L+ RL +VE  A+ + + K+ L+S+LEK     +  K ++  +     +E L K++  LK ++       +     LE DL  TK ELL ++A L++ EKELEKKVS+T PFKNLK ML KKN+Q+KD R+RL K+E+
Sbjct:   22 DHHQATVINYMRFARYQRGQRLRAVDACFDDLKDSRLIDET-FTVDEVTEMLDGLLAVVRGEMESELINTAHTNVLLLRQLCQQAEKWHLKLQADISELENRDLLEKIKDFEDAEFTGTKRDTDFSALSGPSKLEPLNESSASALLHMEIERLKEENEKLKDRLKAVESQALGIQQEKNLLSSDLEKTKNALSSAKGTVIRQDSGEEVEALRKQMAGLKSEIDKSRKHGSAAAEMLEGDLADTKHELLKVRADLELAEKELEKKVSQTAPFKNLKQMLTKKNDQIKDLRRRLAKYED 317          
BLAST of Leucine zipper transcription factor like 1 vs. TrEMBL
Match: A0A1S3IMT6 (leucine zipper transcription factor-like protein 1 isoform X2 OS=Lingula unguis OX=7574 GN=LOC106165757 PE=4 SV=1)

HSP 1 Score: 236.884 bits (603), Expect = 1.841e-72
Identity = 144/297 (48.48%), Postives = 203/297 (68.35%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKD----ERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHEE 957
            D H + V+NYMRFARYQR QRLR VDACF DLK+ RL+D+T FT DE+ ++L  L   +R E ESEL++++HTNV+LL QL +QAE+WHL L  DI+ELENR+LL+KIK FE+ +F+   +D      +  + L PLNE   S LL MEI+RL++EN++L+ RL +VE  A+ + + K+ L+S+LEK     +  K ++  +     +E L K++  LK ++       +     +E DL  TK ELL ++A L++ EKELEKKVS+T PFKNLK ML KKN+Q+KD R+RL K+E+
Sbjct:    9 DHHQATVINYMRFARYQRGQRLRAVDACFDDLKDSRLIDET-FTVDEVTEMLDGLLAVVRGEMESELINTAHTNVLLLRQLCQQAEKWHLKLQADISELENRDLLEKIKDFEDAEFTGTKRDTDFSALSGPSKLEPLNESSASALLHMEIERLKEENEKLKDRLKAVESQALGIQQEKNLLSSDLEKTKNALSSAKGTVIRQDSGEEVEALRKQMAGLKSEIDKSRKHGSAAAEMMEGDLADTKHELLKVRADLELAEKELEKKVSQTAPFKNLKQMLTKKNDQIKDLRRRLAKYED 304          
BLAST of Leucine zipper transcription factor like 1 vs. TrEMBL
Match: R7U6E1 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_2656 PE=4 SV=1)

HSP 1 Score: 226.098 bits (575), Expect = 1.685e-68
Identity = 140/290 (48.28%), Postives = 194/290 (66.90%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGK 948
            D H + V+ YMRFARYQR QR++ VD  FKD+K+ RL D+T +T DE++++L  L   +  E E+E ++++HTN++LL QLF+QAE+WHL L  D++ELENRELL+KI  FEE +FS   K +  S   L P+NE GG+ LL +EI RLQ EN +L+ RL  +E  A +  K +S L SELE+   +    + S DN +++ +L+   + +    +  S G  S      +LE DL  TK ELL I+ MLDM EKELEKKVS+T PFKNLK+ML KKNEQ+K+ R++L K
Sbjct:    8 DHHQAMVVQYMRFARYQRGQRIKAVDLNFKDVKDSRLTDNT-YTIDEVEEMLDGLLAVVHGEVETEFINTAHTNILLLRQLFQQAEKWHLKLNADVSELENRELLEKIAEFEEMEFSGARKSDGFS-GRLEPMNESGGAALLNIEIQRLQDENAKLKERLHQLEGQATSAVKDRSQLKSELERANRELGAARPS-DNSEELDALQRQMQNLKSEMNMSSQGSHSKV---TDLEGDLTSTKHELLRIKDMLDMAEKELEKKVSQTAPFKNLKSMLTKKNEQIKELRRKLSK 291          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Cavefish
Match: lztfl1 (leucine zipper transcription factor-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-945])

HSP 1 Score: 179.104 bits (453), Expect = 1.323e-53
Identity = 123/293 (41.98%), Postives = 189/293 (64.51%), Query Frame = 1
Query:   85 HNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSK-DERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVAL----NKMKSSLTSELEKLGGD--RAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRL 942
            H + V+NYMRFAR +R  RL+ +D+CF+DLK+   + + TFT DE+ D+L  L+  +R E E EL++++HTNV+LL QLF QAE+++L L  DI+ELEN ELL+++  FE+  F   SK ++ +SK  L PLNE G S LL  EI RLQ+END+LR RL ++E  A++     +K + +L  +L+K+ GD  RA+    + N +D ++  +          D     ++N   +  L+++L+  K +LL +Q  L + EKELEKK  +T  ++N+K +L KKN+Q+KD R+RL
Sbjct:    9 HQNEVINYMRFARSKRLLRLKTIDSCFQDLKDS--LVEETFTVDEVTDMLDGLQVVVRGEVEMELINTAHTNVLLLRQLFSQAEKFYLRLQTDISELEN-ELLEQVAEFEKTDFKSNSKGNQESSKPKLAPLNEGGVSELLNKEISRLQEENDKLRTRLRTLESQAMSALDERSKAERAL-KDLQKIQGDQQRALCAQELSNLEDTVAAMQA---------DFEKSLNANVASQKELQDNLVSAKHDLLRVQEQLSLAEKELEKKFQQTAAYRNMKEILSKKNDQIKDLRKRL 288          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Sea Lamprey
Match: lztfl1 (leucine zipper transcription factor-like 1 [Source:ZFIN;Acc:ZDB-GENE-030131-945])

HSP 1 Score: 141.354 bits (355), Expect = 3.487e-40
Identity = 100/270 (37.04%), Postives = 157/270 (58.15%), Query Frame = 1
Query:  202 TFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENR-ELLQKIKVFEEEQFSVKSKDERN--SKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSI----DNXXXXXXXXXXXXXXXXXXHDLSSGD--------------SSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGK 948
            TFT +E+ D+L  L+  +R E ESEL+H++HTNV+LL QLF QAE WHL L  D++ELENR ELL++I   E+ +F    K      SK  L PL++ G + LL  EI RL++EN++L+ R+  VE  A +  + +S L         +R++K+ S+    D +  +     + ++ +    DLS+ +              S+ A     L+E L  ++ ELL I+  L++ EKEL+ K  +TV ++NLK+ML +KN+ +KD R+RL +
Sbjct:    1 TFTAEEVADMLEGLRVVVRGELESELIHTAHTNVLLLRQLFSQAEHWHLKLQADVSELENRSELLEQIAELEKSEFIAAGKKPSTEVSKAKLAPLSDVGATELLNKEIQRLREENEKLKVRIKMVETQATSALEERSRL---------ERSLKEASLHPPADQECFVCVRACVREQRSPPATDLSALEQQVSALRADLQREQSAGATGAAALQEGLAASQHELLRIKQQLEVAEKELDSKFQDTVAYRNLKDMLARKNDSIKDLRKRLSR 261          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Nematostella
Match: EDO45778 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRK9])

HSP 1 Score: 194.897 bits (494), Expect = 4.109e-60
Identity = 127/294 (43.20%), Postives = 185/294 (62.93%), Query Frame = 1
Query:   85 HNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKD---ERN---SKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGK 948
            H  NV++Y+RFAR+ R QR+R V+ACF+DLK+ RL++DT +T DE+ ++L  L   +R E ESEL+++SHTNV+LL QLF QAE+WHL L  DI+ELENREL+++I  FEE +F+  SK    E+N       L PLNE G   LL+ EI+RL  EN +L+ RL  +E  A  +   KS L + LEK   +   K    + K     L +LE+++  +K +L     + +    +L+ D+   K E+L ++  L+  ++EL KK +ET  +KN+K ML  KN+Q+KD R RL K
Sbjct:    8 HQQNVVSYLRFARFNRGQRIRSVEACFEDLKDSRLVEDT-YTLDEITEMLDGLCAVVRGEVESELINTSHTNVLLLRQLFSQAEKWHLKLQADISELENRELIEEIAKFEEREFTASSKSQVFEQNRMKHHLILEPLNEGGAVPLLQTEINRLNDENTKLKGRLKDLESRATGVLGEKSQLLASLEKTQAELKAKG---NVKAHGKELAQLEEQMAKVKLELKKSQENTSNIAASLDVDIADAKHEILRLREELEQAQQELTKKFNETSQYKNMKQMLTSKNDQIKDLRSRLRK 297          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Medaka
Match: lztfl1 (leucine zipper transcription factor like 1 [Source:NCBI gene;Acc:101165106])

HSP 1 Score: 182.57 bits (462), Expect = 9.988e-55
Identity = 128/289 (44.29%), Postives = 193/289 (66.78%), Query Frame = 1
Query:   97 VLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSK-DERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVAL----NKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGK 948
            ++NYMRFAR +R  RL+ +D+CF+DLK  RL+++T FT DE+ ++L  L+  +R E E EL++S+HTNV+LL QLF QAE+++L L  DI+ELENRE+L+++  FE+  F   SK ++ +SK  L PLNE G S LL  EI RLQ+END+L+ RL ++E  A++      K + +L  +L+K+ G++ V   S +       +  LE  +  LK D     S+NA  + +L+E+LI +K ELL +Q  L + EKELEKK  +T  ++N+K +L KKNEQ+K+ R+RL +
Sbjct:    1 MINYMRFARSKRVLRLKTIDSCFEDLKESRLVEET-FTVDEVKEMLDGLQVVVRGEVEVELINSAHTNVLLLRQLFSQAEKFYLRLQTDISELENREMLEQVAEFEKTDFKTASKLNQESSKPKLAPLNEAGVSELLNKEIARLQEENDKLKSRLRALESQAMSALDEKTKAERAL-KDLQKMQGEQQVAAQSKE-------ISSLEDTVAALKDDYERSLSANAASQKDLQENLISSKHELLRVQEQLALAEKELEKKFQQTAAYRNMKEILTKKNEQIKEIRKRLQR 280          
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Medaka
Match: lztfl1 (leucine zipper transcription factor like 1 [Source:NCBI gene;Acc:101165106])

HSP 1 Score: 149.443 bits (376), Expect = 4.115e-42
Identity = 116/284 (40.85%), Postives = 181/284 (63.73%), Query Frame = 1
Query:   97 VLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGK 948
            ++NYMRFAR +R  RL+ +D+CF+DLK  RL+++T FT DE+ ++L  L+  +R E E EL++S+HTNV+LL QLF QAE+++L L  DI+ELENRE+L+++  FE+  F  K+ ++ +SK  L PLNE G S LL      ++    +L   + +++E   A   +K     +L+K+ G++ V   S +       +  LE  +  LK D     S+NA  + +L+E+LI +K ELL +Q  L + EKELEKK  +T  ++N+K +L KKNEQ+K+ R+RL +
Sbjct:    1 MINYMRFARSKRVLRLKTIDSCFEDLKESRLVEET-FTVDEVKEMLDGLQVVVRGEVEVELINSAHTNVLLLRQLFSQAEKFYLRLQTDISELENREMLEQVAEFEKTDF--KTLNQESSKPKLAPLNEAGVSELLNKFWWCVK---SDLLFLISALDEKTKAERALK-----DLQKMQGEQQVAAQSKE-------ISSLEDTVAALKDDYERSLSANAASQKDLQENLISSKHELLRVQEQLALAEKELEKKFQQTAAYRNMKEILTKKNEQIKEIRKRLQR 266          
BLAST of Leucine zipper transcription factor like 1 vs. Planmine SMEST
Match: SMESG000020499.1 (SMESG000020499.1)

HSP 1 Score: 528.865 bits (1361), Expect = 0.000e+0
Identity = 294/294 (100.00%), Postives = 294/294 (100.00%), Query Frame = 1
Query:   79 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHEEM 960
            DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNKKDILSLEELEKEINLLKHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMKEKELEKKVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHEEM
Sbjct:    9 DSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNKKDILSLEELEKEINLLKHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMKEKELEKKVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHEEM 302          
BLAST of Leucine zipper transcription factor like 1 vs. Planmine SMEST
Match: SMESG000020499.1 (SMESG000020499.1)

HSP 1 Score: 506.138 bits (1302), Expect = 0.000e+0
Identity = 284/284 (100.00%), Postives = 284/284 (100.00%), Query Frame = 1
Query:  109 MRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNXXXXXXXXXXXXXXXXXXHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMXXXXXXXXVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHEEM 960
            MRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNKKDILSLEELEKEINLLKHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMKEKELEKKVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHEEM
Sbjct:    1 MRFARYQRDQRLRVVDACFKDLKNGRLMDDTTFTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTLTVDIAELENRELLQKIKVFEEEQFSVKSKDERNSKTTLNPLNEFGGSTLLKMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKKLSIDNKKDILSLEELEKEINLLKHDLSSGDSSNAQFRVNLEEDLIKTKKELLNIQAMLDMKEKELEKKVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHEEM 284          
The following BLAST results are available for this feature:
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LZTFL13.813e-5740.58leucine zipper transcription factor like 1 [Source... [more]
LZTFL14.852e-5340.60leucine zipper transcription factor like 1 [Source... [more]
LZTFL11.273e-2935.29leucine zipper transcription factor like 1 [Source... [more]
LZTFL11.022e-2843.04leucine zipper transcription factor like 1 [Source... [more]
LZTFL13.765e-2754.95leucine zipper transcription factor like 1 [Source... [more]
back to top
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
lztfl19.682e-5842.32leucine zipper transcription factor-like 1 [Source... [more]
lztfl11.617e-4638.75leucine zipper transcription factor-like 1 [Source... [more]
lztfl15.271e-3836.08leucine zipper transcription factor-like 1 [Source... [more]
back to top
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ube2i6.735e-5541.75ubiquitin conjugating enzyme E2 I [Source:Xenbase;... [more]
ube2i3.377e-5441.69ubiquitin conjugating enzyme E2 I [Source:Xenbase;... [more]
ube2i1.269e-4738.98ubiquitin conjugating enzyme E2 I [Source:Xenbase;... [more]
back to top
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lztfl13.611e-5741.18leucine zipper transcription factor-like 1 [Source... [more]
Lztfl19.901e-4746.84leucine zipper transcription factor-like 1 [Source... [more]
Lztfl11.020e-4137.85leucine zipper transcription factor-like 1 [Source... [more]
Lztfl18.412e-3950.38leucine zipper transcription factor-like 1 [Source... [more]
Lztfl16.883e-3035.47leucine zipper transcription factor-like 1 [Source... [more]
back to top
BLAST of Leucine zipper transcription factor like 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q562C6|LZTL1_RAT2.656e-5740.80Leucine zipper transcription factor-like protein 1... [more]
sp|Q3ZBL4|LZTL1_BOVIN2.773e-5742.18Leucine zipper transcription factor-like protein 1... [more]
sp|Q9NQ48|LZTL1_HUMAN1.831e-5640.58Leucine zipper transcription factor-like protein 1... [more]
sp|Q9JHQ5|LZTL1_MOUSE2.526e-5641.18Leucine zipper transcription factor-like protein 1... [more]
sp|Q5RBR4|LZTL1_PONAB6.281e-5640.58Leucine zipper transcription factor-like protein 1... [more]
back to top
BLAST of Leucine zipper transcription factor like 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3INS58.631e-7348.82leucine zipper transcription factor-like protein 1... [more]
V3ZR868.845e-7347.93Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
A0A1S3IPS91.284e-7248.82leucine zipper transcription factor-like protein 1... [more]
A0A1S3IMT61.841e-7248.48leucine zipper transcription factor-like protein 1... [more]
R7U6E11.685e-6848.28Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lztfl11.323e-5341.98leucine zipper transcription factor-like 1 [Source... [more]
back to top
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
lztfl13.487e-4037.04leucine zipper transcription factor-like 1 [Source... [more]
back to top
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO457784.109e-6043.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Leucine zipper transcription factor like 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lztfl19.988e-5544.29leucine zipper transcription factor like 1 [Source... [more]
lztfl14.115e-4240.85leucine zipper transcription factor like 1 [Source... [more]
back to top
BLAST of Leucine zipper transcription factor like 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000020499.10.000e+0100.00SMESG000020499.1[more]
SMESG000020499.10.000e+0100.00SMESG000020499.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031496 ID=SMED30031496|Name=Leucine zipper transcription factor like 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1042bp
GATTAAAATGGTGTAGTTACTGTTTGTATATCACATTATCAGAATTTAAA
TATAATGTCTATTAACTTAAATTTATCAGATTCACACAATTCCAATGTTT
TAAATTATATGAGATTTGCTAGATATCAACGAGATCAGCGCTTAAGAGTC
GTTGATGCATGTTTTAAGGACTTGAAAAATGGTCGATTAATGGATGATAC
AACCTTTACAAGAGATGAATTAGACGACATTCTATGTACCTTAAAAGAAG
ATATAAGAACGGAATTCGAATCAGAGTTATTGCACTCATCTCATACAAAC
GTTATTTTATTGAACCAATTATTTAAGCAAGCGGAACAATGGCATCTTAC
CCTCACTGTAGACATTGCAGAATTAGAAAATAGAGAATTGTTACAGAAAA
TAAAAGTTTTTGAGGAAGAACAATTTTCCGTGAAAAGTAAAGATGAAAGG
AACTCGAAAACAACATTGAATCCATTAAATGAATTCGGTGGAAGCACTCT
GTTGAAAATGGAAATTGACAGATTGCAGAAAGAAAATGATGAATTGCGTC
GCCGATTGATTTCCGTGGAAGAAACCGCAGTAGCACTAAATAAAATGAAA
TCCAGTTTGACGAGTGAATTGGAAAAATTAGGCGGAGATCGAGCAGTTAA
GAAGTTGTCTATCGATAATAAGAAAGACATTTTGAGTTTGGAAGAATTGG
AAAAGGAAATTAATCTGTTGAAGCATGATTTGAGCAGCGGAGATTCGTCT
AATGCTCAGTTCCGTGTGAATCTTGAAGAGGATTTAATTAAAACGAAAAA
GGAACTATTAAATATACAAGCTATGTTGGACATGAAAGAAAAAGAATTAG
AAAAAAAAGTCAGTGAAACTGTTCCGTTTAAAAATTTGAAAAATATGCTT
GTCAAGAAGAATGAACAGCTGAAAGATTTTCGACAGCGATTAGGTAAACA
CGAAGAAATGTGATTGTAATAATATAATATTGGTCTAATGATGTAGACGT
TTTTAGATTTTTTTGTTTCGATATTTATGTAAATTGTAGTGA
back to top

protein sequence of SMED30031496-orf-1

>SMED30031496-orf-1 ID=SMED30031496-orf-1|Name=SMED30031496-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=303bp
MSINLNLSDSHNSNVLNYMRFARYQRDQRLRVVDACFKDLKNGRLMDDTT
FTRDELDDILCTLKEDIRTEFESELLHSSHTNVILLNQLFKQAEQWHLTL
TVDIAELENRELLQKIKVFEEEQFSVKSKDERNSKTTLNPLNEFGGSTLL
KMEIDRLQKENDELRRRLISVEETAVALNKMKSSLTSELEKLGGDRAVKK
LSIDNKKDILSLEELEKEINLLKHDLSSGDSSNAQFRVNLEEDLIKTKKE
LLNIQAMLDMKEKELEKKVSETVPFKNLKNMLVKKNEQLKDFRQRLGKHE
EM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0044877macromolecular complex binding
GO:0032403protein complex binding
GO:0042802identical protein binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR026157LZTFL1
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:1903565negative regulation of protein localization to cilium
GO:1903568negative regulation of protein localization to ciliary membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 147..181
NoneNo IPR availableCOILSCoilCoilcoord: 102..122
NoneNo IPR availableCOILSCoilCoilcoord: 275..302
NoneNo IPR availableCOILSCoilCoilcoord: 237..257
NoneNo IPR availableCOILSCoilCoilcoord: 198..225
IPR026157Leucine zipper transcription factor-like protein 1PFAMPF15294Leu_zipcoord: 21..298
e-value: 1.9E-85
score: 286.8
IPR026157Leucine zipper transcription factor-like protein 1PANTHERPTHR21635LEUCINE ZIPPER TRANSCRIPTION FACTOR LIKEcoord: 5..300