Armadillo repeat containing 4

Overview
NameArmadillo repeat containing 4
Smed IDSMED30031491
Uniprot Best hitArmadillo repeat-containing protein 4 OS=Mus musculus OX=10090 GN=Armc4 PE=1 SV=1 (E=3.5729e-34)
Length (bp)3959
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Armadillo repeat containing 4 (SMED30031491) t-SNE clustered cells

Violin plots show distribution of expression levels for Armadillo repeat containing 4 (SMED30031491) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Armadillo repeat containing 4 (SMED30031491) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Armadillo repeat containing 4 (SMED30031491) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031491

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 15

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30031491SMESG000057827.1 SmedASXL_013117SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031491SMESG000057827.1 dd_Smed_v4_5065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031491SMESG000057827.1 dd_Smed_v4_5065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031491SMESG000057827.1 dd_Smed_v4_5065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30031491SMESG000057827.1 dd_Smed_v4_5065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031491SMESG000057827.1 dd_Smed_v6_13549_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30031491SMESG000057827.1 dd_Smed_v6_5065_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30031491SMESG000057827.1 Contig39946newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30031491SMESG000057827.1 Contig39946uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
epidermisSMED30031491SMESG000057827.1 dd_Smed_v4_13549_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30031491SMESG000057827.1 dd_Smed_v4_13549_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30031491SMESG000057827.1 dd_Smed_v4_13549_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30031491SMESG000057827.1 dd_Smed_v4_13549_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031491SMESG000057827.1 dd_Smed_v4_5065_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30031491SMESG000057827.1 dd_Smed_v4_5065_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Armadillo repeat containing 4 vs. Ensembl Human
Match: ARMC4 (armadillo repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:25583])

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 430/628 (68.47%), Postives = 509/628 (81.05%), Query Frame = 2
Query: 1934 RRQETSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCP-NLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            R++ ++D+ SEYWQIQKLVKYLKGGNQT+T+I+LC++RD  L  E CQLAIRDVGGLEVLINLLETDEV+CKIGSLKILKEISHNP IR+ I DLGGL  MVNIL  P++ LKCL+AETIANVAKF+RARR VR +GGI KLV LLDC  + T PA S    A   RD+EVARC ALALWSCSKS  NKEA++KAG I LL++LLK++H NMLIP+VGTLQECASE++YR AI+ E +IE+LVKNL S N++L+ HCA  I++CAE+KE RDLVR +GGL+PL +LL   DNKE LAAVTGAIWKC+IS+ENV KF+E +AIE LV LL DQPEE                      VLVNVVGALGE  ++  NR ++RK GGI PLVNLL G NQALLVN TK+VG CA EP+SM IID+ DGVRLLWSLLKNP+P+V+A+AAWA+CPCI+NAKDAGEMVRSFVGGLELIV+LLKS+  EVLASVCAAI  IA D+ENLAVITDHGVVPLL++L  T ++ LR  LAEAISRCC WG NR+ FG+  AVAPLV+YLKS+D +VHR+TA+ALYQLS+  +NC+TMHE G VKLLL +VGS D+ LQEAAA CI+NIRRLALA EK++
Sbjct:  440 RQEASADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEA---RDVEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEE----------------------VLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKAR 1042          

HSP 2 Score: 151.754 bits (382), Expect = 2.431e-36
Identity = 125/409 (30.56%), Postives = 198/409 (48.41%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGP---QADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKESYNQTRSDLRL--------AGDADNDYSRS---TADQDSVDGGRNKTV---------KMKVNQGSKHTWKESQKDK 1231
            MG+ L K  +WT+   G G  LE TPLN  IL  I  F+E F  K+P    F F + + W TSL      S   +          DK  Q +  +     + +I+I     +  +L  A    + E +  +E NRDP+ KILG  ++T+  +++SI   A  I+   T  D PE   K    K+++     D+ L+   L  I+  + ++P  V+ +I+LL +FSG   +++ L SIE    Y+F   NGCRAPPWRQ+ GEI Y +V+ H    +C+T S+ G F+N G    + D  + RK   IY +L++ L+++   FS  ++   +  S +Q +   +L        A     D S S   + +++ ++  RN+           K  VN   K + KE Q+DK
Sbjct:    1 MGVALRKLTQWTAAGHGTG-ILEITPLNEAILKEIIVFVESFIYKHPQEAKFVFVEPLEWNTSLAPSAFESGYVVSETTVKSEEVDKNGQPLLFLS----VPQIKIRSFGQLSRLLLIAKTGKLKEAQACVEANRDPIVKILGSDYNTM--KENSI---ALNILGKITRDDDPESEIK---MKIAMLLKQLDLHLLNHSLKHISLEISLSPMTVKKDIELLKRFSG-KGNQTVLESIEYTSDYEF--SNGCRAPPWRQIRGEICYVLVKPHDGETLCITCSAGGVFLNGGKTDDEGDVNYERKGS-IYKNLVTFLREKSPKFSENMSKLGISFSEDQQKEKDQLGKAPKKEEAAALRKDISGSDKRSLEKNQINFWRNQMTKRWEPSLNWKTTVNYKGKGSAKEIQEDK 392          
BLAST of Armadillo repeat containing 4 vs. Ensembl Human
Match: ARMC4 (armadillo repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:25583])

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 430/628 (68.47%), Postives = 509/628 (81.05%), Query Frame = 2
Query: 1934 RRQETSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCP-NLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            R++ ++D+ SEYWQIQKLVKYLKGGNQT+T+I+LC++RD  L  E CQLAIRDVGGLEVLINLLETDEV+CKIGSLKILKEISHNP IR+ I DLGGL  MVNIL  P++ LKCL+AETIANVAKF+RARR VR +GGI KLV LLDC  + T PA S    A   RD+EVARC ALALWSCSKS  NKEA++KAG I LL++LLK++H NMLIP+VGTLQECASE++YR AI+ E +IE+LVKNL S N++L+ HCA  I++CAE+KE RDLVR +GGL+PL +LL   DNKE LAAVTGAIWKC+IS+ENV KF+E +AIE LV LL DQPEE                      VLVNVVGALGE  ++  NR ++RK GGI PLVNLL G NQALLVN TK+VG CA EP+SM IID+ DGVRLLWSLLKNP+P+V+A+AAWA+CPCI+NAKDAGEMVRSFVGGLELIV+LLKS+  EVLASVCAAI  IA D+ENLAVITDHGVVPLL++L  T ++ LR  LAEAISRCC WG NR+ FG+  AVAPLV+YLKS+D +VHR+TA+ALYQLS+  +NC+TMHE G VKLLL +VGS D+ LQEAAA CI+NIRRLALA EK++
Sbjct:  440 RQEASADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEA---RDVEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEE----------------------VLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKAR 1042          

HSP 2 Score: 151.754 bits (382), Expect = 2.431e-36
Identity = 125/409 (30.56%), Postives = 198/409 (48.41%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGP---QADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKESYNQTRSDLRL--------AGDADNDYSRS---TADQDSVDGGRNKTV---------KMKVNQGSKHTWKESQKDK 1231
            MG+ L K  +WT+   G G  LE TPLN  IL  I  F+E F  K+P    F F + + W TSL      S   +          DK  Q +  +     + +I+I     +  +L  A    + E +  +E NRDP+ KILG  ++T+  +++SI   A  I+   T  D PE   K    K+++     D+ L+   L  I+  + ++P  V+ +I+LL +FSG   +++ L SIE    Y+F   NGCRAPPWRQ+ GEI Y +V+ H    +C+T S+ G F+N G    + D  + RK   IY +L++ L+++   FS  ++   +  S +Q +   +L        A     D S S   + +++ ++  RN+           K  VN   K + KE Q+DK
Sbjct:    1 MGVALRKLTQWTAAGHGTG-ILEITPLNEAILKEIIVFVESFIYKHPQEAKFVFVEPLEWNTSLAPSAFESGYVVSETTVKSEEVDKNGQPLLFLS----VPQIKIRSFGQLSRLLLIAKTGKLKEAQACVEANRDPIVKILGSDYNTM--KENSI---ALNILGKITRDDDPESEIK---MKIAMLLKQLDLHLLNHSLKHISLEISLSPMTVKKDIELLKRFSG-KGNQTVLESIEYTSDYEF--SNGCRAPPWRQIRGEICYVLVKPHDGETLCITCSAGGVFLNGGKTDDEGDVNYERKGS-IYKNLVTFLREKSPKFSENMSKLGISFSEDQQKEKDQLGKAPKKEEAAALRKDISGSDKRSLEKNQINFWRNQMTKRWEPSLNWKTTVNYKGKGSAKEIQEDK 392          
BLAST of Armadillo repeat containing 4 vs. Ensembl Human
Match: ARMC4 (armadillo repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:25583])

HSP 1 Score: 791.571 bits (2043), Expect = 0.000e+0
Identity = 430/628 (68.47%), Postives = 509/628 (81.05%), Query Frame = 2
Query: 1934 RRQETSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCP-NLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            R++ ++D+ SEYWQIQKLVKYLKGGNQT+T+I+LC++RD  L  E CQLAIRDVGGLEVLINLLETDEV+CKIGSLKILKEISHNP IR+ I DLGGL  MVNIL  P++ LKCL+AETIANVAKF+RARR VR +GGI KLV LLDC  + T PA S    A   RD+EVARC ALALWSCSKS  NKEA++KAG I LL++LLK++H NMLIP+VGTLQECASE++YR AI+ E +IE+LVKNL S N++L+ HCA  I++CAE+KE RDLVR +GGL+PL +LL   DNKE LAAVTGAIWKC+IS+ENV KF+E +AIE LV LL DQPEE                      VLVNVVGALGE  ++  NR ++RK GGI PLVNLL G NQALLVN TK+VG CA EP+SM IID+ DGVRLLWSLLKNP+P+V+A+AAWA+CPCI+NAKDAGEMVRSFVGGLELIV+LLKS+  EVLASVCAAI  IA D+ENLAVITDHGVVPLL++L  T ++ LR  LAEAISRCC WG NR+ FG+  AVAPLV+YLKS+D +VHR+TA+ALYQLS+  +NC+TMHE G VKLLL +VGS D+ LQEAAA CI+NIRRLALA EK++
Sbjct:  132 RQEASADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEA---RDVEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEE----------------------VLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKAR 734          
BLAST of Armadillo repeat containing 4 vs. Ensembl Human
Match: ARMC4 (armadillo repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:25583])

HSP 1 Score: 758.444 bits (1957), Expect = 0.000e+0
Identity = 402/588 (68.37%), Postives = 476/588 (80.95%), Query Frame = 2
Query: 1934 RRQETSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCP-NLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHE 3694
            R++ ++D+ SEYWQIQKLVKYLKGGNQT+T+I+LC++RD  L  E CQLAIRDVGGLEVLINLLETDEV+CKIGSLKILKEISHNP IR+ I DLGGL  MVNIL  P++ LKCL+AETIANVAKF+RARR VR +GGI KLV LLDC  + T PA S    A   RD+EVARC ALALWSCSKS  NKEA++KAG I LL++LLK++H NMLIP+VGTLQECASE++YR AI+ E +IE+LVKNL S N++L+ HCA  I++CAE+KE RDLVR +GGL+PL +LL   DNKE LAAVTGAIWKC+IS+ENV KF+E +AIE LV LL DQPEE                      VLVNVVGALGE  ++  NR ++RK GGI PLVNLL G NQALLVN TK+VG CA EP+SM IID+ DGVRLLWSLLKNP+P+V+A+AAWA+CPCI+NAKDAGEMVRSFVGGLELIV+LLKS+  EVLASVCAAI  IA D+ENLAVITDHGVVPLL++L  T ++ LR  LAEAISRCC WG NR+ FG+  AVAPLV+YLKS+D +VHR+TA+ALYQLS+  +NC+TMHE
Sbjct:  132 RQEASADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEA---RDVEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEE----------------------VLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHE 694          
BLAST of Armadillo repeat containing 4 vs. Ensembl Human
Match: ARMC4 (armadillo repeat containing 4 [Source:HGNC Symbol;Acc:HGNC:25583])

HSP 1 Score: 692.575 bits (1786), Expect = 0.000e+0
Identity = 377/552 (68.30%), Postives = 442/552 (80.07%), Query Frame = 2
Query: 2042 LRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCP-NLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHE 3694
            +RD  L  E CQLAIRDVGGLEVLINLLETDEV+CKIGSLKILKEISHNP IR+ I DLGGL  MVNIL  P++ LKCL+AETIANVAKF+RARR VR +GGI KLV LLDC  + T PA S    A   RD+EVARC ALALWSCSKS  NKEA++KAG I LL++LLK++H NMLIP+VGTLQECASE++YR AI+ E +IE+LVKNL S N++L+ HCA  I++CAE+KE RDLVR +GGL+PL +LL   DNKE LAAVTGAIWKC+IS+ENV KF+E +AIE LV LL DQPEE                      VLVNVVGALGE  ++  NR ++RK GGI PLVNLL G NQALLVN TK+VG CA EP+SM IID+ DGVRLLWSLLKNP+P+V+A+AAWA+CPCI+NAKDAGEMVRSFVGGLELIV+LLKS+  EVLASVCAAI  IA D+ENLAVITDHGVVPLL++L  T ++ LR  LAEAISRCC WG NR+ FG+  AVAPLV+YLKS+D +VHR+TA+ALYQLS+  +NC+TMHE
Sbjct:    1 MRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEA---RDVEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEE----------------------VLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHE 527          
BLAST of Armadillo repeat containing 4 vs. Ensembl Fly
Match: gudu (gene:FBgn0031905 transcript:FBtr0079438)

HSP 1 Score: 498.819 bits (1283), Expect = 5.336e-161
Identity = 298/632 (47.15%), Postives = 425/632 (67.25%), Query Frame = 2
Query: 1949 SDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCP-NLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQ---DNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQQKLLKI 3832
            +++ ++Y+ IQKLVKY+K GNQT+TI+SLC L+D  L T+  Q AI D+GGL+VL+N+LE  + +C +G+LK+L +I+ N  IR+ I DL G+  +V+IL    +DLK ++AET+ANV K R AR+ VR  GGI KLV L+D   ++      Q  P D+E  +++ R  A AL++ + SK N E M+K+GI+ L+++LLKS H++++IPI+GT+++C+SE  +++AI TEGMI D+V +L S N EL+M  +  I+KCA +   RDLVR  GGLEPLV +++ +   +NK LL   TGAIW CA++  NVK   +L+ +  LV LLND+ +E                      VL NV GA+ E  +   NR  +R+ GG+  +V+LL  ++  LL N  K +  CAE+PDSM I++  D VRL+WSLLKNP   VQA+AA+AICPC+ NA D+ E+VRS VG +EL+V LLKS+ I VL++VCAAI  IA D+ NLA++TD  V+  LA L  TTDDLLR  LA A++ C  +G N  + G+   V P+V Y+ S +  VHRSTA AL +LS  P+NC+TMH++GVV  LL  +GS +++LQ AAA C+ NIR LAL   ++++ LLKI
Sbjct:   61 AEIPADYYNIQKLVKYIKAGNQTATIVSLCCLKDYDLSTQINQFAISDIGGLDVLVNILECSDTKCCLGALKVLSDITLNIDIRKTIVDLDGIPLIVDILNSSMKDLKTMAAETLANVCKVRLARKYVRTCGGIPKLVDLIDIKLSILKTPRDQLSPDDLE-SLDMTRAGARALFTLADSKHNMEQMRKSGIVPLMAQLLKSCHIDVVIPIMGTVRKCSSEPKFQLAITTEGMIPDIVSHLSSENTELKMEGSTAIYKCAFDGTTRDLVREAGGLEPLVTIIKDKNVRENKPLLRGATGAIWMCAVTDANVKVLDQLRTVNHLVALLNDECDE----------------------VLTNVTGAISECVRFQSNREQLRQAGGLPAMVSLLNSSHAPLLENLAKGLKECAEDPDSMRILEDLDAVRLIWSLLKNPTTRVQAHAAYAICPCVRNANDSAELVRSLVGAMELVVGLLKSKDIMVLSAVCAAIATIAQDQTNLAILTDLKVIYKLADLVQTTDDLLRMNLAAAVAACACFGNNTEELGRLRTVTPIVTYMTSDNPLVHRSTAMALEKLSMDPQNCITMHQSGVVPFLLECIGSTNKELQLAAAGCLRNIRELAL---RAEEYLLKI 666          
BLAST of Armadillo repeat containing 4 vs. Ensembl Zebrafish
Match: armc4 (armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB-GENE-100316-7])

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 435/629 (69.16%), Postives = 508/629 (80.76%), Query Frame = 2
Query: 1931 DRRQET-SDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            +RR ET +D+ SEYWQIQKLVKYLKG NQT+T+I LC+LRD  L  + CQLAIRDVGGLEVLINLL+TDE+RCKIGSLKILKEIS N  IRR IA+LGGL TMV+IL  P+++LKCL+AETIANVAKFRRARR VR +GGI++LV LLDC     PA  ++   + +RD+EVARC ALALWSCSKS  NKEA+++AG I +L +LLKS   NMLIP+VGTLQECASEKSYRIAI+ EGMIEDLVKNL   N+EL+MHCA+ IFKCAE+K  RDLVR Y GL+PLV LL + +NK+LLAA TGAIWKC+IS ENV KFQE + +E LV LL +QPEE                      VLVNVVGALGE  +   N A IR++ GI PLVNLLTGTNQALLVN TK+VG CA +P++M IID+ DGVRLLWSLLKNPNPEVQA+AAWAICPCIENAKDAGEMVRSFVGGLELIV+LLKS+  +VLASVCAAI KIA D ENLAVITDHGVVP+LA LT T +D LR  LAEAI+ CC WG+N + FG+ GAVAPLV+YL S D SVH++TA+AL++LSK P NC+TMHE GVVKLLL ++GS DE LQEAAASC+ANIRRLALAN+K++
Sbjct:  444 ERRAETATDLPSEYWQIQKLVKYLKGANQTATVIVLCSLRDFNLVQDTCQLAIRDVGGLEVLINLLDTDEIRCKIGSLKILKEISCNSQIRRTIANLGGLQTMVSILDSPDKELKCLAAETIANVAKFRRARRMVRQHGGIQRLVELLDCV----PA-GESLSLEQQRDVEVARCGALALWSCSKSTWNKEAIRRAGGIPMLGRLLKSPQKNMLIPVVGTLQECASEKSYRIAIQAEGMIEDLVKNLSCDNQELQMHCASAIFKCAEDKHTRDLVRQYDGLKPLVTLLNEAENKQLLAATTGAIWKCSISMENVAKFQEYKVVEILVRLLTNQPEE----------------------VLVNVVGALGECGQISENLATIRRSSGIQPLVNLLTGTNQALLVNVTKAVGACATDPENMMIIDRLDGVRLLWSLLKNPNPEVQASAAWAICPCIENAKDAGEMVRSFVGGLELIVNLLKSQNKDVLASVCAAIAKIAKDVENLAVITDHGVVPMLASLTNTEEDKLRRYLAEAIACCCTWGSNCVSFGEAGAVAPLVRYLYSKDPSVHQATARALFELSKDPNNCITMHENGVVKLLLVMIGSTDEILQEAAASCVANIRRLALANDKAK 1045          

HSP 2 Score: 101.293 bits (251), Expect = 4.676e-21
Identity = 86/334 (25.75%), Postives = 149/334 (44.61%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSC-ELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVR-FHSKNEICVTASSTGWFVNNGPQADSMFARKD------------DKIYSDLISLLKQEDEHFS 1033
            MG+TL+++ +W+S     G KLEN+ LN+ IL  I  F E F   +P+     F + + W+TSL+  D  S   ++  G  +   +D   + + L+        I +     +  IL+    K+  E++  LE N++ + KI G                           ++P I E   +F +       D +L+   +  I    R++P  V  E+DLL  F G  + +  L S+     Y F   NGCR+PPWRQ+ GEI   I+    ++  + +T ++ G F++ G +       K             ++++ DL++LLK +  HF+
Sbjct:    1 MGVTLSRAIQWSSD----GNKLENSLLNNDILTEIMLFTEYFSESHPEEARLTFSEPLQWKTSLEVSDFTSEIYDVREGSVMSQERDDNRRPLLLLNPP----DITVHSFYHLSNILQLNKNKNRKEVQACLEANKEVLKKIFG--------------------------PNTPSINE-DHLFNI---LCQLDEKLLDIAVKPINREGRLSPAAVNTEVDLLKTFCGTGEMR-LLKSVRYTSDYVF--SNGCRSPPWRQMDGEICSLIIETCDTEPTLFITCNTNGVFLDEGLKRRGGGGEKSYNAVESYNSPVINEVFKDLVTLLKNKSSHFA 293          
BLAST of Armadillo repeat containing 4 vs. Ensembl Zebrafish
Match: armc4 (armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB-GENE-100316-7])

HSP 1 Score: 793.112 bits (2047), Expect = 0.000e+0
Identity = 435/629 (69.16%), Postives = 508/629 (80.76%), Query Frame = 2
Query: 1931 DRRQET-SDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            +RR ET +D+ SEYWQIQKLVKYLKG NQT+T+I LC+LRD  L  + CQLAIRDVGGLEVLINLL+TDE+RCKIGSLKILKEIS N  IRR IA+LGGL TMV+IL  P+++LKCL+AETIANVAKFRRARR VR +GGI++LV LLDC     PA  ++   + +RD+EVARC ALALWSCSKS  NKEA+++AG I +L +LLKS   NMLIP+VGTLQECASEKSYRIAI+ EGMIEDLVKNL   N+EL+MHCA+ IFKCAE+K  RDLVR Y GL+PLV LL + +NK+LLAA TGAIWKC+IS ENV KFQE + +E LV LL +QPEE                      VLVNVVGALGE  +   N A IR++ GI PLVNLLTGTNQALLVN TK+VG CA +P++M IID+ DGVRLLWSLLKNPNPEVQA+AAWAICPCIENAKDAGEMVRSFVGGLELIV+LLKS+  +VLASVCAAI KIA D ENLAVITDHGVVP+LA LT T +D LR  LAEAI+ CC WG+N + FG+ GAVAPLV+YL S D SVH++TA+AL++LSK P NC+TMHE GVVKLLL ++GS DE LQEAAASC+ANIRRLALAN+K++
Sbjct:  444 ERRAETATDLPSEYWQIQKLVKYLKGANQTATVIVLCSLRDFNLVQDTCQLAIRDVGGLEVLINLLDTDEIRCKIGSLKILKEISCNSQIRRTIANLGGLQTMVSILDSPDKELKCLAAETIANVAKFRRARRMVRQHGGIQRLVELLDCV----PA-GESLSLEQQRDVEVARCGALALWSCSKSTWNKEAIRRAGGIPMLGRLLKSPQKNMLIPVVGTLQECASEKSYRIAIQAEGMIEDLVKNLSCDNQELQMHCASAIFKCAEDKHTRDLVRQYDGLKPLVTLLNEAENKQLLAATTGAIWKCSISMENVAKFQEYKVVEILVRLLTNQPEE----------------------VLVNVVGALGECGQISENLATIRRSSGIQPLVNLLTGTNQALLVNVTKAVGACATDPENMMIIDRLDGVRLLWSLLKNPNPEVQASAAWAICPCIENAKDAGEMVRSFVGGLELIVNLLKSQNKDVLASVCAAIAKIAKDVENLAVITDHGVVPMLASLTNTEEDKLRRYLAEAIACCCTWGSNCVSFGEAGAVAPLVRYLYSKDPSVHQATARALFELSKDPNNCITMHENGVVKLLLVMIGSTDEILQEAAASCVANIRRLALANDKAK 1045          

HSP 2 Score: 101.293 bits (251), Expect = 4.676e-21
Identity = 86/334 (25.75%), Postives = 149/334 (44.61%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSC-ELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVR-FHSKNEICVTASSTGWFVNNGPQADSMFARKD------------DKIYSDLISLLKQEDEHFS 1033
            MG+TL+++ +W+S     G KLEN+ LN+ IL  I  F E F   +P+     F + + W+TSL+  D  S   ++  G  +   +D   + + L+        I +     +  IL+    K+  E++  LE N++ + KI G                           ++P I E   +F +       D +L+   +  I    R++P  V  E+DLL  F G  + +  L S+     Y F   NGCR+PPWRQ+ GEI   I+    ++  + +T ++ G F++ G +       K             ++++ DL++LLK +  HF+
Sbjct:    1 MGVTLSRAIQWSSD----GNKLENSLLNNDILTEIMLFTEYFSESHPEEARLTFSEPLQWKTSLEVSDFTSEIYDVREGSVMSQERDDNRRPLLLLNPP----DITVHSFYHLSNILQLNKNKNRKEVQACLEANKEVLKKIFG--------------------------PNTPSINE-DHLFNI---LCQLDEKLLDIAVKPINREGRLSPAAVNTEVDLLKTFCGTGEMR-LLKSVRYTSDYVF--SNGCRSPPWRQMDGEICSLIIETCDTEPTLFITCNTNGVFLDEGLKRRGGGGEKSYNAVESYNSPVINEVFKDLVTLLKNKSSHFA 293          
BLAST of Armadillo repeat containing 4 vs. Ensembl Zebrafish
Match: CR847789.1 (armadillo repeat containing 4 [Source:NCBI gene;Acc:799229])

HSP 1 Score: 790.03 bits (2039), Expect = 0.000e+0
Identity = 434/629 (69.00%), Postives = 507/629 (80.60%), Query Frame = 2
Query: 1931 DRRQET-SDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            +RR ET +D+ SEYWQIQKLVKYLKG NQT+T+I LC+LRD  L  + CQLAIRDVGGLEVLINLL+TDE+RCKIGSLKILKEIS N  IRR IA+LGGL TMV+IL   +++LKCL+AETIANVAKFRRARR VR +GGI++LV LLDC     PA  ++   + +RD+EVARC ALALWSCSKS  NKEA+++AG I +L +LLKS   NMLIP+VGTLQECASEKSYRIAI+ EGMIEDLVKNL   N+EL+MHCA+ IFKCAE+K  RDLVR Y GL+PLV LL + +NK+LLAA TGAIWKC+IS ENV KFQE + +E LV LL +QPEE                      VLVNVVGALGE  +   N A IR++ GI PLVNLLTGTNQALLVN TK+VG CA +P++M IID+ DGVRLLWSLLKNPNPEVQA+AAWAICPCIENAKDAGEMVRSFVGGLELIV+LLKS+  +VLASVCAAI KIA D ENLAVITDHGVVP+LA LT T +D LR  LAEAI+ CC WG+N + FG+ GAVAPLV+YL S D SVH++TA+AL++LSK P NC+TMHE GVVKLLL ++GS DE LQEAAASC+ANIRRLALAN+K++
Sbjct:  444 ERRAETATDLPSEYWQIQKLVKYLKGANQTATVIVLCSLRDFNLVQDTCQLAIRDVGGLEVLINLLDTDEIRCKIGSLKILKEISCNSQIRRTIANLGGLQTMVSILDSSDKELKCLAAETIANVAKFRRARRMVRQHGGIQRLVELLDCV----PA-GESLSLEQQRDVEVARCGALALWSCSKSTWNKEAIRRAGGIPMLGRLLKSPQKNMLIPVVGTLQECASEKSYRIAIQAEGMIEDLVKNLSCDNQELQMHCASAIFKCAEDKHTRDLVRQYDGLKPLVTLLNEAENKQLLAATTGAIWKCSISMENVAKFQEYKVVEILVRLLTNQPEE----------------------VLVNVVGALGECGQISENLATIRRSSGIQPLVNLLTGTNQALLVNVTKAVGACATDPENMMIIDRLDGVRLLWSLLKNPNPEVQASAAWAICPCIENAKDAGEMVRSFVGGLELIVNLLKSQNKDVLASVCAAIAKIAKDVENLAVITDHGVVPMLASLTNTEEDKLRRYLAEAIACCCTWGSNCVSFGEAGAVAPLVRYLYSKDPSVHQATARALFELSKDPNNCITMHENGVVKLLLVMIGSTDEILQEAAASCVANIRRLALANDKAK 1045          

HSP 2 Score: 104.375 bits (259), Expect = 6.018e-22
Identity = 89/334 (26.65%), Postives = 148/334 (44.31%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSC-ELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVR-FHSKNEICVTASSTGWFVNNGPQADSMFARKD------------DKIYSDLISLLKQEDEHFS 1033
            MG+TL+++ +W+S     G KLEN+ LN+ IL  I  F E F   +P+     F + + W+TSL+  D  S   ++  G  +    D   + + L+        I +     +  IL+    K+  E++  LE N++ V KI G                           D+P I E   +F +       D +L+   +  I    R++P  V  EIDLL  F G  + +  L S+     Y F   NGCR+PPWRQ+ GEI   I+    ++  + +T ++ G F++ G +       K             ++++ DL++LLK +  HF+
Sbjct:    1 MGVTLSRAIQWSSD----GNKLENSLLNNDILTEIMLFTEYFSESHPEEARLTFSEPLQWKTSLEVSDFTSEIYDVREGSVMSQEHDDNGRPLLLLNPP----DITVHSFYHLSNILQLNKNKNRKEVQACLEANKEVVKKIFG--------------------------PDTPSINE-DHLFNI---LCQLDEKLLDIAVKPINREGRLSPAAVNTEIDLLKTFCGTGEMR-LLKSVRYTSDYVF--SNGCRSPPWRQMDGEICSLIIETCDTEPTLFITCNTNGVFLDEGLKRRGGGGEKSYNAVESYNSPVINEVFKDLVTLLKNKSSHFA 293          
BLAST of Armadillo repeat containing 4 vs. Ensembl Zebrafish
Match: armc4 (armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB-GENE-100316-7])

HSP 1 Score: 169.088 bits (427), Expect = 2.642e-48
Identity = 79/106 (74.53%), Postives = 90/106 (84.91%), Query Frame = 2
Query: 2561 NMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKF 2878
            NMLIP+VGTLQECASEKSYRIAI+ EGMIEDLVKNL   N+EL+MHCA+ IFKCAE+K  RDLVR Y GL+PLV LL + +NK+LLAA TGAIWKC+IS ENV K 
Sbjct:    3 NMLIPVVGTLQECASEKSYRIAIQAEGMIEDLVKNLSCDNQELQMHCASAIFKCAEDKHTRDLVRQYDGLKPLVTLLNEAENKQLLAATTGAIWKCSISMENVAKM 108          

HSP 2 Score: 48.1358 bits (113), Expect = 5.461e-6
Identity = 34/120 (28.33%), Postives = 62/120 (51.67%), Query Frame = 2
Query: 3002 VLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNP-NPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLL 3358
            +L+ VVG L E A +   R  I+  G I  LV  L+  NQ L ++   ++ +CAE+  +  ++ + DG++ L +LL    N ++ A    AI  C  + ++  +M+  +   L ++ S L
Sbjct:    4 MLIPVVGTLQECASEKSYRIAIQAEGMIEDLVKNLSCDNQELQMHCASAIFKCAEDKHTRDLVRQYDGLKPLVTLLNEAENKQLLAATTGAIWKCSISMENVAKMLGKWCVPLWVVWSSL 123          
BLAST of Armadillo repeat containing 4 vs. Ensembl Zebrafish
Match: armc3 (armadillo repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE-110614-1])

HSP 1 Score: 68.1662 bits (165), Expect = 6.358e-11
Identity = 95/403 (23.57%), Postives = 172/403 (42.68%), Query Frame = 2
Query: 2207 IADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXN-HVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSN-KELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNM-----------------YLYVDSSSNKIKLVQRIEK----VLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELI 3346
            I +  GL  ++ +L  P+ D+K  S E I N+ +  + R  V+   G+  L+ LL          +      I  D E   CVA            +       I+ +++    S+ H   L  I+  L++  S + ++    T G +E L++ + +S   E++ +    I K A+  E R ++ H   +E  +  L  Q+N+ +  AV  A+   + +  +   F+ L  I  +V LLN +  E+ M                 Y   D+  +++ LV++++       V    AL  MA     R  I     +  LV LL  T+  +L++  ++V     + ++   +    G+  L  LLK+ N E++ NA+WAI  C  +   A E+    VG LE++
Sbjct:  146 IFESNGLEPLIQLLSSPDPDVKKNSVECIFNLVQDVQNRAAVQRLNGLPPLLDLLRSEFSVIQQLALHTIEKITTDTET--CVAF-----------RNVQGFERILEVVAMKEFSDLHEGALRVILNCLEDTESMQLFQ----TMGGLEQLLQCVGTSTVAEVKANAVKAIAKMAQSSENRKIL-HERNIEKTLTDLLTQENESVRTAVCQAVATVSKNLSSRDTFRSLDGIRPIVQLLNSEGSELRMAAAEALSSLTNSNNLNAYAIYDAEGDRL-LVRQLQDSCTGAAVYAAMALTNMASQEELRKSILAHEAMPALVELLHSTDNNILISAVQAVASLTCDAEARQELRNVGGLSALVQLLKSINAEIRRNASWAISVCANDEITASELCN--VGALEIL 527          
BLAST of Armadillo repeat containing 4 vs. Ensembl Xenopus
Match: gc (group-specific component (vitamin D binding protein) [Source:Xenbase;Acc:XB-GENE-947316])

HSP 1 Score: 829.321 bits (2141), Expect = 0.000e+0
Identity = 451/628 (71.82%), Postives = 516/628 (82.17%), Query Frame = 2
Query: 1934 RRQE-TSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            RRQE  +D+ SEYWQIQKLVKYLKGGNQT+T+I+LC++RD  L  E CQLAIRDVGGL++LINLL T+E++CKIG+LKILKEISHN  IR AIADLGGL TMV IL   ++DLKCL+AETIANVAKFRRARRTVR +GGI++LVGLLDC     P  S    A  E+DIEVARC ALALWSCSKS +NKEA++KAG I LL++LLKS+H NMLIP+VGTLQECASE SYR+AI+TE MIEDLVKNLKS N EL+MHCA+ IFKCAE++E RDLVR YGGL+PL  LL Q +NKELLAAVTGAIWKC+IS++NV KFQE + IE LVTLL +QPEE                      VLVNVVGALGE  ++P NRA+IRK GGI+PLVNLL+GTNQALLVN TK+VG CA +P++M IID+ DGVRLLWSLLKNP+P+VQANAAWAICPCIENAKDAGEMVRSFVGGLELIV+LLKSE  EVLASVCAAI  IA DEENLAVITDHGVV LL+ L  TTDD LR  LAEAIS CC WG NR+ FG++ AVAPLV YLKSSD  VHR+TA+ALYQLS+   NC+TMHE GVVKLL+ +VGS D  LQEAAA CIANIRRLALANEK++
Sbjct:  450 RRQEGNTDLPSEYWQIQKLVKYLKGGNQTATVIALCSIRDFNLAQETCQLAIRDVGGLDILINLLNTEEIKCKIGALKILKEISHNSQIRSAIADLGGLQTMVGILDSQDKDLKCLAAETIANVAKFRRARRTVRQHGGIRRLVGLLDC----APIGSSNLSAQQEKDIEVARCGALALWSCSKSTRNKEAIRKAGGIPLLARLLKSSHSNMLIPVVGTLQECASEPSYRLAIKTEKMIEDLVKNLKSENPELQMHCASAIFKCAEDEETRDLVRQYGGLQPLAMLLGQFENKELLAAVTGAIWKCSISRDNVTKFQEYKVIETLVTLLTNQPEE----------------------VLVNVVGALGECGQEPANRAIIRKCGGISPLVNLLSGTNQALLVNVTKAVGACASDPENMVIIDRLDGVRLLWSLLKNPHPDVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVNLLKSENKEVLASVCAAITNIAKDEENLAVITDHGVVALLSALANTTDDKLRRHLAEAISHCCMWGHNRVAFGESKAVAPLVHYLKSSDPLVHRATAQALYQLSEDANNCITMHENGVVKLLIDMVGSPDSMLQEAAAGCIANIRRLALANEKAR 1051          

HSP 2 Score: 192.2 bits (487), Expect = 4.278e-49
Identity = 116/333 (34.83%), Postives = 187/333 (56.16%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNG--PQADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKES 1066
            MG+ L ++A+WT+   G G KLE TPLN  +L+ I K+ E F  ++P+   F F++ + W+T+L+     S  ++          D+    + ++ S    + ++IS    I   L+ A  K + E +  LE+NRDP++ ILG  F+TV GED ++ R  +++     + DS     K K+F +       D++L+   L +I++ VRV P  V+NE+DLL +FSG H++K  L SIE    Y+F   NGCRAPPWRQ+HGEI Y +   H  + + +T S++G F+N G   + D +   +  +IY DL++LLK + + F+  I   D + S
Sbjct:    1 MGVALTRAAQWTTAGSGTG-KLEITPLNESLLNDIIKYAEAFSSRHPEEAQFVFQEPLEWKTNLEPSAFESGYDISGSTVKSQETDQDGHPLLILSS----STVKISSFGQISRFLQLARDKKLKEAQACLEENRDPIACILGPGFATVEGEDMTLIRLLEKM----RQDDSGSAEIKMKIFLLL---QQLDMQLLNSSLKQISQEVRVTPAAVKNEVDLLRRFSG-HEEKFVLKSIEYTSDYEF--SNGCRAPPWRQVHGEICYLLAAPHDTDPLYITCSTSGTFLNAGKLKENDEINYERKSEIYKDLVTLLKTKSQTFAENITKQDFQFS 318          
BLAST of Armadillo repeat containing 4 vs. Ensembl Xenopus
Match: gc (group-specific component (vitamin D binding protein) [Source:Xenbase;Acc:XB-GENE-947316])

HSP 1 Score: 827.009 bits (2135), Expect = 0.000e+0
Identity = 451/628 (71.82%), Postives = 516/628 (82.17%), Query Frame = 2
Query: 1934 RRQE-TSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            RRQE  +D+ SEYWQIQKLVKYLKGGNQT+T+I+LC++RD  L  E CQLAIRDVGGL++LINLL T+E++CKIG+LKILKEISHN  IR AIADLGGL TMV IL   ++DLKCL+AETIANVAKFRRARRTVR +GGI++LVGLLDC     P  S    A  E+DIEVARC ALALWSCSKS +NKEA++KAG I LL++LLKS+H NMLIP+VGTLQECASE SYR+AI+TE MIEDLVKNLKS N EL+MHCA+ IFKCAE++E RDLVR YGGL+PL  LL Q +NKELLAAVTGAIWKC+IS++NV KFQE + IE LVTLL +QPEE                      VLVNVVGALGE  ++P NRA+IRK GGI+PLVNLL+GTNQALLVN TK+VG CA +P++M IID+ DGVRLLWSLLKNP+P+VQANAAWAICPCIENAKDAGEMVRSFVGGLELIV+LLKSE  EVLASVCAAI  IA DEENLAVITDHGVV LL+ L  TTDD LR  LAEAIS CC WG NR+ FG++ AVAPLV YLKSSD  VHR+TA+ALYQLS+   NC+TMHE GVVKLL+ +VGS D  LQEAAA CIANIRRLALANEK++
Sbjct:  357 RRQEGNTDLPSEYWQIQKLVKYLKGGNQTATVIALCSIRDFNLAQETCQLAIRDVGGLDILINLLNTEEIKCKIGALKILKEISHNSQIRSAIADLGGLQTMVGILDSQDKDLKCLAAETIANVAKFRRARRTVRQHGGIRRLVGLLDC----APIGSSNLSAQQEKDIEVARCGALALWSCSKSTRNKEAIRKAGGIPLLARLLKSSHSNMLIPVVGTLQECASEPSYRLAIKTEKMIEDLVKNLKSENPELQMHCASAIFKCAEDEETRDLVRQYGGLQPLAMLLGQFENKELLAAVTGAIWKCSISRDNVTKFQEYKVIETLVTLLTNQPEE----------------------VLVNVVGALGECGQEPANRAIIRKCGGISPLVNLLSGTNQALLVNVTKAVGACASDPENMVIIDRLDGVRLLWSLLKNPHPDVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVNLLKSENKEVLASVCAAITNIAKDEENLAVITDHGVVALLSALANTTDDKLRRHLAEAISHCCMWGHNRVAFGESKAVAPLVHYLKSSDPLVHRATAQALYQLSEDANNCITMHENGVVKLLIDMVGSPDSMLQEAAAGCIANIRRLALANEKAR 958          

HSP 2 Score: 188.348 bits (477), Expect = 6.085e-48
Identity = 114/326 (34.97%), Postives = 184/326 (56.44%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNG--PQADSMFARKDDKIYSDLISLLKQEDEHFSSFIN 1045
            MG+ L ++A+WT+   G G KLE TPLN  +L+ I K+ E F  ++P+   F F++ + W+T+L+     S  ++          D+    + ++ S    + ++IS    I   L+ A  K + E +  LE+NRDP++ ILG  F+TV GED ++ R  +++     + DS     K K+F +       D++L+   L +I++ VRV P  V+NE+DLL +FSG H++K  L SIE    Y+F   NGCRAPPWRQ+HGEI Y +   H  + + +T S++G F+N G   + D +   +  +IY DL++LLK + + F+  I 
Sbjct:    1 MGVALTRAAQWTTAGSGTG-KLEITPLNESLLNDIIKYAEAFSSRHPEEAQFVFQEPLEWKTNLEPSAFESGYDISGSTVKSQETDQDGHPLLILSS----STVKISSFGQISRFLQLARDKKLKEAQACLEENRDPIACILGPGFATVEGEDMTLIRLLEKM----RQDDSGSAEIKMKIFLLL---QQLDMQLLNSSLKQISQEVRVTPAAVKNEVDLLRRFSG-HEEKFVLKSIEYTSDYEF--SNGCRAPPWRQVHGEICYLLAAPHDTDPLYITCSTSGTFLNAGKLKENDEINYERKSEIYKDLVTLLKTKSQTFAENIT 311          
BLAST of Armadillo repeat containing 4 vs. Ensembl Xenopus
Match: gc (group-specific component (vitamin D binding protein) [Source:Xenbase;Acc:XB-GENE-947316])

HSP 1 Score: 826.624 bits (2134), Expect = 0.000e+0
Identity = 451/628 (71.82%), Postives = 516/628 (82.17%), Query Frame = 2
Query: 1934 RRQE-TSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            RRQE  +D+ SEYWQIQKLVKYLKGGNQT+T+I+LC++RD  L  E CQLAIRDVGGL++LINLL T+E++CKIG+LKILKEISHN  IR AIADLGGL TMV IL   ++DLKCL+AETIANVAKFRRARRTVR +GGI++LVGLLDC     P  S    A  E+DIEVARC ALALWSCSKS +NKEA++KAG I LL++LLKS+H NMLIP+VGTLQECASE SYR+AI+TE MIEDLVKNLKS N EL+MHCA+ IFKCAE++E RDLVR YGGL+PL  LL Q +NKELLAAVTGAIWKC+IS++NV KFQE + IE LVTLL +QPEE                      VLVNVVGALGE  ++P NRA+IRK GGI+PLVNLL+GTNQALLVN TK+VG CA +P++M IID+ DGVRLLWSLLKNP+P+VQANAAWAICPCIENAKDAGEMVRSFVGGLELIV+LLKSE  EVLASVCAAI  IA DEENLAVITDHGVV LL+ L  TTDD LR  LAEAIS CC WG NR+ FG++ AVAPLV YLKSSD  VHR+TA+ALYQLS+   NC+TMHE GVVKLL+ +VGS D  LQEAAA CIANIRRLALANEK++
Sbjct:  328 RRQEGNTDLPSEYWQIQKLVKYLKGGNQTATVIALCSIRDFNLAQETCQLAIRDVGGLDILINLLNTEEIKCKIGALKILKEISHNSQIRSAIADLGGLQTMVGILDSQDKDLKCLAAETIANVAKFRRARRTVRQHGGIRRLVGLLDC----APIGSSNLSAQQEKDIEVARCGALALWSCSKSTRNKEAIRKAGGIPLLARLLKSSHSNMLIPVVGTLQECASEPSYRLAIKTEKMIEDLVKNLKSENPELQMHCASAIFKCAEDEETRDLVRQYGGLQPLAMLLGQFENKELLAAVTGAIWKCSISRDNVTKFQEYKVIETLVTLLTNQPEE----------------------VLVNVVGALGECGQEPANRAIIRKCGGISPLVNLLSGTNQALLVNVTKAVGACASDPENMVIIDRLDGVRLLWSLLKNPHPDVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVNLLKSENKEVLASVCAAITNIAKDEENLAVITDHGVVALLSALANTTDDKLRRHLAEAISHCCMWGHNRVAFGESKAVAPLVHYLKSSDPLVHRATAQALYQLSEDANNCITMHENGVVKLLIDMVGSPDSMLQEAAAGCIANIRRLALANEKAR 929          

HSP 2 Score: 136.732 bits (343), Expect = 8.115e-32
Identity = 98/332 (29.52%), Postives = 162/332 (48.80%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEF-HNFDVRLMRDMLGKI-AETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVN------NGPQADSMFARKDDKIYSDLISLLKQEDEHFSSFIN 1045
            MG+ L ++A+WT+   G G KLE TPLN  +L+ I K+ E F  ++P+   F F++ + W+T+L+     S  ++          D+    + ++ S    + ++IS    I   L+ A  K + E +  LE +                                       EI  K K+F +  +   +F+V+++  ++  I +  VRV P  V+NE+DLL +FSG H++K  L SIE    Y+F   NGCRAPPWRQ+HGEI Y +   H  + + +T S++G F+N         + D +   +  +IY DL++LLK + + F+  I 
Sbjct:    1 MGVALTRAAQWTTAGSGTG-KLEITPLNESLLNDIIKYAEAFSSRHPEEAQFVFQEPLEWKTNLEPSAFESGYDISGSTVKSQETDQDGHPLLILSS----STVKISSFGQISRFLQLARDKKLKEAQACLEGH--------------------------------------AEI--KMKIFLLLQQLDMSFEVKVI--LIPVINSREVRVTPAAVKNEVDLLRRFSG-HEEKFVLKSIEYTSDYEF--SNGCRAPPWRQVHGEICYLLAAPHDTDPLYITCSTSGTFLNARGCVGKLKENDEINYERKSEIYKDLVTLLKTKSQTFAENIT 282          
BLAST of Armadillo repeat containing 4 vs. Ensembl Xenopus
Match: armc3 (armadillo repeat containing 3 [Source:NCBI gene;Acc:407950])

HSP 1 Score: 58.9214 bits (141), Expect = 4.396e-8
Identity = 80/374 (21.39%), Postives = 162/374 (43.32%), Query Frame = 2
Query: 2600 ASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKK-FQELQAIEKLVTLLNDQPEEMNMY----------------LYVDSSSNKIKLVQRIEKVL------VNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAI------CPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRS 3634
            A+E + +  I     +E L+K L S + +++ +CA  I+  A+E + R  V     + PL+ LL+ +    ++  +T     C  S+   +  F E Q +E+L+ +L +  E  +++                L++   S  +K +    +        +N   A+ + A++  NR    +      LV++L   N  +      ++    E  +S ++ +KQ G+  + +LL   + EV+ +AA+ +      CP   NA    E       G++ +++LL  +   V+ + C  +  +A  E    ++  HG+V  L     ++++++  + A  ++        R D    G + PLVK L+     V RS
Sbjct:  105 AAEYTSKTQIHELNGLEPLIKLLSSPDPDVKKNCAECIYLLAQEFQSRSAVWELNAIPPLLELLKSE--YPVIQQLTLRTLGCLSSEVEARHIFIENQVLEQLLKVL-ETKEFHDLHVDTLLVIANCLEDVEALHILQQSGGLKRILEFAETTPLPEAQMNAAKAISKAAQNDENRKFFHEQEVERILVSMLDTDNDEVKAAACLAIAAMGENLESKNVFNKQ-GIPQIITLLTRESAEVRESAAFVLANLTTNCPA--NASAVAE-----ADGVDALINLLSDKRDGVIMNACTVLINMAAQEPLRLILETHGLVHALIEPLHSSNNMVLSKAALTVASIACDADIRTDLRNAGGLPPLVKLLQCDHNEVRRS 467          
BLAST of Armadillo repeat containing 4 vs. Ensembl Xenopus
Match: armc3 (armadillo repeat containing 3 [Source:NCBI gene;Acc:407950])

HSP 1 Score: 59.3066 bits (142), Expect = 4.988e-8
Identity = 81/379 (21.37%), Postives = 164/379 (43.27%), Query Frame = 2
Query: 2600 ASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKK-FQELQAIEKLVTLLNDQPEEMNMY----------------LYVDSSSNKIKLVQRIEKVL------VNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAI------CPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKAL 3649
            A+E + +  I     +E L+K L S + +++ +CA  I+  A+E + R  V     + PL+ LL+ +    ++  +T     C  S+   +  F E Q +E+L+ +L  + E  +++                L++   S  +K +    +        +N   A+ + A++  NR    +      LV++L   N  +      ++    E  +S ++ +KQ G+  + +LL   + EV+ +AA+ +      CP   NA    E       G++ +++LL  +   V+ + C  +  +A  E    ++  HG+V  L     ++++++  + A  ++        R D    G + PLVK L+     V RS   A+
Sbjct:  105 AAEYTSKTQIHELNGLEPLIKLLSSPDPDVKKNCAECIYLLAQEFQSRSAVWELNAIPPLLELLKSE--YPVIQQLTLRTLGCLSSEVEARHIFIENQVLEQLLKVLETK-EFHDLHVDTLLVIANCLEDVEALHILQQSGGLKRILEFAETTPLPEAQMNAAKAISKAAQNDENRKFFHEQEVERILVSMLDTDNDEVKAAACLAIAAMGENLESKNVFNKQ-GIPQIITLLTRESAEVRESAAFVLANLTTNCPA--NASAVAE-----ADGVDALINLLSDKRDGVIMNACTVLINMAAQEPLRLILETHGLVHALIEPLHSSNNMVLSKAALTVASIACDADIRTDLRNAGGLPPLVKLLQCDHNEVRRSACWAV 472          
BLAST of Armadillo repeat containing 4 vs. Ensembl Mouse
Match: Armc4 (armadillo repeat containing 4 [Source:MGI Symbol;Acc:MGI:1922184])

HSP 1 Score: 796.964 bits (2057), Expect = 0.000e+0
Identity = 436/632 (68.99%), Postives = 512/632 (81.01%), Query Frame = 2
Query: 1928 PDRRQET-SDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDC-PNLTGPANSQAQPADIE-RDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            PD RQE  +D+ SEYWQIQKLVKYLKGGNQT+T+I+LC++RD  L  E CQLAIRDVGGLEVLINLL+TDEV+CKIGSLKILKEISHNP IRR I DLGGL  MVNIL  P++ LKCLSAETIANVAKF+RARR VR +GGI KLV LLDC  N T P     QP+  E RD+EVARC ALALWSCSKS  NKEA++KAG I LL++LLK++H NMLIP+VGTLQECASE++YR AI+ E +IE+LVKNL S N++L+ HCA  I++CAE++E RDLVR +GGL+PL +LL   DNKE LAAVTGAIWKC+IS+ENV KF+E +AIE LV LL DQPEE                      VLVNVVGALGE  ++  NR ++RK GGI PLVNLL G NQALLVN TK+VG CA EP+SM+IID+ DGVRLLWSLLKNP+P+V+A+AAWA+CPCIENAKDAGEMVRSFVGGLEL+V+LLKS+  EVLASVCAAI  IA D+ENLAVITDHGVVPLL++L  T +D LR  LAEAISRCC WG NR+ FG+  AVAPLV+YLKS+D +VHR+TA+ALYQLS+  +NC+TMHE G VKLLL +VGS D+ LQEAAA CI+NIRRLALA EK++
Sbjct:  430 PDHRQEANADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFNLAQETCQLAIRDVGGLEVLINLLDTDEVKCKIGSLKILKEISHNPQIRRNIVDLGGLPIMVNILDSPHKSLKCLSAETIANVAKFKRARRAVRQHGGITKLVALLDCGQNSTEPT----QPSLYETRDVEVARCGALALWSCSKSHSNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDEETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVIKFREYKAIETLVGLLTDQPEE----------------------VLVNVVGALGECCQEYENRVLVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMAIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIENAKDAGEMVRSFVGGLELVVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNDKLRRHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKAR 1035          

HSP 2 Score: 146.747 bits (369), Expect = 5.108e-35
Identity = 130/450 (28.89%), Postives = 205/450 (45.56%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQ--DIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGP---QADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKESYNQTRSDLRLAGDADNDYS----RSTADQDSVDGGRNKTVKMKVNQGSKHTWKESQKDKLKVSKKWXXXXXXXXXXXXTTRRLKYYENRKSETRHSNRNSDS-LNKSSTVVTSP 1393
            MG+ L + A+WT+  G   G LE TPLN  IL+ I KF+E F  K P    F F + + W+T L+    ++G        +     KD   Q +  +     +  I++     +  +L  A    + E +  +E NRDPV KILG  ++ +  ED +     D II     KD    +++K    +++     D+ L+   L  I+  + +NP   + +I+LL +FSG   +++ L SIE    Y+F   NGCRAPPWRQ+ GEI Y +V+ H    +C+T S+ G F+N G    + +  + RK + IY DL++ LK +   FS            N ++ ++R   +   D        T D  S   G  K+   K++ G     K     +L+ S  W              R    Y++ KS  + S       L KSS+V  +P
Sbjct:    1 MGVALTRLAQWTAA-GYETGTLEITPLNESILNEITKFVESFSYKYPQEAKFVFVEPLEWKTYLEPSAFELGYVVSATTAESEETGKDG--QPLLFLS----VPYIKVRSFGQLSQLLSIATDSKLQEAQACIEANRDPVVKILGPDYNEMK-EDPTRLTLLDTII-----KDKETYMKRK----VAILLKQLDLHLLNHSLKYISLEISLNPGTFKKDIELLKRFSG-KGEQTVLESIEYTSDYEF--SNGCRAPPWRQIQGEICYVLVKPHDMETLCLTCSTEGVFLNGGKTEEEGEINYERKGE-IYKDLVTCLKDKSPVFSE-----------NMSKHEIRFTEEQQKDNQIFEKPKTEDGHSSVAGSEKSKIEKISFG-----KSPMTKRLEPSLNW--------------RVTVDYKDHKSSIKDSQEEKQGKLEKSSSVSVAP 399          
BLAST of Armadillo repeat containing 4 vs. Ensembl Mouse
Match: Armc4 (armadillo repeat containing 4 [Source:MGI Symbol;Acc:MGI:1922184])

HSP 1 Score: 796.964 bits (2057), Expect = 0.000e+0
Identity = 436/632 (68.99%), Postives = 512/632 (81.01%), Query Frame = 2
Query: 1928 PDRRQET-SDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDC-PNLTGPANSQAQPADIE-RDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            PD RQE  +D+ SEYWQIQKLVKYLKGGNQT+T+I+LC++RD  L  E CQLAIRDVGGLEVLINLL+TDEV+CKIGSLKILKEISHNP IRR I DLGGL  MVNIL  P++ LKCLSAETIANVAKF+RARR VR +GGI KLV LLDC  N T P     QP+  E RD+EVARC ALALWSCSKS  NKEA++KAG I LL++LLK++H NMLIP+VGTLQECASE++YR AI+ E +IE+LVKNL S N++L+ HCA  I++CAE++E RDLVR +GGL+PL +LL   DNKE LAAVTGAIWKC+IS+ENV KF+E +AIE LV LL DQPEE                      VLVNVVGALGE  ++  NR ++RK GGI PLVNLL G NQALLVN TK+VG CA EP+SM+IID+ DGVRLLWSLLKNP+P+V+A+AAWA+CPCIENAKDAGEMVRSFVGGLEL+V+LLKS+  EVLASVCAAI  IA D+ENLAVITDHGVVPLL++L  T +D LR  LAEAISRCC WG NR+ FG+  AVAPLV+YLKS+D +VHR+TA+ALYQLS+  +NC+TMHE G VKLLL +VGS D+ LQEAAA CI+NIRRLALA EK++
Sbjct:  430 PDHRQEANADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFNLAQETCQLAIRDVGGLEVLINLLDTDEVKCKIGSLKILKEISHNPQIRRNIVDLGGLPIMVNILDSPHKSLKCLSAETIANVAKFKRARRAVRQHGGITKLVALLDCGQNSTEPT----QPSLYETRDVEVARCGALALWSCSKSHSNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDEETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVIKFREYKAIETLVGLLTDQPEE----------------------VLVNVVGALGECCQEYENRVLVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMAIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIENAKDAGEMVRSFVGGLELVVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNDKLRRHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKAR 1035          

HSP 2 Score: 146.747 bits (369), Expect = 5.108e-35
Identity = 130/450 (28.89%), Postives = 205/450 (45.56%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQ--DIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGP---QADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKESYNQTRSDLRLAGDADNDYS----RSTADQDSVDGGRNKTVKMKVNQGSKHTWKESQKDKLKVSKKWXXXXXXXXXXXXTTRRLKYYENRKSETRHSNRNSDS-LNKSSTVVTSP 1393
            MG+ L + A+WT+  G   G LE TPLN  IL+ I KF+E F  K P    F F + + W+T L+    ++G        +     KD   Q +  +     +  I++     +  +L  A    + E +  +E NRDPV KILG  ++ +  ED +     D II     KD    +++K    +++     D+ L+   L  I+  + +NP   + +I+LL +FSG   +++ L SIE    Y+F   NGCRAPPWRQ+ GEI Y +V+ H    +C+T S+ G F+N G    + +  + RK + IY DL++ LK +   FS            N ++ ++R   +   D        T D  S   G  K+   K++ G     K     +L+ S  W              R    Y++ KS  + S       L KSS+V  +P
Sbjct:    1 MGVALTRLAQWTAA-GYETGTLEITPLNESILNEITKFVESFSYKYPQEAKFVFVEPLEWKTYLEPSAFELGYVVSATTAESEETGKDG--QPLLFLS----VPYIKVRSFGQLSQLLSIATDSKLQEAQACIEANRDPVVKILGPDYNEMK-EDPTRLTLLDTII-----KDKETYMKRK----VAILLKQLDLHLLNHSLKYISLEISLNPGTFKKDIELLKRFSG-KGEQTVLESIEYTSDYEF--SNGCRAPPWRQIQGEICYVLVKPHDMETLCLTCSTEGVFLNGGKTEEEGEINYERKGE-IYKDLVTCLKDKSPVFSE-----------NMSKHEIRFTEEQQKDNQIFEKPKTEDGHSSVAGSEKSKIEKISFG-----KSPMTKRLEPSLNW--------------RVTVDYKDHKSSIKDSQEEKQGKLEKSSSVSVAP 399          
BLAST of Armadillo repeat containing 4 vs. Ensembl Mouse
Match: Armc4 (armadillo repeat containing 4 [Source:MGI Symbol;Acc:MGI:1922184])

HSP 1 Score: 137.887 bits (346), Expect = 8.779e-38
Identity = 66/87 (75.86%), Postives = 75/87 (86.21%), Query Frame = 2
Query: 2003 GGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNR 2263
            GGNQT+T+I+LC++RD  L  E CQLAIRDVGGLEVLINLL+TDEV+CKIGSLKILKEISHNP IRR I DLGGL  MVNIL  P++
Sbjct:    5 GGNQTATVIALCSMRDFNLAQETCQLAIRDVGGLEVLINLLDTDEVKCKIGSLKILKEISHNPQIRRNIVDLGGLPIMVNILDSPHK 91          
BLAST of Armadillo repeat containing 4 vs. Ensembl Mouse
Match: Ctnnb1 (catenin (cadherin associated protein), beta 1 [Source:MGI Symbol;Acc:MGI:88276])

HSP 1 Score: 60.4622 bits (145), Expect = 1.581e-8
Identity = 95/388 (24.48%), Postives = 166/388 (42.78%), Query Frame = 2
Query: 1976 IQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISH-NPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARR-TVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXX-XXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQE--CASEKSYRIAIRTEGMIEDLVKN-LKSSNKELEMHCAATIFKC----AEEKEI-RDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLL 3106
            I  LVK L     +    ++  L +L LH E  ++A+R  GGL+ ++ LL    V+    +   L+ +++ N   +  I   GG   +VNI++    +    +   +  V     + +  +   GG++ L GL    +LT P+                R V   LW+         +     G++  L +LL S+ +N++    G L    C + K+  +  +  G IE LV+  L++ ++E     A    +      +E E+ ++ VR + GL  +V LL    +  L+ A  G I   A+   N    +E  AI +LV LL    ++      +  +  +     R+E+++    GAL  +A+D  NR VIR    I   V LL
Sbjct:  237 IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQAL-GL----HLTDPSQ---------------RLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG-IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLL 603          
BLAST of Armadillo repeat containing 4 vs. Ensembl Mouse
Match: Ctnnb1 (catenin (cadherin associated protein), beta 1 [Source:MGI Symbol;Acc:MGI:88276])

HSP 1 Score: 60.4622 bits (145), Expect = 1.581e-8
Identity = 95/388 (24.48%), Postives = 166/388 (42.78%), Query Frame = 2
Query: 1976 IQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISH-NPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARR-TVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXX-XXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQE--CASEKSYRIAIRTEGMIEDLVKN-LKSSNKELEMHCAATIFKC----AEEKEI-RDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLL 3106
            I  LVK L     +    ++  L +L LH E  ++A+R  GGL+ ++ LL    V+    +   L+ +++ N   +  I   GG   +VNI++    +    +   +  V     + +  +   GG++ L GL    +LT P+                R V   LW+         +     G++  L +LL S+ +N++    G L    C + K+  +  +  G IE LV+  L++ ++E     A    +      +E E+ ++ VR + GL  +V LL    +  L+ A  G I   A+   N    +E  AI +LV LL    ++      +  +  +     R+E+++    GAL  +A+D  NR VIR    I   V LL
Sbjct:  237 IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQAL-GL----HLTDPSQ---------------RLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG-IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLL 603          
BLAST of Armadillo repeat containing 4 vs. UniProt
Match: sp|B2RY50|ARMC4_MOUSE (Armadillo repeat-containing protein 4 OS=Mus musculus OX=10090 GN=Armc4 PE=1 SV=1)

HSP 1 Score: 796.964 bits (2057), Expect = 0.000e+0
Identity = 436/632 (68.99%), Postives = 512/632 (81.01%), Query Frame = 2
Query: 1928 PDRRQET-SDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDC-PNLTGPANSQAQPADIE-RDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            PD RQE  +D+ SEYWQIQKLVKYLKGGNQT+T+I+LC++RD  L  E CQLAIRDVGGLEVLINLL+TDEV+CKIGSLKILKEISHNP IRR I DLGGL  MVNIL  P++ LKCLSAETIANVAKF+RARR VR +GGI KLV LLDC  N T P     QP+  E RD+EVARC ALALWSCSKS  NKEA++KAG I LL++LLK++H NMLIP+VGTLQECASE++YR AI+ E +IE+LVKNL S N++L+ HCA  I++CAE++E RDLVR +GGL+PL +LL   DNKE LAAVTGAIWKC+IS+ENV KF+E +AIE LV LL DQPEE                      VLVNVVGALGE  ++  NR ++RK GGI PLVNLL G NQALLVN TK+VG CA EP+SM+IID+ DGVRLLWSLLKNP+P+V+A+AAWA+CPCIENAKDAGEMVRSFVGGLEL+V+LLKS+  EVLASVCAAI  IA D+ENLAVITDHGVVPLL++L  T +D LR  LAEAISRCC WG NR+ FG+  AVAPLV+YLKS+D +VHR+TA+ALYQLS+  +NC+TMHE G VKLLL +VGS D+ LQEAAA CI+NIRRLALA EK++
Sbjct:  430 PDHRQEANADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFNLAQETCQLAIRDVGGLEVLINLLDTDEVKCKIGSLKILKEISHNPQIRRNIVDLGGLPIMVNILDSPHKSLKCLSAETIANVAKFKRARRAVRQHGGITKLVALLDCGQNSTEPT----QPSLYETRDVEVARCGALALWSCSKSHSNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDEETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVIKFREYKAIETLVGLLTDQPEE----------------------VLVNVVGALGECCQEYENRVLVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMAIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIENAKDAGEMVRSFVGGLELVVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNDKLRRHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKAR 1035          

HSP 2 Score: 146.747 bits (369), Expect = 3.573e-34
Identity = 130/450 (28.89%), Postives = 205/450 (45.56%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQ--DIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGP---QADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKESYNQTRSDLRLAGDADNDYS----RSTADQDSVDGGRNKTVKMKVNQGSKHTWKESQKDKLKVSKKWXXXXXXXXXXXXTTRRLKYYENRKSETRHSNRNSDS-LNKSSTVVTSP 1393
            MG+ L + A+WT+  G   G LE TPLN  IL+ I KF+E F  K P    F F + + W+T L+    ++G        +     KD   Q +  +     +  I++     +  +L  A    + E +  +E NRDPV KILG  ++ +  ED +     D II     KD    +++K    +++     D+ L+   L  I+  + +NP   + +I+LL +FSG   +++ L SIE    Y+F   NGCRAPPWRQ+ GEI Y +V+ H    +C+T S+ G F+N G    + +  + RK + IY DL++ LK +   FS            N ++ ++R   +   D        T D  S   G  K+   K++ G     K     +L+ S  W              R    Y++ KS  + S       L KSS+V  +P
Sbjct:    1 MGVALTRLAQWTAA-GYETGTLEITPLNESILNEITKFVESFSYKYPQEAKFVFVEPLEWKTYLEPSAFELGYVVSATTAESEETGKDG--QPLLFLS----VPYIKVRSFGQLSQLLSIATDSKLQEAQACIEANRDPVVKILGPDYNEMK-EDPTRLTLLDTII-----KDKETYMKRK----VAILLKQLDLHLLNHSLKYISLEISLNPGTFKKDIELLKRFSG-KGEQTVLESIEYTSDYEF--SNGCRAPPWRQIQGEICYVLVKPHDMETLCLTCSTEGVFLNGGKTEEEGEINYERKGE-IYKDLVTCLKDKSPVFSE-----------NMSKHEIRFTEEQQKDNQIFEKPKTEDGHSSVAGSEKSKIEKISFG-----KSPMTKRLEPSLNW--------------RVTVDYKDHKSSIKDSQEEKQGKLEKSSSVSVAP 399          
BLAST of Armadillo repeat containing 4 vs. UniProt
Match: sp|Q5T2S8|ARMC4_HUMAN (Armadillo repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=ARMC4 PE=1 SV=1)

HSP 1 Score: 793.882 bits (2049), Expect = 0.000e+0
Identity = 430/628 (68.47%), Postives = 509/628 (81.05%), Query Frame = 2
Query: 1934 RRQETSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCP-NLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            R++ ++D+ SEYWQIQKLVKYLKGGNQT+T+I+LC++RD  L  E CQLAIRDVGGLEVLINLLETDEV+CKIGSLKILKEISHNP IR+ I DLGGL  MVNIL  P++ LKCL+AETIANVAKF+RARR VR +GGI KLV LLDC  + T PA S    A   RD+EVARC ALALWSCSKS  NKEA++KAG I LL++LLK++H NMLIP+VGTLQECASE++YR AI+ E +IE+LVKNL S N++L+ HCA  I++CAE+KE RDLVR +GGL+PL +LL   DNKE LAAVTGAIWKC+IS+ENV KF+E +AIE LV LL DQPEE                      VLVNVVGALGE  ++  NR ++RK GGI PLVNLL G NQALLVN TK+VG CA EP+SM IID+ DGVRLLWSLLKNP+P+V+A+AAWA+CPCI+NAKDAGEMVRSFVGGLELIV+LLKS+  EVLASVCAAI  IA D+ENLAVITDHGVVPLL++L  T ++ LR  LAEAISRCC WG NR+ FG+  AVAPLV+YLKS+D +VHR+TA+ALYQLS+  +NC+TMHE G VKLLL +VGS D+ LQEAAA CI+NIRRLALA EK++
Sbjct:  440 RQEASADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFSLAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIMVNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLYEA---RDVEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECASEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLASLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEE----------------------VLVNVVGALGECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGVRLLWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLASVCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFGEHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDLQEAAAGCISNIRRLALATEKAR 1042          

HSP 2 Score: 151.754 bits (382), Expect = 1.167e-35
Identity = 125/409 (30.56%), Postives = 198/409 (48.41%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGP---QADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKESYNQTRSDLRL--------AGDADNDYSRS---TADQDSVDGGRNKTV---------KMKVNQGSKHTWKESQKDK 1231
            MG+ L K  +WT+   G G  LE TPLN  IL  I  F+E F  K+P    F F + + W TSL      S   +          DK  Q +  +     + +I+I     +  +L  A    + E +  +E NRDP+ KILG  ++T+  +++SI   A  I+   T  D PE   K    K+++     D+ L+   L  I+  + ++P  V+ +I+LL +FSG   +++ L SIE    Y+F   NGCRAPPWRQ+ GEI Y +V+ H    +C+T S+ G F+N G    + D  + RK   IY +L++ L+++   FS  ++   +  S +Q +   +L        A     D S S   + +++ ++  RN+           K  VN   K + KE Q+DK
Sbjct:    1 MGVALRKLTQWTAAGHGTG-ILEITPLNEAILKEIIVFVESFIYKHPQEAKFVFVEPLEWNTSLAPSAFESGYVVSETTVKSEEVDKNGQPLLFLS----VPQIKIRSFGQLSRLLLIAKTGKLKEAQACVEANRDPIVKILGSDYNTM--KENSI---ALNILGKITRDDDPESEIK---MKIAMLLKQLDLHLLNHSLKHISLEISLSPMTVKKDIELLKRFSG-KGNQTVLESIEYTSDYEF--SNGCRAPPWRQIRGEICYVLVKPHDGETLCITCSAGGVFLNGGKTDDEGDVNYERKGS-IYKNLVTFLREKSPKFSENMSKLGISFSEDQQKEKDQLGKAPKKEEAAALRKDISGSDKRSLEKNQINFWRNQMTKRWEPSLNWKTTVNYKGKGSAKEIQEDK 392          
BLAST of Armadillo repeat containing 4 vs. UniProt
Match: sp|Q9VM21|GUDU_DROME (Armadillo repeat-containing protein gudu OS=Drosophila melanogaster OX=7227 GN=gudu PE=2 SV=1)

HSP 1 Score: 498.819 bits (1283), Expect = 5.349e-160
Identity = 298/632 (47.15%), Postives = 425/632 (67.25%), Query Frame = 2
Query: 1949 SDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCP-NLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQ---DNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQQKLLKI 3832
            +++ ++Y+ IQKLVKY+K GNQT+TI+SLC L+D  L T+  Q AI D+GGL+VL+N+LE  + +C +G+LK+L +I+ N  IR+ I DL G+  +V+IL    +DLK ++AET+ANV K R AR+ VR  GGI KLV L+D   ++      Q  P D+E  +++ R  A AL++ + SK N E M+K+GI+ L+++LLKS H++++IPI+GT+++C+SE  +++AI TEGMI D+V +L S N EL+M  +  I+KCA +   RDLVR  GGLEPLV +++ +   +NK LL   TGAIW CA++  NVK   +L+ +  LV LLND+ +E                      VL NV GA+ E  +   NR  +R+ GG+  +V+LL  ++  LL N  K +  CAE+PDSM I++  D VRL+WSLLKNP   VQA+AA+AICPC+ NA D+ E+VRS VG +EL+V LLKS+ I VL++VCAAI  IA D+ NLA++TD  V+  LA L  TTDDLLR  LA A++ C  +G N  + G+   V P+V Y+ S +  VHRSTA AL +LS  P+NC+TMH++GVV  LL  +GS +++LQ AAA C+ NIR LAL   ++++ LLKI
Sbjct:   61 AEIPADYYNIQKLVKYIKAGNQTATIVSLCCLKDYDLSTQINQFAISDIGGLDVLVNILECSDTKCCLGALKVLSDITLNIDIRKTIVDLDGIPLIVDILNSSMKDLKTMAAETLANVCKVRLARKYVRTCGGIPKLVDLIDIKLSILKTPRDQLSPDDLE-SLDMTRAGARALFTLADSKHNMEQMRKSGIVPLMAQLLKSCHIDVVIPIMGTVRKCSSEPKFQLAITTEGMIPDIVSHLSSENTELKMEGSTAIYKCAFDGTTRDLVREAGGLEPLVTIIKDKNVRENKPLLRGATGAIWMCAVTDANVKVLDQLRTVNHLVALLNDECDE----------------------VLTNVTGAISECVRFQSNREQLRQAGGLPAMVSLLNSSHAPLLENLAKGLKECAEDPDSMRILEDLDAVRLIWSLLKNPTTRVQAHAAYAICPCVRNANDSAELVRSLVGAMELVVGLLKSKDIMVLSAVCAAIATIAQDQTNLAILTDLKVIYKLADLVQTTDDLLRMNLAAAVAACACFGNNTEELGRLRTVTPIVTYMTSDNPLVHRSTAMALEKLSMDPQNCITMHQSGVVPFLLECIGSTNKELQLAAAGCLRNIRELAL---RAEEYLLKI 666          
BLAST of Armadillo repeat containing 4 vs. UniProt
Match: sp|Q59MN0|VAC8_CANAL (Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VAC8 PE=3 SV=3)

HSP 1 Score: 66.2402 bits (160), Expect = 1.356e-9
Identity = 72/271 (26.57%), Postives = 132/271 (48.71%), Query Frame = 2
Query: 3020 GALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVI--TDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQQKLL 3826
            GALG +A +  N+ +I + GG+ PL+  +  TN  +  N    +   A + D+ S I K   +  L  L K+ +  VQ NA  A+     + ++  E+V +  G + ++VSLL +E  +V      A+  IA+DE N   +  T+  +V  L  L  +    ++CQ   A+    +    +++  + G +  LV+ L  + + +  +    +  +S  P N   + EAG +K L+GL+   D   +E     ++ +R LA ++EK++  LL
Sbjct:  109 GALGNLAVNTENKILIVEMGGLEPLIRQMMSTNIEVQCNAVGCITNLATQDDNKSKIAKSGALIPLTKLAKSKDIRVQRNATGALLNMTHSGENRQELVNA--GAVPVLVSLLSNEDADVQYYCTTALSNIAVDEVNRKKLASTEPKLVGQLVHLMDSPSPRVQCQATLALRNLASDSGYQVEIVRAGGLPHLVQLLTCNHQPLVLAAVACIRNISIHPLNEALIIEAGFLKPLVGLLDYTDS--EEIQCHAVSTLRNLAASSEKNRTALL 375          
BLAST of Armadillo repeat containing 4 vs. UniProt
Match: sp|Q9WU82|CTNB1_RAT (Catenin beta-1 OS=Rattus norvegicus OX=10116 GN=Ctnnb1 PE=1 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.589e-8
Identity = 94/388 (24.23%), Postives = 167/388 (43.04%), Query Frame = 2
Query: 1976 IQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISH-NPLIRRAIADLGGLNTMVNILKDPNRD-LKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXX-XXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQE--CASEKSYRIAIRTEGMIEDLVKN-LKSSNKELEMHCAATIFKC----AEEKEI-RDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLL 3106
            I  LVK L     +    ++  L +L LH E  ++A+R  GGL+ ++ LL    V+    +   L+ +++ N   +  I   GG   +VNI++    + L   ++  +  ++     +  +   GG++ L      P+LT P+                R V   LW+         +     G++  L +LL S+ +N++    G L    C + K+  +  +  G IE LV+  L++ ++E     A    +      +E E+ ++ VR + GL  +V LL    +  L+ A  G I   A+   N    +E  AI +LV LL    ++      +  +  +     R+E+++    GAL  +A+D  NR VIR    I   V LL
Sbjct:  237 IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQAL-----GPHLTDPSQ---------------RLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG-IEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLL 603          
BLAST of Armadillo repeat containing 4 vs. TrEMBL
Match: gnl|BL_ORD_ID|22912158 (tr|A0A4S2M1Z9|A0A4S2M1Z9_OPIFE Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003307 PE=4 SV=1)

HSP 1 Score: 896.345 bits (2315), Expect = 0.000e+0
Identity = 471/630 (74.76%), Postives = 543/630 (86.19%), Query Frame = 2
Query: 1928 PDRRQETS-DMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            P+ + E+  D+ SEYWQI K+VKYLKGGNQTSTIISLCAL+D+PL+TE CQLA+RDVGGL+VLINLLET+EVRCK+GSLKIL+EI+ NP IRRAIAD+GGL  +VN+L+ PNRDLKCLSAE IANVA F RARRTVR YGGIK+LV LLDCP+L    N+     D+ERDIEVARC ALALWSCSKS+KNK AMKKAG+ISLL++LLKS H NMLIP+VGTLQECASE +YR+AIRTEGM+EDLVKNLK  N EL+MHCA+TIFKCAEE E RDLVR YGGLEPL+ LL +QDNKELLAA TGAIWKCAIS+ENV +FQ+L  IEKLV LLN+QPEEM+ YLYV+S S +I+LV R EKVLVNVVGALGEMAKD  N   IR+T GI PLV+LLT TNQ LL+NTT+++ +CA EP+SMSII+  DGVRLLWSLLKNPNPEVQ+ AAWAICPCIENAKDAGEMVRSFVGGLELIVSLL+S  + VLA+VCAA+ KIA+DEENLAVITDHGVV LL+RLT T DD LRC L EAI+RCC WGTNR+DFG+ GAV+PLV YL S+D +VHRSTAKAL+QLS+ P NCV MH+AGVVK LL +VGS D +LQ AAA CI+NIRRL+LANEK+Q
Sbjct:  587 PEHQGESHVDLPSEYWQIGKIVKYLKGGNQTSTIISLCALQDMPLNTEVCQLAVRDVGGLDVLINLLETEEVRCKLGSLKILREITKNPKIRRAIADVGGLQPLVNLLRSPNRDLKCLSAEVIANVANFHRARRTVRQYGGIKRLVALLDCPSL----NAVPMTTDVERDIEVARCGALALWSCSKSRKNKLAMKKAGVISLLARLLKSPHENMLIPVVGTLQECASEPTYRVAIRTEGMVEDLVKNLKRPNPELQMHCASTIFKCAEEPETRDLVRLYGGLEPLIVLLAKQDNKELLAAATGAIWKCAISKENVVQFQKLGVIEKLVGLLNEQPEEMSTYLYVESVSPRIQLVLRTEKVLVNVVGALGEMAKDANNIVTIRRTHGIPPLVSLLTRTNQDLLINTTRAIEKCAGEPESMSIIESLDGVRLLWSLLKNPNPEVQSGAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLRSTNMNVLAAVCAAVSKIAVDEENLAVITDHGVVALLSRLTCTKDDKLRCPLTEAIARCCTWGTNRVDFGRAGAVSPLVGYLNSTDPNVHRSTAKALFQLSRDPNNCVAMHDAGVVKPLLQMVGSPDMELQTAAAGCISNIRRLSLANEKAQ 1212          

HSP 2 Score: 219.164 bits (557), Expect = 5.212e-54
Identity = 123/336 (36.61%), Postives = 195/336 (58.04%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELN----KIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSI-YRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRF-HSKNEICVTASSTGWFVNNG--PQADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADL 1057
            MG TL+++AEWTS  GG  GKL ++P+N+ +L+    F++ +   NP + +  FK A+ W+TSL  QD+       N   +  S D   + +  +   R +N    +I +  L     ++ AAG ++++E+R  LE N DP+  +LG+RFS+ S       +   +EII+    KDS E  EKK   K++L+ HNFD++LM D L K+++ VR +P  VE+EI++L K     +  S L  I P  ++  IHENGCRAPPWRQ+HG+I+YF V   + ++E+ VTA++ GWF+N G   +   M   +  +++  L+ LL+     FS F+  A+L
Sbjct:    1 MGCTLSRAAEWTSARGGSSGKLTSSPINNAVLEEAVDFLKNYHTTNPGAQNLVFKSALKWKTSLSPQDM-KGFTTTNDGAISTSTDTVGEPLAAL---RAINSGDFEIYVRSLQECVKMINAAGSRALAEVRACLESNPDPLVNMLGERFSSSSISADDSIFGLMEEIIS--NTKDSEEAKEKKISLKLALDLHNFDMKLMNDALQKVSKEVRQSPGAVEHEIEVLDKALPSGRPDSILEYIRPTGVFTMIHENGCRAPPWRQMHGDIAYFEVGIRNPRSELSVTAATYGWFMNGGYNQKTGQMNFDRVGEVHRSLVELLQANSSSFSEFMKKANL 330          
BLAST of Armadillo repeat containing 4 vs. TrEMBL
Match: gnl|BL_ORD_ID|22921014 (tr|A0A4S2M213|A0A4S2M213_OPIFE Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003307 PE=4 SV=1)

HSP 1 Score: 894.804 bits (2311), Expect = 0.000e+0
Identity = 471/630 (74.76%), Postives = 543/630 (86.19%), Query Frame = 2
Query: 1928 PDRRQETS-DMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            P+ + E+  D+ SEYWQI K+VKYLKGGNQTSTIISLCAL+D+PL+TE CQLA+RDVGGL+VLINLLET+EVRCK+GSLKIL+EI+ NP IRRAIAD+GGL  +VN+L+ PNRDLKCLSAE IANVA F RARRTVR YGGIK+LV LLDCP+L    N+     D+ERDIEVARC ALALWSCSKS+KNK AMKKAG+ISLL++LLKS H NMLIP+VGTLQECASE +YR+AIRTEGM+EDLVKNLK  N EL+MHCA+TIFKCAEE E RDLVR YGGLEPL+ LL +QDNKELLAA TGAIWKCAIS+ENV +FQ+L  IEKLV LLN+QPEEM+ YLYV+S S +I+LV R EKVLVNVVGALGEMAKD  N   IR+T GI PLV+LLT TNQ LL+NTT+++ +CA EP+SMSII+  DGVRLLWSLLKNPNPEVQ+ AAWAICPCIENAKDAGEMVRSFVGGLELIVSLL+S  + VLA+VCAA+ KIA+DEENLAVITDHGVV LL+RLT T DD LRC L EAI+RCC WGTNR+DFG+ GAV+PLV YL S+D +VHRSTAKAL+QLS+ P NCV MH+AGVVK LL +VGS D +LQ AAA CI+NIRRL+LANEK+Q
Sbjct:  466 PEHQGESHVDLPSEYWQIGKIVKYLKGGNQTSTIISLCALQDMPLNTEVCQLAVRDVGGLDVLINLLETEEVRCKLGSLKILREITKNPKIRRAIADVGGLQPLVNLLRSPNRDLKCLSAEVIANVANFHRARRTVRQYGGIKRLVALLDCPSL----NAVPMTTDVERDIEVARCGALALWSCSKSRKNKLAMKKAGVISLLARLLKSPHENMLIPVVGTLQECASEPTYRVAIRTEGMVEDLVKNLKRPNPELQMHCASTIFKCAEEPETRDLVRLYGGLEPLIVLLAKQDNKELLAAATGAIWKCAISKENVVQFQKLGVIEKLVGLLNEQPEEMSTYLYVESVSPRIQLVLRTEKVLVNVVGALGEMAKDANNIVTIRRTHGIPPLVSLLTRTNQDLLINTTRAIEKCAGEPESMSIIESLDGVRLLWSLLKNPNPEVQSGAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLRSTNMNVLAAVCAAVSKIAVDEENLAVITDHGVVALLSRLTCTKDDKLRCPLTEAIARCCTWGTNRVDFGRAGAVSPLVGYLNSTDPNVHRSTAKALFQLSRDPNNCVAMHDAGVVKPLLQMVGSPDMELQTAAAGCISNIRRLSLANEKAQ 1091          

HSP 2 Score: 218.779 bits (556), Expect = 4.858e-54
Identity = 123/336 (36.61%), Postives = 196/336 (58.33%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELN----KIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSI-YRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRF-HSKNEICVTASSTGWFVNNG--PQADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADL 1057
            MG TL+++AEWTS  GG  GKL ++P+N+ +L+    F++ +   NP + +  FK A+ W+TSL  QD+       +G  +  S D   + +  +   R +N    +I +  L     ++ AAG ++++E+R  LE N DP+  +LG+RFS+ S       +   +EII+    KDS E  EKK   K++L+ HNFD++LM D L K+++ VR +P  VE+EI++L K     +  S L  I P  ++  IHENGCRAPPWRQ+HG+I+YF V   + ++E+ VTA++ GWF+N G   +   M   +  +++  L+ LL+     FS F+  A+L
Sbjct:    1 MGCTLSRAAEWTSARGGSSGKLTSSPINNAVLEEAVDFLKNYHTTNPGAQNLVFKSALKWKTSLSPQDMKGFTTTNDGA-ISTSTDTVGEPLAAL---RAINSGDFEIYVRSLQECVKMINAAGSRALAEVRACLESNPDPLVNMLGERFSSSSISADDSIFGLMEEIIS--NTKDSEEAKEKKISLKLALDLHNFDMKLMNDALQKVSKEVRQSPGAVEHEIEVLDKALPSGRPDSILEYIRPTGVFTMIHENGCRAPPWRQMHGDIAYFEVGIRNPRSELSVTAATYGWFMNGGYNQKTGQMNFDRVGEVHRSLVELLQANSSSFSEFMKKANL 330          
BLAST of Armadillo repeat containing 4 vs. TrEMBL
Match: gnl|BL_ORD_ID|22540852 (tr|A0A5J4NL79|A0A5J4NL79_9TREM Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0012233 PE=4 SV=1)

HSP 1 Score: 884.019 bits (2283), Expect = 0.000e+0
Identity = 468/635 (73.70%), Postives = 543/635 (85.51%), Query Frame = 2
Query: 1928 PDRRQETS-DMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQQKLLK 3829
            P+RR +T+ D+ SEYWQI KLVKYLKGGNQTSTIISLCAL+D+PL TE CQLA+RDVGG+++L+NLLETDEVRCK+GSLKIL+EI+ NP IRRAIAD+GGL  +VN+L+ PNRDLKCLSAE IANVA F RARRTVR YGGIK+LV LLDCP+L    NS     ++ERDIEVARC ALALWSCSKS+KNK AMK+AG+ISLL++LLKS H NMLIP+VGTLQECASE +YR+AIRTEGMIEDLVKNLK +N EL+MHCA+TI+KCAEE E RDLVR YGGLEPL+ LL  Q+NKELLAA TGAIWKCAIS+EN+K+FQ+L  IEKLV+LLN+QPEE N    V    + I       KVLVNVVGALGEMAKDP NR  IRK+GGI PLV+LLT TNQ LL+NTTK+VG+CAEEP+SMS I+  DGVRLLWSLLKNPN EVQ++AAWAICPCIENAKDAGEMVRSFVGGLELIVSLL+S  + VLA+VCAA+ KIA+DEENLAVITDHGVVPLL+RLT T DD LRC L +AI+RCC WGTNRIDFG+ GAV+PLV+YL SSD +VHRSTA+AL+QLS+ P NCV MHEAG VKLLL +VGS D +LQ AAA CI+NIRRL+LANE++Q K ++
Sbjct:  405 PERRTDTNVDLPSEYWQIGKLVKYLKGGNQTSTIISLCALQDMPLKTEMCQLAVRDVGGIDILVNLLETDEVRCKLGSLKILREIAKNPQIRRAIADIGGLQPLVNLLRSPNRDLKCLSAEVIANVANFHRARRTVRQYGGIKRLVALLDCPSL----NSTPMTNEVERDIEVARCGALALWSCSKSRKNKLAMKRAGVISLLARLLKSPHENMLIPVVGTLQECASEPTYRVAIRTEGMIEDLVKNLKRTNPELQMHCASTIYKCAEEPETRDLVRLYGGLEPLINLLGSQENKELLAAATGAIWKCAISKENIKQFQKLGVIEKLVSLLNEQPEERNT---VQQYGSPIPY-----KVLVNVVGALGEMAKDPANRVTIRKSGGIAPLVSLLTRTNQELLINTTKAVGKCAEEPESMSAIESLDGVRLLWSLLKNPNHEVQSSAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLRSNDLGVLAAVCAAVSKIAVDEENLAVITDHGVVPLLSRLTCTKDDHLRCPLTDAIARCCTWGTNRIDFGRAGAVSPLVRYLHSSDPAVHRSTARALFQLSRDPGNCVAMHEAGAVKLLLRMVGSQDLELQNAAAGCISNIRRLSLANERAQLKRIQ 1027          

HSP 2 Score: 139.428 bits (350), Expect = 2.103e-29
Identity = 74/227 (32.60%), Postives = 120/227 (52.86%), Query Frame = 2
Query:  614 VFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEI-CVTASSTGWFVNNG--PQADSMFARKDDKIYSDLISLLKQEDEHFSSFINTAD------LKESYNQTRSDLRLAGDADNDYSRSTADQDSVDGGRNKTVKMKVNQG-----SKHTWKESQKDKLKVSKKW 1252
              K++L+FHN DV+L+ D L KIA   R+ P+ VE EI LL    G  + K  L  I P  ++K +H+NGCRAPPWRQ++G+I+Y+ ++    + +  VTA++ GWF+N G   +   M   K  + Y DL +LL+     F++F+N+ D      L +     RS  +  G       ++T  +  ++  + ++ K     G     +KH  KE  +   + SK+W
Sbjct:    2 TLKVALDFHNLDVKLLNDTLHKIAGEFRLTPQTVECEISLLHNLVGFDRQKCILECIRPTGVFKLVHDNGCRAPPWRQMYGDIAYYTIKILDTDSVLSVTAATYGWFLNGGFNEKTGQMNFEKTGETYRDLTALLRANSSQFNAFLNSTDLANLMQLSQKACSPRSQHQPKGREQKAPGQTTESRSEINRLKEQSKKPTEGNGKTQATTKHHLKEPAQTSNQPSKRW 228          
BLAST of Armadillo repeat containing 4 vs. TrEMBL
Match: gnl|BL_ORD_ID|23843268 (tr|V4CPB6|V4CPB6_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_224011 PE=4 SV=1)

HSP 1 Score: 882.863 bits (2280), Expect = 0.000e+0
Identity = 475/622 (76.37%), Postives = 530/622 (85.21%), Query Frame = 2
Query: 1949 SDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            +D+ SEYWQIQKLVKYLKGGNQT+TII+LC+LRD  L  E CQLAIRDVGGLEVLINLL+T+EV+CKIG+LKILKEIS N  IRRAIADLGGL TMV IL+D N+DLKCL+AETIANVAKFRRARRTVR +GGIK+LV LLDC  L  P        D+E+D+EVARC ALALWSCSKSKKNKEAM+KAG I LL+KLLKS H +MLIP+VGTLQECASE SYR+AIRTEGMIEDLV+NLKSSN+EL+MHCA+ IFKCAEEKE RDLVR YGGL+PLV LL   +NKELLAA TGAIWKCAIS ENV++F+EL+AI++LVTLLN+QPEE                      VLVNVVGALGE+AK PPNR  IRK GGI+PLVNLLTGTNQALLVN T++VG+CAEEPD+M IIDK DGVRLLWSLLKN NPEVQA+AAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSE  EVLASVCAAI  IA DEENLAVITDHGVVP+LA+LT TTDD LR  LAEAISRCCNWG NR  FG+  AVAPLVKYLKSSDE+VHRSTA+AL+QLSK PENC+TMHEAGVV+ L+ +VGS DE LQEAAA CI NIRRLALANE+++
Sbjct:  473 ADLPSEYWQIQKLVKYLKGGNQTATIIALCSLRDFNLSLETCQLAIRDVGGLEVLINLLDTEEVKCKIGALKILKEISKNTQIRRAIADLGGLQTMVKILRDTNKDLKCLAAETIANVAKFRRARRTVRQHGGIKRLVSLLDCAGLNKP--------DMEKDVEVARCGALALWSCSKSKKNKEAMRKAGSIPLLAKLLKSTHEDMLIPVVGTLQECASEPSYRLAIRTEGMIEDLVQNLKSSNQELQMHCASAIFKCAEEKETRDLVRQYGGLDPLVTLLTNIENKELLAAATGAIWKCAISPENVQRFEELKAIDQLVTLLNNQPEE----------------------VLVNVVGALGELAKAPPNRMQIRKAGGISPLVNLLTGTNQALLVNVTRAVGKCAEEPDNMIIIDKLDGVRLLWSLLKNQNPEVQASAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEDKEVLASVCAAIANIAKDEENLAVITDHGVVPMLAKLTNTTDDKLRRHLAEAISRCCNWGNNRTAFGREDAVAPLVKYLKSSDENVHRSTARALFQLSKNPENCITMHEAGVVQPLMKMVGSQDEDLQEAAAGCIGNIRRLALANERAK 1064          

HSP 2 Score: 206.453 bits (524), Expect = 2.888e-50
Identity = 144/424 (33.96%), Postives = 221/424 (52.12%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNK----IEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEII-----NAGTEK-----DSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIY--KFIHENGCRAPPWRQLHGEISYFIVRFHSKNE-ICVTASSTGWFVNNGPQADSM----FARKDDKIYSDLISLLKQEDEHFSSFINTADLKESYNQT-RSDLRLAGDAD---------NDYSRSTADQDSVDGGRNKTVKMKVNQGSKHTWKESQKDKLKVSKKW 1252
            MG  L ++A+WTS   G GGKLE T +N  +L+AI KF+E   GK+ +     FK  + W+TSL  Q    S    +G  V +S +K  +  T +    +L K    + IS L     +L+ AG K M ELR  LE NRDPV  +LG+RF+TV  +D+SI+RY +EI      NA  E+      S E+ EKK V ++ L+    D +LM   + K++  VR++P  V+ E+ +L + SG  + K  L   E +  Y   F+ +NGCRA PWRQLHG+I Y  V+ H K+  + +TA+++G+++NNGP  +      + R D   Y DL+SLLK     F+  I+  +      Q  +  + ++   +         N Y ++T +++  D  ++K  K +             K KL+ S KW
Sbjct:    1 MGQALQRAAQWTSAKDGAGGKLEFTSINEDLLNAILKFVET-TGKSTEEASLTFKTPLKWQTSLNPQHFQGSGFSDSGDDV-ISDNKSSKDDTPLLKLHKLAKDKYEVNISTLGYAEQVLRIAGDKKMVELRGCLEANRDPVVNMLGERFATVETDDNSIFRYIEEITKEIEQNAKQEQTAEGSKSAEVEEKKIVLRLRLKLLRLDEQLMNMSIQKMSSEVRLSPASVDGEVTILKQLSGSDETKCVL---EYIDYYGETFVSKNGCRAQPWRQLHGDICYIYVKTHDKDTPLYITANTSGYYLNNGPDPEKPTQLDYTRPDSTTYRDLVSLLKDNSSKFAELIDQQEFTLKVEQNDKKKIEMSEQTEQNEDYQKKKNSYEQNTRNENDQDSDKDKNQKNRTQ----------SKKKLEPSLKW 409          
BLAST of Armadillo repeat containing 4 vs. TrEMBL
Match: gnl|BL_ORD_ID|24982493 (tr|C3YEZ0|C3YEZ0_BRAFL Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_126603 PE=4 SV=1)

HSP 1 Score: 878.626 bits (2269), Expect = 0.000e+0
Identity = 473/630 (75.08%), Postives = 533/630 (84.60%), Query Frame = 2
Query: 1928 PDRRQET-SDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            PDRRQE  SD+ SEYWQIQKLVKYLKGGNQT+TII+LC++RD  L  E CQLAIRDVGGLEVLINLL+T+E++CKIGSLKILKEISHN  IRRAIADLGGL TMV ILK P++DLKCL+AETIANVAKFRRARRTVR +GGIKKLVGLLDC    GP  S     ++E+DIEVARC ALALWSCSKS KNK+A++KAG I LL++LLKS+H NMLIP+VGTLQECASE+SYR+AIRTEGMIEDLV NL+S N+ L+MHCA+ IFKCAEEKE RDLVR YGGL+PLV+LL + DNKELLAA TGAIWKCAIS ENV++FQEL+AIEKLV+LL  QPEE                      VLVNVVGALGE A++P NR  IRK GGI PLVNLLTGTNQ+LLVN TK+VG CA E ++M+IID+ DGVRLLWSLLKN NPEVQA+AAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSE+ EVLASVCAAI  IA DEENLAVITDHGVVP+LA+LT TTDD LR  LAEAI+RCC WG NR+ FG+  AVAPLV+YLKS DESVHR+TA+AL+QLS+ PENC+TMH AGVVKLLL +VGS DE LQEAAA CI NIRRLALANEK++
Sbjct:  469 PDRRQEANSDLPSEYWQIQKLVKYLKGGNQTATIIALCSMRDFNLTQETCQLAIRDVGGLEVLINLLDTEEIKCKIGSLKILKEISHNAQIRRAIADLGGLQTMVKILKSPDKDLKCLAAETIANVAKFRRARRTVRQHGGIKKLVGLLDC----GPLGSVPMTPEVEKDIEVARCGALALWSCSKSTKNKQAIRKAGGIPLLARLLKSSHENMLIPVVGTLQECASEQSYRLAIRTEGMIEDLVTNLRSENQVLQMHCASAIFKCAEEKETRDLVRQYGGLDPLVSLLDKSDNKELLAAATGAIWKCAISPENVERFQELKAIEKLVSLLQHQPEE----------------------VLVNVVGALGECAQEPQNRMSIRKAGGIPPLVNLLTGTNQSLLVNVTKAVGACATETENMTIIDRLDGVRLLWSLLKNQNPEVQASAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEHKEVLASVCAAIANIAKDEENLAVITDHGVVPMLAKLTNTTDDKLRRHLAEAIARCCMWGNNRVAFGEANAVAPLVRYLKSPDESVHRATAQALFQLSRDPENCITMHNAGVVKLLLDMVGSTDEALQEAAAGCIGNIRRLALANEKAK 1072          

HSP 2 Score: 215.312 bits (547), Expect = 3.935e-53
Identity = 123/360 (34.17%), Postives = 201/360 (55.83%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGPQADSMFARKDDK---IYSDLISLLKQEDEHFSSFINTADLKESYNQT---RSDLRLAGD-ADNDYSRST 1132
            MG TL ++A+WTSV  G  GKLE TPLN  +L+ I KF E F  K+       F+  ++WET +       + E+ + K V  +K    Q + ++++    N + +S  D +  +LK +G K M E R  LE NRDP +KILGD ++T+ GED+S+ R  +++     +++   +   +    + +    FD++L+   L  I++ VR+ P  V +E+ LL  FSG  +DK+ L SI+    Y+F   NGCRAPPWRQ+HG+I Y +++ H  + + V+AS+ G ++N G + ++    K D+   IY DL++LLK++   F+  I   D     ++T   + D+  +GD  D D +  T
Sbjct:    1 MGQTLTRAAQWTSVSEGGQGKLEFTPLNEALLNEIIKFAEGFASKHQQEAQTVFRSPLAWETQIAPSAFSGAYEVSDNKAVSEAKAPDGQPLLVLEAAGGKNTVSVSSFDQLSAVLKYSGDK-MREARACLEANRDPAAKILGDGYATIEGEDNSMLRLLEKVKKEDGQEEGETL---QATMGLLVILQQFDMQLLNMSLQHISKEVRLTPAAVNSEVKLLQSFSGDDRDKTVLKSIQYTSDYEF--NNGCRAPPWRQVHGDICYVVIKPHDTDLLSVSASTAGVYINGGFEKENFSDLKHDREGEIYKDLVTLLKEKSAVFAENIAKQDFTLREDETTGNQYDIMDSGDEGDGDNTHRT 354          
BLAST of Armadillo repeat containing 4 vs. Ensembl Cavefish
Match: armc4 (armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB-GENE-100316-7])

HSP 1 Score: 758.444 bits (1957), Expect = 0.000e+0
Identity = 417/629 (66.30%), Postives = 497/629 (79.01%), Query Frame = 2
Query: 1934 RRQET-SDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQQ 3817
            RR E+ +D+ SEYW+IQKLVKYLK GNQT+T+I+LC +RD  L  E CQLAIRD GGLEVLINLL+TDEV+CKIGSLKILKEIS +  IR+AIADL GL TMV+IL  P+++LKCL+AETIANVAKFRRARRTVR YGGIK+LV LL+C       +S    A+ E+D+EVARC ALALWSCSKS +NKEA++KAG I LL++LLKS   NMLIP+VGTLQECASE SYRIAI+TEGMI+DLVKNL   N+EL+MHCA+ IFKCAE+K  RDLVR Y GL+PLV+LL Q DNK+LLAA TGAIWKC+IS ENV KF+E + +E L++LL  QPEE                      VLVNVVGALGE A+   NR  I K+GGI  LV+LL  TNQALLVN T++VG CA EPD+M IID  DGVRLLWSLL+ P+P+VQA+AAWAICPCIEN KDAGEMVRSF+GGL+LIV LLKS   EVLASVCA I +IA D+ENLA+IT+HGV+P+LA LT T +D LR  LAEAIS CC WG N + FG+  AVAPLV+YL+S D SVH++TA ALYQLS+ P NC+TMHE+GVV+ L+ ++GS DE LQEAAA C+ NIR LALAN+K++ 
Sbjct:  352 RRGESRTDLPSEYWEIQKLVKYLKVGNQTATVIALCCIRDFNLAQETCQLAIRDGGGLEVLINLLDTDEVKCKIGSLKILKEISCSSQIRQAIADLRGLQTMVSILDSPDKELKCLAAETIANVAKFRRARRTVRQYGGIKRLVELLNCV-----PDSATLSAEQEKDVEVARCGALALWSCSKSTRNKEAIRKAGGIPLLARLLKSPQKNMLIPVVGTLQECASESSYRIAIQTEGMIKDLVKNLNCDNQELQMHCASAIFKCAEDKRTRDLVRQYKGLQPLVSLLSQTDNKQLLAAATGAIWKCSISMENVAKFEEFKTLEILLSLLTAQPEE----------------------VLVNVVGALGECAQRSANRIAIGKSGGIPRLVSLLRETNQALLVNVTRAVGACATEPDNMVIIDHLDGVRLLWSLLRKPDPDVQASAAWAICPCIENVKDAGEMVRSFMGGLKLIVDLLKSTNKEVLASVCAVISRIAKDKENLAIITEHGVMPMLANLTNTVNDKLRRHLAEAISHCCMWGNNHVAFGEERAVAPLVRYLRSKDPSVHQATALALYQLSRDPNNCITMHESGVVQPLIVMMGSTDEVLQEAAAGCVRNIRLLALANDKAKH 953          

HSP 2 Score: 118.242 bits (295), Expect = 2.619e-26
Identity = 94/337 (27.89%), Postives = 159/337 (47.18%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILE-----------DNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHE--NGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGPQADSMFARKDDKIYSDLISLLKQEDEHFSSFIN 1045
            MG+ L++ A+ T+       + E+ PLN  +L  I +F+E+   +  +     F + + W T+L++ D G+  EL +G  V  S++       L+Q    L    IS              +S S+L  +L             NRDPV KILG  F+ + GED S     + +   G  +      E +   K+ L     D +L+   + ++++ VR++P +V+ ++++L    G   +K  L S+     Y   HE  NGCR+PPWRQ  GEI+  I+       + VT S  G+++N   + +     K  ++Y DL++LLK +  HF+  IN
Sbjct:    1 MGVALSRQAQRTT------DRQEDAPLNEALLRDIVRFVEQVDSRYTEEAQLVFDEPLLWTTNLQASDFGTEYEL-SGSSVH-SRETDGDGRPLLQ----LTPPVISV-------------RSFSQLSKLLHLNNDSKTEGSATNRDPVKKILGRSFAMMDGEDPSALLLLNTVNEDGQSR------ETELKVKLFLILQQLDRQLLNSSVPQLSQKVRLSPAVVKCDVEMLKSVCGA-GEKRPLKSVR----YTSDHEYSNGCRSPPWRQEFGEIAGLIIEPCDTEPLSVTCSIYGFYLNMPIKQEGEENVKTRELYKDLLTLLKSKSPHFAESIN 301          
BLAST of Armadillo repeat containing 4 vs. Ensembl Cavefish
Match: ctnnb2 (catenin beta-1-like [Source:NCBI gene;Acc:103034575])

HSP 1 Score: 60.4622 bits (145), Expect = 1.283e-8
Identity = 93/388 (23.97%), Postives = 165/388 (42.53%), Query Frame = 2
Query: 1976 IQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISH-NPLIRRAIADLGGLNTMVNILKDPNRD-LKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXX-XXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQE--CASEKSYRIAIRTEGMIEDLVKN-LKSSNKELEMHCAATIFKCAEEKE-----IRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLL 3106
            I  LVK L     +    ++  L +L LH E  ++A+R  GGL+ ++ LL    V+    +   L+ +++ N   +  I   GG   +VNI++    + L   ++  +  ++     +  +   GG++ L GL    +LT P+                R V   LW+         +     G++  L +LL S+ +N++    G L    C + K+  +  +  G IE LV+  L++ ++E     A    +    +       ++ VR + GL  +V LL    +  L+ A  G I   A+   N    +E  AI +LV LL    ++      +  +  +     R+E+++    GAL  +A+D  NR VIR    I   V LL
Sbjct:  236 IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQAL-GL----HLTDPSQ---------------RLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG-IEALVRTVLRAGDREDITEPAVCALRHLTSRHQDAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLL 602          
BLAST of Armadillo repeat containing 4 vs. Ensembl Cavefish
Match: ctnnb1 (catenin beta 1 [Source:NCBI gene;Acc:103035854])

HSP 1 Score: 59.6918 bits (143), Expect = 1.898e-8
Identity = 93/388 (23.97%), Postives = 165/388 (42.53%), Query Frame = 2
Query: 1976 IQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISH-NPLIRRAIADLGGLNTMVNILKDPNRD-LKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXX-XXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQE--CASEKSYRIAIRTEGMIEDLVKN-LKSSNKELEMHCAATIFKCAEEKE-----IRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLL 3106
            I  LVK L     +    ++  L +L LH E  ++A+R  GGL+ ++ LL    V+    +   L+ +++ N   +  I   GG   +VNI++    + L   ++  +  ++     +  +   GG++ L GL    +LT P+                R V   LW+         +     G++  L +LL S+ +N++    G L    C + K+  +  +  G IE LV+  L++ ++E     A    +    +       ++ VR + GL  +V LL    +  L+ A  G I   A+   N    +E  AI +LV LL    ++      +  +  +     R+E+++    GAL  +A+D  NR VIR    I   V LL
Sbjct:  236 IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQAL-GL----HLTDPSQ---------------RLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG-IEALVRTVLRAGDREDITEPAICALRHLTSRHQDAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDIHNRIVIRGLNTIPLFVQLL 602          
BLAST of Armadillo repeat containing 4 vs. Ensembl Cavefish
Match: jupa (junction plakoglobin-like [Source:NCBI gene;Acc:103045821])

HSP 1 Score: 58.151 bits (139), Expect = 5.739e-8
Identity = 112/480 (23.33%), Postives = 199/480 (41.46%), Query Frame = 2
Query: 1976 IQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISH-NPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARR-TVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXX-XXGIIXXXXXXXXXNHVNMLIPIVGTLQE--CASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAAT------IFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVG-----RCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSE 3367
            I  LV+ L    ++    ++  L +L LH E  ++A+R   GL+ ++ LL+    +    +   L+ +S+ N   +  I   GG   +V I+++ N +    +   +  V     + +  +   GG++ L       ++TG +   +Q            C    LW+               G++ +L  LL ++ VNML  + G L    C + ++     +  G +E L+  L  + ++ ++   AT        +  E +  ++ VR + G+  +V LL +     ++ AV G I   A+   N    ++  AI KLV LL +  ++   +    +S    +   R+E+++    GAL  MA+DP +R VI     I   V LL        V+  K V        A +  S  +ID +     L  LL + N  +   AA A+   I   K+A    R  V   EL  SL K +
Sbjct:  217 IPALVRMLSSPMESVLFYAITTLHNLLLHQEGAKMAVRLADGLQRMVPLLKKSNHKFLAITTDCLQLLSYGNQESKLIILANGGPEGLVQIMRNYNYEKLLWTTSRVLKVLSVCPSNKPAIVEAGGMQAL-----GKHVTGSSQRLSQ-----------NC----LWTLRNLSDAATKQDGLDGLLQVLIGLLSTDDVNMLACVTGILSNLTCNNARNKTYVTQNNG-VEALIHALLRAGEKEDVAEPATCALRHLTSRHPEAELAQNAVRTHYGIPAIVKLLNKPYYWPVVKAVVGLIRNLALCPANQAPLRDADAIPKLVNLLINAHQDAQKH--GSASQQTYQDGVRMEEIVEGCTGALHIMARDPMSRGVIADMNTIPLFVQLLYSP-----VDNIKRVAAGVLCELALDKQSAVVIDNEGACAPLMELLHSSNEGIATYAA-AVLFRISEDKNADYKKRVSV---ELTHSLFKHD 664          
BLAST of Armadillo repeat containing 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008159.1 (pep scaffold:Pmarinus_7.0:GL482338:1463:16382:1 gene:ENSPMAG00000007377.1 transcript:ENSPMAT00000008159.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 789.26 bits (2037), Expect = 0.000e+0
Identity = 438/627 (69.86%), Postives = 506/627 (80.70%), Query Frame = 2
Query: 1931 DRRQETS-DMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEK 3808
            DRRQE S D+ SEYWQIQKL+KY+K GN T+T+I+LC +RD  L  E CQLA++DVGGLEVLINLL+TD+++CKIGSLKILKEISHN  IR++I D+GGL TMVNIL    ++LKCL+AETIANVAKFRRARRTVR + GIKKLVGL+DC  +     S AQ    E+DIEVARC ALALWSCSKS+KNK+A++KAG I LL++LLKS H NMLIP+VGTLQECASE SYR+AI+TE MIEDLVKNL S N+EL+MHCA+ IFKCAE+KE RDLVR YGGL PL  LL + +NKELLAAVTGAIWKC+ISQENV   QEL+ IE LV+LL++QPEE                      VL+NVVGALGE  ++P NRA+IRKTGGI PLV LLTGTNQ LL+N T++VG CA +P++M IID  DGVRLLWSLLKN N +VQA+AAWAICPCIEN KDAGEMVRSFVGGLELIV+LLKS+  EVLASVCAAI KIA DEENLAVITDHGVVPLLA LT+TTDD LR  LAEAI+ CC WG+NR  FG   AVAPLV+YLKS D  VHR+TA+ALYQLS  PENC+TMH  GVVK L+ +VGS D  LQ AAA CI+NIR+LALANEK
Sbjct:   19 DRRQEASMDLPSEYWQIQKLIKYIKSGNPTATVIALCCMRDFNLAQETCQLAMKDVGGLEVLINLLDTDDIKCKIGSLKILKEISHNSQIRQSIVDIGGLQTMVNILDSSEKELKCLAAETIANVAKFRRARRTVRKHNGIKKLVGLMDCVPMRSANLSPAQ----EKDIEVARCGALALWSCSKSRKNKQAIRKAGGIPLLARLLKSPHENMLIPVVGTLQECASEASYRLAIQTEKMIEDLVKNLNSDNQELQMHCASAIFKCAEDKETRDLVRQYGGLHPLDILLGKSENKELLAAVTGAIWKCSISQENVAILQELRTIETLVSLLSNQPEE----------------------VLINVVGALGECCQEPANRAIIRKTGGIHPLVQLLTGTNQPLLINVTRAVGACAMDPENMGIIDHLDGVRLLWSLLKNSNSQVQASAAWAICPCIENVKDAGEMVRSFVGGLELIVNLLKSDDNEVLASVCAAISKIAKDEENLAVITDHGVVPLLANLTSTTDDKLRKNLAEAIACCCTWGSNRAAFGDAQAVAPLVRYLKSKDALVHRATAQALYQLSLAPENCITMHSNGVVKPLVAMVGSTDTFLQVAAAGCISNIRQLALANEK 619          
BLAST of Armadillo repeat containing 4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010052.1 (pep scaffold:Pmarinus_7.0:GL486832:2469:9112:1 gene:ENSPMAG00000009094.1 transcript:ENSPMAT00000010052.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.221 bits (391), Expect = 7.739e-42
Identity = 104/322 (32.30%), Postives = 167/322 (51.86%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGPQADS---MFARKDDKIYSDLISLLKQEDEHF 1030
            MG++L+++A+WTS        LE TP+N  +L++I  + EEF   +      +F + + WET L+  D     + I  +    SKD K     L+    +   + +S  + +  +L+A+G   + E++  LE NRDPV+KILG  F+TV GE  +    A  +   G + D    I+K+ +  +           ++    ++AE V ++P+ +  E++LL   SG    KS + SI+ +  Y F   NGCRAPPWRQ+ G+I Y +++      + VT S+ G F+N G + D    ++ RK D IY DLISLLK     F
Sbjct:    1 MGVSLSRAAQWTSDSARGRVTLEPTPMNEVLLNSIANYAEEFGNLHIHEAALEFYEPLQWETLLQPSDFTQ--DYIPSETTVASKDTKHDGQPLLYLSGQ--TVSVSNWNHLSRLLQASGQHKLKEVQSCLEANRDPVTKILGKSFATVEGEGPA----ALHLPEIGEKGDPGTEIKKRLLVLLQQFDLQLLQSCLK----QVAEKVSMSPEAINREVELLQPLSG-DSTKSLIRSIQHISDYVF--SNGCRAPPWRQIEGDICYLMIKPCDTELLSVTCSTVGVFLNGGTEKDGDEIIYERKSD-IYKDLISLLKDRSPKF 306          
BLAST of Armadillo repeat containing 4 vs. Ensembl Sea Lamprey
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 67.3958 bits (163), Expect = 1.743e-11
Identity = 106/444 (23.87%), Postives = 187/444 (42.12%), Query Frame = 2
Query: 1976 IQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISH-NPLIRRAIADLGGLNTMVNILKDPNRD-LKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXX-GIIXXXXXXXXXNHVNMLIPIVGTLQE--CASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMH----CAATIF--KCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLL---NDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAA 3265
            I  LVK L    ++    ++  L +L LH E  ++A+R  GGL+ ++ LL    V+    +   L+ +++ N   +  I   GG   +V I++  N + L   ++  I  ++     +  +   GG++ L   L  P+                     R V  +LW+               G++ +L + L S+ +N++    G L    C + K+  +A +  G IE LVK L  +    ++     CA      +  E +  ++ VR + GL  +V LLQ   +  L+ A  G I   A+   N    +E   +E+LV LL   +   +   M     S  + I    R+E+++    GAL  +A+D  NR VI     I   V LL   N+ +    T  +   A++ ++   I+++    +L  LL + N  V   AA
Sbjct:  236 IPALVKMLSSPVESVVFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVALLNRTNVKFLAITTDCLQILAYGNQESKLIILASGGPAALVQIMRTYNYEKLLWTTSRVIKVLSVCSSNKPAIVEAGGMQALALHLSHPS--------------------QRLVQNSLWTLRNLSDAATKQDNMDGLLQMLVQALDSSDLNVVTCAAGILSNLTCNNYKNKLMACQMGG-IEVLVKTLMQAGDREDITEPAVCALRHLTSRHPEAEMAQNAVRLHYGLPVVVKLLQPPSHWPLIKADVGLIRNLALCPANHAPLREQGVLERLVQLLVRAHQDTQRHTMGTMQQSQPDGI----RMEEIVEGCTGALQILARDAANREVIYSLNVIPVFVQLLYSNNENVQRVATGVLCEMAQDKEAADAIEREGATPVLTELLHSRNEGVATYAA 654          
BLAST of Armadillo repeat containing 4 vs. Ensembl Sea Lamprey
Match: CTNNB1 (catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514])

HSP 1 Score: 58.9214 bits (141), Expect = 7.690e-9
Identity = 108/455 (23.74%), Postives = 188/455 (41.32%), Query Frame = 2
Query: 1976 IQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISH-NPLIRRAIADLGGLNTMVNILKDPNRD-LKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXX-XXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYR--IAIRTEGMIEDLVKN-LKSSNKELEMHCAATIFKCAEEKE-----IRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLL--------------NDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAA 3265
            I  LVK L    ++    ++  L +L LH E  ++A+R  GGL+ ++ LL    V+    +   L+ +++ N   +  I   GG   +V+I++  + + L   ++  +  ++     +  +   GG++ L G+    +LT P+                R +   LW+         +     G++  L +LL SN VN++    G L       +YR  + +   G IE LV+  L++ ++E     A    +    +       ++ VR + GL   V LLQ      L+ AV G I   A+   N    ++  AI +LV LL              N QP+      YVD          R+E+++    GAL  +A+D  NR+VIR    +   V LL    + +       +   A+E ++   I+ +     L  LL + N  V   AA
Sbjct:  235 IPALVKLLSCPVESVLFYAITTLHNLLLHQEGSKMAVRLAGGLQKMVALLNKGNVKFLAITTDCLQLLAYGNQESKLIILASGGPTGLVHIMRTYSYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQAL-GI----HLTSPSQ---------------RLMQNCLWTLRNLSDAATKQENMEGLLQSLVQLLGSNDVNVVTCGAGILSNLTC-NNYRNKMVVCQVGGIEALVQTVLQAGDREDITEPAVCALRHLTSRHPDAELAQNAVRLHYGLPITVKLLQPPSRWPLIKAVVGLIRNLALLPANHSPLRDHGAIPRLVQLLVRAHQDTQRQGVAANGQPQ------YVDGI--------RMEEIVEGCTGALHILARDAHNRSVIRGLNTVPLFVQLLYSNIENIQRVAAGVLCELAQEKEAAETIETEGATAPLTELLHSRNEGVATYAA 654          
BLAST of Armadillo repeat containing 4 vs. Ensembl Yeast
Match: VAC8 (Phosphorylated and palmitoylated vacuolar membrane protein; interacts with Atg13p, required for the cytoplasm-to-vacuole targeting (Cvt) pathway; interacts with Nvj1p to form nucleus-vacuole junctions [Source:SGD;Acc:S000000739])

HSP 1 Score: 61.2326 bits (147), Expect = 7.803e-10
Identity = 68/279 (24.37%), Postives = 133/279 (47.67%), Query Frame = 2
Query: 2999 KVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVI--TDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQQKLLK 3829
            ++ V    ALG +A +  N+ +I + GG+ PL+N + G N  +  N    +   A   D+   I     +  L  L K+ +  VQ NA  A+     + ++  E+V +  G + ++VSLL S   +V      A+  IA+DE N   +  T+  +V  L  L  +    ++CQ   A+    +  + +++  + G +  LVK ++S    +  ++   +  +S  P N   + +AG +K L+ L+   D   +E     ++ +R LA ++EK++++  +
Sbjct:  100 QIQVAACAALGNLAVNNENKLLIVEMGGLEPLINQMMGDNVEVQCNAVGCITNLATRDDNKHKIATSGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENRKELVNA--GAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVRAGGLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVRLLDYKDS--EEIQCHAVSTLRNLAASSEKNRKEFFE 374          

HSP 2 Score: 60.8474 bits (146), Expect = 8.502e-10
Identity = 82/321 (25.55%), Postives = 142/321 (44.24%), Query Frame = 2
Query: 2642 MIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDG--VRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVV-PXXXXXXXXXXXXXXCQLAEAISRCCNWGT----NRIDFGKTGAV 3583
            ++E ++  L+S + ++++   A +   A   E + L+   GGLEPL+  +   DN E+     G I   A   +N  K     A+  L  L               + S  I+ VQR      N  GAL  M     NR  +   G +  LV+LL+ T+  +    T ++   A +  +   + + +   V  L SL+ +P+  V+  A  A+     +     E+VR+  GGL  +V L++S+ I ++ +  A I  I++   N  +I D G + PL+  L     + ++C    A+S   N       NR +F ++GAV
Sbjct:   86 VLEPILILLQSQDPQIQVAACAALGNLAVNNENKLLIVEMGGLEPLINQM-MGDNVEVQCNAVGCITNLATRDDNKHKIATSGALIPLTKL---------------AKSKHIR-VQR------NATGALLNMTHSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVRA--GGLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVRLLDYKDSEEIQCH---AVSTLRNLAASSEKNRKEFFESGAV 378          

HSP 3 Score: 51.9878 bits (123), Expect = 5.844e-7
Identity = 76/298 (25.50%), Postives = 133/298 (44.63%), Query Frame = 2
Query: 2039 ALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQE-NVKKFQELQAIEKLVTLLNDQP 2929
            AL +L ++ EN +L I ++GGLE LIN +  D V  +  ++  +  ++     +  IA  G L  +  + K  +  ++  +   + N+      R+ + + G +  LV LL          S   P     D++     AL+  +  ++ + K A  +  ++S L  L+ S    +       L+  AS+ SY++ I   G +  LVK ++S +  L +   A I   +       L+   G L+PLV LL  +D++E+       +   A S E N K+F E  A+EK   L  D P
Sbjct:  108 ALGNLAVNNEN-KLLIVEMGGLEPLINQMMGDNVEVQCNAVGCITNLATRDDNKHKIATSGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENRKELVNAGAVPVLVSLL----------SSTDP-----DVQYYCTTALSNIAVDEANRKKLAQTEPRLVSKLVSLMDSPSSRVKCQATLALRNLASDTSYQLEIVRAGGLPHLVKLIQSDSIPLVLASVACIRNISIHPLNEGLIVDAGFLKPLVRLLDYKDSEEIQCHAVSTLRNLAASSEKNRKEFFESGAVEKCKELALDSP 389          

HSP 4 Score: 51.6026 bits (122), Expect = 6.875e-7
Identity = 52/192 (27.08%), Postives = 92/192 (47.92%), Query Frame = 2
Query: 3206 VRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANI 3781
            ++ L +L+ + N  +Q +AA A     E  K   ++ R     LE I+ LL+S+  ++  + CAA+G +A++ EN  +I + G +  L       +  ++C     I+       N+     +GA+ PL K  KS    V R+   AL  ++   EN   +  AG V +L+ L+ S D  +Q    + ++NI
Sbjct:   49 LKALTTLVYSDNLNLQRSAALAFAEITE--KYVRQVSREV---LEPILILLQSQDPQIQVAACAALGNLAVNNENKLLIVEMGGLEPLINQMMGDNVEVQCNAVGCITNLATRDDNKHKIATSGALIPLTKLAKSKHIRVQRNATGALLNMTHSEENRKELVNAGAVPVLVSLLSSTDPDVQYYCTTALSNI 235          
BLAST of Armadillo repeat containing 4 vs. Ensembl Nematostella
Match: EDO43886 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXR2])

HSP 1 Score: 804.283 bits (2076), Expect = 0.000e+0
Identity = 437/629 (69.48%), Postives = 515/629 (81.88%), Query Frame = 2
Query: 1931 DRRQET-SDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            DRRQE+ +D+ SEYWQIQKLVKYLKGGNQT+TII+LCA+RD  L  E CQLAIRDVGGLEVLINLLET+E++CKIGSLKILKEIS N LIR+AIADLGGL TMVNI++  N++LKCL+AETIA+VAKFRRARRTVR YGGI+KLV LLDC  L+G +       DI  D+ VAR  ALALWSCSKS KNK+A++KAG I LL++LLKS +  MLIP+VGTLQECASE++YR+AIRTEGM+EDLV NLKS N+EL+ HCA+ IFKCAE+++ R+LVR YGGL+PLV+LL   +NKELLAA TGAIWKC+IS ENV +FQEL+AIE+LV LL DQPEE                      VL+NVVGALGE A+   NR  IRK GGI  LVNLLT TNQALLVN TK+VG CA EPD+M+IID+ DGVRLLWSLLK+ NP VQA+AAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKS   EVLASVCAAI  IA DEENLAVITDHGVVP+LA+L +T +D LR  LAE+I+RCC WG NR+ FGK GAV PLV YLKS  + VHR+TA+ALYQLS+ P+NC++MH++GVV+ L+ +VGS D+ LQEA+A C+ NIR+LALANEK++
Sbjct:  227 DRRQESNADLPSEYWQIQKLVKYLKGGNQTATIIALCAMRDFNLTQETCQLAIRDVGGLEVLINLLETEEIKCKIGSLKILKEISRNTLIRKAIADLGGLQTMVNIVQSMNKELKCLAAETIAHVAKFRRARRTVRQYGGIRKLVSLLDCGLLSGAS-------DI--DVAVARSGALALWSCSKSTKNKKAIRKAGGIPLLARLLKSKNEAMLIPVVGTLQECASEQTYRLAIRTEGMVEDLVNNLKSENQELQRHCASAIFKCAEDEDTRNLVRQYGGLDPLVSLLTNIENKELLAAATGAIWKCSISVENVTRFQELKAIEQLVALLTDQPEE----------------------VLINVVGALGECAQMLANRTAIRKAGGIPSLVNLLTSTNQALLVNVTKAVGACATEPDNMAIIDRLDGVRLLWSLLKSTNPRVQASAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSNDQEVLASVCAAIANIAKDEENLAVITDHGVVPMLAKLASTKEDRLRQYLAESIARCCMWGNNRVAFGKEGAVPPLVGYLKSPSQDVHRATARALYQLSRDPDNCISMHDSGVVQPLMKMVGSQDDVLQEASAGCLKNIRKLALANEKAK 824          

HSP 2 Score: 88.9669 bits (219), Expect = 8.612e-18
Identity = 50/130 (38.46%), Postives = 75/130 (57.69%), Query Frame = 2
Query:  692 VRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGPQADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKE-SYNQT 1078
            VR+NP+ V++E +LL  FSG  +D   L +I     Y+F   NGC APPWRQ+HG+ISY  ++    +  CV AS++G+F+        +    +  +Y  L +LLK++  HF+   +T D KE SY  T
Sbjct:    3 VRLNPEAVQSEYELLKSFSG-SEDTCCLETINWTLDYQF--SNGCHAPPWRQVHGDISYIDIKPLDGDAFCVIASTSGFFITGKDSNGELSYECEGDVYPTLAALLKKKSVHFA---DTIDKKEFSYYGT 126          
BLAST of Armadillo repeat containing 4 vs. Ensembl Nematostella
Match: EDO49017 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHP9])

HSP 1 Score: 440.269 bits (1131), Expect = 4.493e-141
Identity = 261/559 (46.69%), Postives = 378/559 (67.62%), Query Frame = 2
Query: 2141 RCKIGSLKILKEISHNPLIRR-AIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQ 3814
            +CKIGSLKIL+ ++ +    R AI +LGG+  +V+++   +++++ L+A T+AN+A   RAR  +R  GGI+K+V LL+  + +       +  ++  D+EVAR  ALALWSCS S +N+ ++ KAG + LL++L++    ++LIP+VG +QECA E  YR A + E MIE +V+NLK+ N+EL+++CA  IFKCAE+++ R +V  YGGLE LV LL    NK+LLAAVTGAIWKC++S EN K+F EL  +E L+  L D+ EE                  + E+V V++VGAL E+AK    R  I    G   LV+L T  N+ L+    +++  C+++ +     +++DG+RLLWSLLK+ NP+V A+A+W I   +E+  +A E  RSFVGGLELIV++L+S+ IEVL SVCAAIG +A + EN+ VITD+GVV  LA+LT   D  LR  LA+AI+RCC WG N  DF + GAV  +V+YL + D  + RS  +AL+QL++ PE+C+ MH +GVVK L+ +VGS DE LQEAAA C+ NIR+LA+ANEK++
Sbjct:    1 KCKIGSLKILQPLTTSSKYNRNAIINLGGVQLLVDLVTTGSQEVQGLAAATLANIAMASRARNILRRCGGIRKMVNLLNYQDKSWRKQKSQEQKNL--DLEVARSAALALWSCSTSMRNRTSIFKAGSVPLLARLIRLEREDVLIPVVGLVQECAIETRYRTAFKNENMIEPIVQNLKTENQELQIYCANAIFKCAEDEDTRKVVHKYGGLETLVKLLSSHQNKKLLAAVTGAIWKCSVSVENTKRFLELDIVEALLRFLQDEHEE------------------QPEQVQVHIVGALSELAKVQKGRLEILACKGCKTLVDLSTDPNEELVEQVGRAIAACSQDVECRGQFNRRDGLRLLWSLLKSNNPKVIASASWGIHGLMEDTPEAWENARSFVGGLELIVNMLESDDIEVLTSVCAAIGNVANEGENIGVITDYGVVKHLAKLTVLNDIALRRHLAKAIARCCKWGHNARDFTREGAVEAMVEYLSTDDTILKRSAVRALHQLARYPESCIKMHSSGVVKPLMEMVGSEDEALQEAAAGCLLNIRKLAMANEKAR 539          
BLAST of Armadillo repeat containing 4 vs. Ensembl Nematostella
Match: EDO45816 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRS5])

HSP 1 Score: 184.496 bits (467), Expect = 2.860e-47
Identity = 140/472 (29.66%), Postives = 238/472 (50.42%), Query Frame = 2
Query: 1952 DMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVAL-ALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATI-----FKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLY--VDSSSN---------KIKLVQRIEKVLVN-------------------------VVGALGEMAKDPPNRAVIRKTGGITPLVNLLTG---TNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLK 3232
            ++++EYW+I +LVKYL+ GN T TII+LCAL+D  +  E CQL++ D+    VL+NLL TD   C IGSL++L+ +S +  +   +  LGG+  +V+ L+  + +++ L+A T+AN+  F +A   VR   GI+KLV LL  P  T       +    + D    R  A  ALWSCSKS KN  A++ AG + +L+ LL S   ++ +P VG +QEC+++  +R  +R  GMI+++V+ L   +++++  CA+ I      K  + K ++   R Y             D+  L      A+W C+ S +N+   +    +  L +LL     ++ +     +   SN         K  ++Q I ++L++                            A+ + A+D   R ++ K GG+ P+V++L      N  LL     ++ +CAE  DSM  +++   V  L + +K
Sbjct:  466 ELTTEYWEIHRLVKYLRAGNPTVTIIALCALQDFSIEQEGCQLSLLDLRAAPVLLNLLNTDNYSCMIGSLQLLRRLSCSKFVNLELYRLGGVEQLVSCLESSSFEVQSLAAATLANLVSFGKAYSAVRKGRGIRKLVELLK-PGDTKSVKVHTRRYTNDHDHSTLRRNACNALWSCSKSSKNITAIRTAGTVPILASLLTSGKHDLQLPAVGIIQECSNDTVFRGELRKHGMIQEIVQLLIDGSEDMKALCASAIDKVELLKPGDTKSVKVHTRRY---------TNDHDHSTLRRNACNALWSCSKSSKNITAIRTAGTVPILASLLTSGKHDLQLPAVGIIQECSNDTIFRGELRKHGMIQEIVQLLIDGSEDMKALCASAIDKVKAQPSPSTPACLAIDKCAEDEETRELVLKHGGLDPMVDVLATRPCKNAELLAAVAGALWKCAEHGDSMRRLERLGTVNHLITQVK 927          
BLAST of Armadillo repeat containing 4 vs. Ensembl Nematostella
Match: EDO38462 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCU6])

HSP 1 Score: 82.8037 bits (203), Expect = 5.784e-16
Identity = 92/384 (23.96%), Postives = 183/384 (47.66%), Query Frame = 2
Query: 2588 LQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQ------QQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLL-NDQPEEMNM-YLYVDSSS----NKIKLVQ---------------RIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICP-CIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQ 3655
            L   +++ + ++ I  +G +E L+K L S + +++ +   +I    ++   R  +    GL+PL+ALL       QQ   E L+ +T       +  +N    ++L+ +EKLV  + N + E++++  L V S+       ++L+Q               +I  V  +   A+   AK+  NR ++ +      +++LL+     +  +   ++   +E   S  +I K +G+  + +LL N NPEV+ +A+ A+      N  +  EMV    GG+E I+ +L      V A+    +  +A DE   + +  HGVVP L +   +   +++ ++A A++       +R +F   G +  LV+ L+S+++ V RS + A+ Q
Sbjct:  133 LASMSADFTSKVEIFEQGGLEPLIKLLSSPDCDVQKNAVESICLLVQDYHSRSAITELNGLQPLLALLGSEYSIIQQLALESLSQIT-------LDADNRNALRDLEGLEKLVDFIGNKEFEDLHVPALQVLSNCLQDVESMQLIQTSGGLQKLLAFVAESQIPDVQQHAAKAISLAAKNGDNRKILHEQECEKTIISLLSSDVPGVQSSLALALAVMSENLSSRDMIGKLEGIPPIIALLSNENPEVRESASLAVANITTANPTNCNEMVEK--GGIEPIIMMLMDTKPLVQANAAVCLTNLAADESWRSEVQQHGVVPALVQALKSNSTIVQSKVAMAVAAYVCDAESRSEFRTEGGLPRLVELLQSNNDEVRRSASWAVLQ 507          
BLAST of Armadillo repeat containing 4 vs. Ensembl Nematostella
Match: EDO50064 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFA0])

HSP 1 Score: 60.077 bits (144), Expect = 6.258e-9
Identity = 76/339 (22.42%), Postives = 142/339 (41.89%), Query Frame = 2
Query: 2645 IEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLT-GTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIEN-AKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKI-AMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESV-HRSTAKAL 3649
            IE  +KNL SS          +I K  +   +       GGL  ++  LQ   N  ++     A+  C +  E+ K+ + +  I+ +VT+L +          + S+S           +L     AL  +A+D  N  VI + G I  L  LLT  ++     +  +++ +    P+   I+    GV+ +  LLK+    ++      IC   +  +K+  + V+ +  G++ IV+L KS+   +  +   +I  + A  +  + + T+ G+  L           ++ ++ E +  CC    NR    + GA+  L++ L SS   V HR    A 
Sbjct:    8 IELFIKNLDSSTHSTVKKALFSITKLTKRHNLVSTFIENGGLRKIIRFLQTT-NSTIVDMSMSAVANCCMFDESRKEVRNIDGIKPIVTVLKN----------LTSTS-----------ILNRTARALANLAEDEKNAIVIEELGAIEELTKLLTDASDTECQESVLRALLKICTTPERKKIVYNTGGVQTMVKLLKSDKESLKHCCIRTICEFTKFCSKEVAQAVQEY-DGIKHIVALSKSDKPVIQRAAVLSIANLSAHAQVRVCIGTEGGIQELFQLAKLDEPAHIKVKMLEGLCYCCREAVNRNKVFECGALELLMQQLLSSQHHVLHRKIIAAF 323          

HSP 2 Score: 53.1434 bits (126), Expect = 9.021e-7
Identity = 47/216 (21.76%), Postives = 97/216 (44.91%), Query Frame = 2
Query: 2639 GMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGR----CAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAI 3274
            G +  +++ L+++N  +     + +  C    E R  VR+  G++P+V +L+   +  +L     A+   A  ++N    +EL AIE+L  LL D           D+   +            +V+ AL ++   P  + ++  TGG+  +V LL    ++L     +++      C++E      + + DG++ + +L K+  P +Q  A  +I
Sbjct:   47 GGLRKIIRFLQTTNSTIVDMSMSAVANCCMFDESRKEVRNIDGIKPIVTVLKNLTSTSILNRTARALANLAEDEKNAIVIEELGAIEELTKLLTDAS---------DTECQE------------SVLRALLKICTTPERKKIVYNTGGVQTMVKLLKSDKESLKHCCIRTICEFTKFCSKE--VAQAVQEYDGIKHIVALSKSDKPVIQRAAVLSI 239          

HSP 3 Score: 50.8322 bits (120), Expect = 4.175e-6
Identity = 31/100 (31.00%), Postives = 50/100 (50.00%), Query Frame = 2
Query: 2078 LAIRDVGGLEVLINLL-ETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKF--RRARRTVRHYGGIKKLVGL 2368
            + I ++G +E L  LL +  +  C+   L+ L +I   P  ++ + + GG+ TMV +LK     LK     TI    KF  +   + V+ Y GIK +V L
Sbjct:  124 IVIEELGAIEELTKLLTDASDTECQESVLRALLKICTTPERKKIVYNTGGVQTMVKLLKSDKESLKHCCIRTICEFTKFCSKEVAQAVQEYDGIKHIVAL 223          
BLAST of Armadillo repeat containing 4 vs. Ensembl Medaka
Match: armc4 (armadillo repeat containing 4 [Source:NCBI gene;Acc:101161014])

HSP 1 Score: 524.242 bits (1349), Expect = 2.558e-166
Identity = 330/629 (52.46%), Postives = 427/629 (67.89%), Query Frame = 2
Query: 1928 PDRRQETS-DMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKS 3811
            P+ R E+   +SSE+ QI+KLVKYLK G+Q  T++ LC + DL L  ++C LAIRD GGL+ L+NLL+T+E +CKIG+LKIL  +S    I+R++ D+ G+ ++VN L      +K L+AETIANVA F RARRTVR  GGI+KL+ LLDC        SQ + +D   ++E ARC ALALWSCS+S KNK+A+  AG I LL  LL S+  +MLIP+VGTLQECASE+S RI I+++ +I++LVKNL+S+  +L++ C+  +FKCAE+ E RDLVR Y GL+ LV LL   +NKELLAA TGAIWKC+IS ENV  FQ  + +E L  LL  QPEE                      VL+NV GAL E  + P N+AVIRK  GI P++ LL  TNQALLVN TK+VG CA + ++M IID+ DG+ LLWSLL+NPNPEVQA+AAWAICPCI N+KDA   V SF  G   I +LL S   EVLAS+CA I K+A  +  LA +TD G+V LL +LT T DD LR  L++AI  CC +  N   FG+ GAV PLV+Y+KS D  V +S   AL+QLS  P N +TM   G VK L+ ++GS  E++QEAAA C+ NIR  A+   K+
Sbjct:  417 PEHRPESDFYLSSEFLQIKKLVKYLKKGDQKVTLLMLCCMLDLDLTQDSCNLAIRDEGGLQFLLNLLDTNEDKCKIGALKILIRMSRCVPIQRSMEDMLGVRSLVNNLDSEVTKVKALAAETIANVANFPRARRTVRQSGGIEKLIKLLDC-----FLKSQKK-SDHSENMEAARCGALALWSCSRSTKNKKAICSAGGIPLLGCLLTSSLESMLIPVVGTLQECASEESSRITIQSKDIIKNLVKNLRSNCTDLQIQCSMALFKCAEDTETRDLVRKYKGLKLLVELLNNTNNKELLAAATGAIWKCSISIENVLIFQNDKVLESLAGLLTAQPEE----------------------VLINVAGALTEFLQVPANKAVIRKCDGIKPMIQLLLSTNQALLVNVTKAVGACATDRENMKIIDELDGISLLWSLLQNPNPEVQASAAWAICPCIGNSKDAMRTVLSF-QGFGRIPNLLMSTNNEVLASICAVIAKLAKYKNILATLTDLGIVSLLTKLTNTKDDRLRHHLSDAICHCCQFANNTASFGEAGAVEPLVRYMKSEDILVRQSATMALFQLSWDPNNNLTMLSRGAVKRLIPMIGSTLEEVQEAAACCVRNIRMTAMECRKA 1016          

HSP 2 Score: 135.961 bits (341), Expect = 7.810e-32
Identity = 92/323 (28.48%), Postives = 167/323 (51.70%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYAD-EIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNG--PQADSMFARKDDKIYSDLISLLKQEDEHFS 1033
            MG++L+K+A+WT+       KL+++P N  +L  I  F+E+   ++P   DF F+  + W T++ + D+ S   + +        D +      + +    + + +  L  + M+++AA  K + E++  LE NRD + KILG R ++   ED +   YAD E +    + ++ EI  K ++  +     N D R++R +L   ++  + +P  ++ E+D L +F     D+  L S+     ++F   NGCRAPPWRQ  GEI Y ++       + VT  + G F+N G  P+ D    R  + +Y DL++L+K+   +F+
Sbjct:    1 MGVSLSKAAQWTTFSPD-ASKLKSSPTNEALLKEILTFVEQIGSQHPQEADFTFEAPLQWSTTVVTSDLKSDYHIRDSTARSHETDSREAPPPPLLTP---STVRVRSLGQLSMLIQAAEDKKLEEVQACLEGNRDFLVKILGPRIASQLLEDGA---YADVESLKEDVKDEASEI--KARLVAL---LQNTDTRILRKLLRDFSD-AQYDPDFMKVEMDFL-QFCSEGDDR-LLKSVRYTSDFEFW--NGCRAPPWRQAQGEICYVVIESVDTGSLNVTCCTAGVFLNGGGNPEEDGGCIRTSE-MYPDLVTLMKRRSSYFA 305          
BLAST of Armadillo repeat containing 4 vs. Ensembl Medaka
Match: armc4 (armadillo repeat containing 4 [Source:NCBI gene;Acc:101161014])

HSP 1 Score: 466.077 bits (1198), Expect = 5.485e-145
Identity = 305/629 (48.49%), Postives = 391/629 (62.16%), Query Frame = 2
Query: 1928 PDRRQETS-DMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKS 3811
            P+ R E+   +SSE+ QI+KLVKYLK                                                 IG+LKIL  +S    I+R++ D+ G+ ++VN L      +K L+AETIANVA F RARRTVR  GGI+KL+ LLDC        SQ + +D   ++E ARC ALALWSCS+S KNK+A+  AG I LL  LL S+  +MLIP+VGTLQECASE+S RI I+++ +I++LVKNL+S+  +L++ C+  +FKCAE+ E RDLVR Y GL+ LV LL   +NKELLAA TGAIWKC+IS ENV  FQ  + +E L  LL  QPEE                      VL+NV GAL E  + P N+AVIRK  GI P++ LL  TNQALLVN TK+VG CA + ++M IID+ DG+ LLWSLL+NPNPEVQA+AAWAICPCI N+KDA   V SF  G   I +LL S   EVLAS+CA I K+A  +  LA +TD G+V LL +LT T DD LR  L++AI  CC +  N   FG+ GAV PLV+Y+KS D  V +S   AL+QLS  P N +TM   G VK L+ ++GS  E++QEAAA C+ NIR  A+   K+
Sbjct:  417 PEHRPESDFYLSSEFLQIKKLVKYLK-------------------------------------------------IGALKILIRMSRCVPIQRSMEDMLGVRSLVNNLDSEVTKVKALAAETIANVANFPRARRTVRQSGGIEKLIKLLDCF-----LKSQKK-SDHSENMEAARCGALALWSCSRSTKNKKAICSAGGIPLLGCLLTSSLESMLIPVVGTLQECASEESSRITIQSKDIIKNLVKNLRSNCTDLQIQCSMALFKCAEDTETRDLVRKYKGLKLLVELLNNTNNKELLAAATGAIWKCSISIENVLIFQNDKVLESLAGLLTAQPEE----------------------VLINVAGALTEFLQVPANKAVIRKCDGIKPMIQLLLSTNQALLVNVTKAVGACATDRENMKIIDELDGISLLWSLLQNPNPEVQASAAWAICPCIGNSKDAMRTVLSF-QGFGRIPNLLMSTNNEVLASICAVIAKLAKYKNILATLTDLGIVSLLTKLTNTKDDRLRHHLSDAICHCCQFANNTASFGEAGAVEPLVRYMKSEDILVRQSATMALFQLSWDPNNNLTMLSRGAVKRLIPMIGSTLEEVQEAAACCVRNIRMTAMECRKA 967          

HSP 2 Score: 135.576 bits (340), Expect = 9.606e-32
Identity = 92/323 (28.48%), Postives = 167/323 (51.70%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYAD-EIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNG--PQADSMFARKDDKIYSDLISLLKQEDEHFS 1033
            MG++L+K+A+WT+       KL+++P N  +L  I  F+E+   ++P   DF F+  + W T++ + D+ S   + +        D +      + +    + + +  L  + M+++AA  K + E++  LE NRD + KILG R ++   ED +   YAD E +    + ++ EI  K ++  +     N D R++R +L   ++  + +P  ++ E+D L +F     D+  L S+     ++F   NGCRAPPWRQ  GEI Y ++       + VT  + G F+N G  P+ D    R  + +Y DL++L+K+   +F+
Sbjct:    1 MGVSLSKAAQWTTFSPD-ASKLKSSPTNEALLKEILTFVEQIGSQHPQEADFTFEAPLQWSTTVVTSDLKSDYHIRDSTARSHETDSREAPPPPLLTP---STVRVRSLGQLSMLIQAAEDKKLEEVQACLEGNRDFLVKILGPRIASQLLEDGA---YADVESLKEDVKDEASEI--KARLVAL---LQNTDTRILRKLLRDFSD-AQYDPDFMKVEMDFL-QFCSEGDDR-LLKSVRYTSDFEFW--NGCRAPPWRQAQGEICYVVIESVDTGSLNVTCCTAGVFLNGGGNPEEDGGCIRTSE-MYPDLVTLMKRRSSYFA 305          
BLAST of Armadillo repeat containing 4 vs. Ensembl Medaka
Match: ENSORLT00000004536.2 (catenin beta-1 [Source:NCBI gene;Acc:101171502])

HSP 1 Score: 60.8474 bits (146), Expect = 9.812e-9
Identity = 92/387 (23.77%), Postives = 164/387 (42.38%), Query Frame = 2
Query: 1976 IQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISH-NPLIRRAIADLGGLNTMVNILKDPNRD-LKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXX-XXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECA-SEKSYRIAIRTEGMIEDLVKN-LKSSNKELEMHCAATIFKCAEEKE-----IRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLL 3106
            I  LVK L     +    ++  L +L LH E  ++A+R  GGL+ ++ LL    V+    +   L+ +++ N   +  I   GG   +VNI++    + L   ++  +  ++     +  +   GG++ L GL    +LT P+                R V   LW+         +     G++  L +LL S+ +N++    G L     +  S ++ +   G IE LV+  L++ ++E     A    +    +       ++ VR + GL  +V LL    +  L+ A  G I   A+   N    +E  AI +LV LL    ++      +  +  +     R+E+++    GAL  +A+D  NR VIR    I   V LL
Sbjct:  230 IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLSNTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTFTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQAL-GL----HLTDPSQ---------------RLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYSNKLMVCQVGGIEALVRTVLRAGDREDITEPAVCALRHLTSRHQDAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHSALREQGAIPRLVQLLVRAHQDTQRRTSMGGNQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLL 596          
BLAST of Armadillo repeat containing 4 vs. Ensembl Medaka
Match: ctnnb1 (catenin beta 1 [Source:NCBI gene;Acc:101166738])

HSP 1 Score: 60.077 bits (144), Expect = 1.629e-8
Identity = 93/388 (23.97%), Postives = 163/388 (42.01%), Query Frame = 2
Query: 1976 IQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISH-NPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARR-TVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXX-XXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQE--CASEKSYRIAIRTEGMIEDLVKN-LKSSNKELEMHCAATIFKCAEEKE-----IRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLL 3106
            I  LVK L     +    ++  L +L LH E  ++A+R  GGL+ ++ LL    V+    +   L+ +++ N   +  I   GG   +VNI++    +    +   +  V     + +  +   GG++ L GL    +LT P+                R V   LW+         +     G++  L +LL S+ +N++    G L    C + K+  +  +  G IE LV+  L++ ++E     A    +    +       ++ VR + GL  +V LL    +  L+ A  G I   A+   N    +E  AI +LV LL    ++      +  +  +     R+E+++    GAL  +A+D  NR VIR    I   V LL
Sbjct:  237 IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQAL-GL----HLTDPSQ---------------RLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG-IEALVRTVLRAGDREDITEPAICALRHLTSRHQDAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLL 603          
BLAST of Armadillo repeat containing 4 vs. Ensembl Medaka
Match: ctnnb1 (catenin beta 1 [Source:NCBI gene;Acc:101166738])

HSP 1 Score: 60.077 bits (144), Expect = 1.629e-8
Identity = 93/388 (23.97%), Postives = 163/388 (42.01%), Query Frame = 2
Query: 1976 IQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISH-NPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARR-TVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXX-XXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQE--CASEKSYRIAIRTEGMIEDLVKN-LKSSNKELEMHCAATIFKCAEEKE-----IRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLL 3106
            I  LVK L     +    ++  L +L LH E  ++A+R  GGL+ ++ LL    V+    +   L+ +++ N   +  I   GG   +VNI++    +    +   +  V     + +  +   GG++ L GL    +LT P+                R V   LW+         +     G++  L +LL S+ +N++    G L    C + K+  +  +  G IE LV+  L++ ++E     A    +    +       ++ VR + GL  +V LL    +  L+ A  G I   A+   N    +E  AI +LV LL    ++      +  +  +     R+E+++    GAL  +A+D  NR VIR    I   V LL
Sbjct:  237 IPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQAL-GL----HLTDPSQ---------------RLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGG-IEALVRTVLRAGDREDITEPAICALRHLTSRHQDAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLL 603          
BLAST of Armadillo repeat containing 4 vs. Planmine SMEST
Match: SMESG000057827.1 (SMESG000057827.1)

HSP 1 Score: 2240.31 bits (5804), Expect = 0.000e+0
Identity = 1233/1255 (98.25%), Postives = 1233/1255 (98.25%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGPQADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKESYNQTRSDLRLAGDADNDYSRSTADQDSVDGGRNKTVKMKVNQGSKHTWKESQKDKLKVSKKWXXXXXXXXXXXXTTRRLKYYENRKSETRHSNRNSDSLNKSSTVVTSPISNEHQNLEDDHKDVENTXXXXXXXXXXXXXXXXXXXXXXNVANNRGYSESNTKQDXXXXXXXXXXXXXXXXXXXXXXDDEVKLKNTIKSKRESKDVDENAPNFGEWMENNSMRIRRYSEIQETVRERFNNDEYTDLITRLRFQDETRQRKHDKKKLXXXXXXXXXXXXXXXXXXXXAPDRRQETSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQQKLLKITN 3838
            MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGPQADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKESYNQTRSDLRLAGDADNDYSRSTADQDSVDGGRNKTVKMKVNQGSKHTWKESQKDKLKVSKKWEILQINNLNEEETTRRLKYYENRKSETRHSNRNSDSLNKSSTVVTSPISNEHQNLEDDHKDVENTDEKMNIKEEIIEKDKEIQKEIDNVANNRGYSESNTKQDLNVSNNLENEQLNVLNNNLIIQDDEVKLKNTIKSKRESKDVDENAPNFGEWMENNSMRIRRYSEIQETVRERFNNDEYTDLITRLRFQDETRQRKHDKKKLDNRENENMSESSSESEEDEDAPDRRQETSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCSKSKKNKEAMKKAGIISLLSKLLKSNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEE                      VLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPLLARLTTTTDDLLRCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAGVVKLLLGLVGSADEQLQEAAASCIANIRRLALANEKSQQKLLKITN
Sbjct:    1 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGPQADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKESYNQTRSDLRLAGDADNDYSRSTADQDSVDGGRNKTVKMKVNQGSKHTWKESQKDKLKVSKKWEILQINNLNEEETTRRLKYYENRKSETRHSNRNSDSLNKSSTVVTSPISNEHQNLEDDHKDVENTDEKMNIKEEIIEKDKEIQKEIDNVANNRGYSESNTKQDLNVSNNLENEQLNVLNNNLIIQDDEVKLKNTIKSKRESKDVDENAPNFGEWMENNSMRIRRYSEIQETVRERFNNDEYTDLITRLRFQDETRQRKHDKKKLDNRENENMSESSSESEEDEDAPDRRQETSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCSKSKKNKEAMKKAGIISLLSKLLKSNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEE----------------------VLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPLLARLTTTTDDLLRCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAGVVKLLLGLVGSADEQLQEAAASCIANIRRLALANEKSQQKLLKITN 1233          
BLAST of Armadillo repeat containing 4 vs. Planmine SMEST
Match: SMESG000057827.1 (SMESG000057827.1)

HSP 1 Score: 1200.27 bits (3104), Expect = 0.000e+0
Identity = 638/638 (100.00%), Postives = 638/638 (100.00%), Query Frame = 2
Query: 1925 APDRRQETSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQQKLLKITN 3838
            APDRRQETSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCSKSKKNKEAMKKAGIISLLSKLLKSNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPLLARLTTTTDDLLRCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAGVVKLLLGLVGSADEQLQEAAASCIANIRRLALANEKSQQKLLKITN
Sbjct:  455 APDRRQETSDMSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWSCSKSKKNKEAMKKAGIISLLSKLLKSNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPLLARLTTTTDDLLRCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAGVVKLLLGLVGSADEQLQEAAASCIANIRRLALANEKSQQKLLKITN 1092          

HSP 2 Score: 875.159 bits (2260), Expect = 0.000e+0
Identity = 431/432 (99.77%), Postives = 431/432 (99.77%), Query Frame = 2
Query:   74 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGPQADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKESYNQTRSDLRLAGDADNDYSRSTADQDSVDGGRNKTVKMKVNQGSKHTWKESQKDKLKVSKKWXXXXXXXXXXXXTTRRLKYYENRKSETRHSNRNSDSLNK 1369
            MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGPQADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKESYNQTRSDLRLAGDADNDYSRSTADQDSVDGGRNKTVKMKVNQGSKHTWKESQKDKLKVSKKWEILQINNLNEEETTRRLKYYENRKSETRHSNRNSDSL K
Sbjct:    1 MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSIDFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRELNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVSGEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDMLGKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENGCRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGPQADSMFARKDDKIYSDLISLLKQEDEHFSSFINTADLKESYNQTRSDLRLAGDADNDYSRSTADQDSVDGGRNKTVKMKVNQGSKHTWKESQKDKLKVSKKWEILQINNLNEEETTRRLKYYENRKSETRHSNRNSDSLKK 432          
BLAST of Armadillo repeat containing 4 vs. Planmine SMEST
Match: SMESG000044790.1 (SMESG000044790.1)

HSP 1 Score: 407.527 bits (1046), Expect = 6.028e-125
Identity = 263/708 (37.15%), Postives = 435/708 (61.44%), Query Frame = 2
Query: 1736 IRRYSEIQETVRERFNNDEYTDLITRLRFQDETRQRKHDKKKLXXXXXXXXXXXXXXXXXXXXAPDRRQETSD--MSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTG----PANSQAQPADIERD---IEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVD-SSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQQKLLK 3829
             + Y +I + V+ ++N   Y+D++TR++   +   + H  ++     + +      E++  +       + SD  +S  YWQ+ K+++Y++ GN  +T++ LC + +  L +  C  A+ D  G+ +L+NLL  +++RC+IGSLKIL+E++      R +  LGG+  +++ LK  N DL+CL+AET+A +A F+RAR  +R + GI  LV LLD  +         +S  +P+ I+RD     V +  A ALW  SKSK+N+  M++AG+I LL+KLL+ N+ N+LIP++GTLQ+CASE  YRI+IRTEGM+  L+K+L S N  L    A TIFKCA + + R LVR+ GG++ L+  +  + +++LL A+TGAIWKC +   N  +         L+ +L++ P+   +YL    S+S+K+  +++ EK+++NV GAL E++K    R +I+        ++LL   ++ LL NT   +  CA+ PD M  I++ DGV +L+++ K     V A A  A+  C  N +++  +++S VG LEL V+ L+S   +VL++ C+ I +I  D +N+A+++D GVV LL+RL  T +D LR  L+EAI+ C ++  NR  FG+   + P+V +L+SSD  VH S A+AL++LS+ P N   M++AGV  LL+ ++GS ++ LQ AAA  I N+R++ + +EK  Q ++K
Sbjct:  104 FKSYEKIMKKVKRKYNAGYYSDVVTRMKNIHKRLNKHHSSQQTYEDADSSSESEDEEAKHLDFLESIIYQKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAPDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLSATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK--QSMMK 809          
BLAST of Armadillo repeat containing 4 vs. Planmine SMEST
Match: SMESG000023906.1 (SMESG000023906.1)

HSP 1 Score: 404.445 bits (1038), Expect = 8.545e-124
Identity = 263/708 (37.15%), Postives = 434/708 (61.30%), Query Frame = 2
Query: 1736 IRRYSEIQETVRERFNNDEYTDLITRLRFQDETRQRKHDKKKLXXXXXXXXXXXXXXXXXXXXAPDRRQETSD--MSSEYWQIQKLVKYLKGGNQTSTIISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILKEISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRARRTVRHYGGIKKLVGLLDCPNLTG----PANSQAQPADIERD---IEVARCVALALWSCXXXXXXXXXXXXXGIIXXXXXXXXXNHVNMLIPIVGTLQECASEKSYRIAIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLEPLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLNDQPEEMNMYLYVD-SSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRKTGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWSLLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYIEVLASVCAAIGKIAMDEENLAVITDHGVVPXXXXXXXXXXXXXXCQLAEAISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPENCVTMHEAXXXXXXXXXXXSADEQLQEAAASCIANIRRLALANEKSQQKLLK 3829
             + Y +I + V+ ++N   Y+D++TR++   +   + H  ++     + +      E++  +       + SD  +S  YWQ+ K+++Y++ GN  +T++ LC + +  L +  C  A+ D  G+ +L+NLL  +++RC+IGSLKIL+E++      R +  LGG+  +++ LK  N DL+CL+AET+A +A F+RAR  +R + GI  LV LLD  +         +S  +P+ I+RD     V +  A ALW  SKSK+N+  M++AG+I LL+KLL+ N+ N+LIP++GTLQ+CASE  YRI+IRTEGM+  L+K+L S N  L    A TIFKCA + + R LVR+ GG++ L+  +  + +++LL A+TGAIWKC +   N  +         L+ +L++ P+   +YL    S+S+K+  +++ EK+++NV GAL E++K    R +I+        ++LL   ++ LL NT   +  CA+  D M  I++ DGV +L+++ K     V A A  A+  C  N +++  +++S VG LEL V+ L+S   +VLA+ C+ I +I  D +N+A+++D GVV LL+RL  T +D LR  L+EAI+ C ++  NR  FG+   + P+V +L+SSD  VH S A+AL++LS+ P N   M++AGV  LL+ ++GS ++ LQ AAA  I N+R++ + +EK  Q ++K
Sbjct:  104 FKSYEKIMKKVKRKYNAGYYSDVVTRMKNIHKRLNKHHSSQQTYEDADSSSESEDEEAKHLDFLESIIYQKSDVQISPLYWQLTKVLRYIRIGNVHATLLCLCYMNNNKLKSPECMRAMEDSDGIALLLNLLSANDMRCRIGSLKILRELASIIFYCRNVTFLGGIQPLIDNLKHHNFDLQCLAAETLAKLAVFKRARSNIRRFDGISHLVYLLDVDDSIAEKKLSISSTNRPSVIQRDTMQFSVTQNAATALWKVSKSKRNRVCMRRAGVIPLLAKLLRKNNQNILIPVIGTLQQCASELYYRISIRTEGMMPILIKHLNSQNLWLRTQSALTIFKCAVDADTRTLVRNLGGIDVLIMHVDPEGDQKLLYAITGAIWKCCLCPINAVEVNNKNGTNVLLKILDELPKSFQIYLRPQISASHKLNRLEKAEKIMINVTGALYEISKLEEGRKLIKLHNSTEKFISLLQMDDENLLFNTIGVLKECAKAIDCMEEINRLDGVPILFAITKRSATFVVAAALEALKSCFANTENSASLIKSLVGSLELTVNQLESVNEDVLAATCSLIAEIGKDSDNVAILSDFGVVRLLSRLVKTDNDKLRRTLSEAIAVCSDYKDNREQFGRANVITPIVNFLRSSDIHVHVSAARALFKLSQDPNNSHEMNQAGVSHLLINMIGSENKDLQIAAAGAIGNLRKIGIEHEK--QSMMK 809          
The following BLAST results are available for this feature:
BLAST of Armadillo repeat containing 4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARMC42.431e-3668.47armadillo repeat containing 4 [Source:HGNC Symbol;... [more]
ARMC42.431e-3668.47armadillo repeat containing 4 [Source:HGNC Symbol;... [more]
ARMC40.000e+068.47armadillo repeat containing 4 [Source:HGNC Symbol;... [more]
ARMC40.000e+068.37armadillo repeat containing 4 [Source:HGNC Symbol;... [more]
ARMC40.000e+068.30armadillo repeat containing 4 [Source:HGNC Symbol;... [more]
back to top
BLAST of Armadillo repeat containing 4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Armadillo repeat containing 4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
gudu5.336e-16147.15gene:FBgn0031905 transcript:FBtr0079438[more]
back to top
BLAST of Armadillo repeat containing 4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
armc44.676e-2169.16armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB... [more]
armc44.676e-2169.16armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB... [more]
CR847789.16.018e-2269.00armadillo repeat containing 4 [Source:NCBI gene;Ac... [more]
armc42.642e-4874.53armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB... [more]
armc36.358e-1123.57armadillo repeat containing 3 [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Armadillo repeat containing 4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gc4.278e-4971.82group-specific component (vitamin D binding protei... [more]
gc6.085e-4871.82group-specific component (vitamin D binding protei... [more]
gc8.115e-3271.82group-specific component (vitamin D binding protei... [more]
armc34.396e-821.39armadillo repeat containing 3 [Source:NCBI gene;Ac... [more]
armc34.988e-821.37armadillo repeat containing 3 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Armadillo repeat containing 4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Armc45.108e-3568.99armadillo repeat containing 4 [Source:MGI Symbol;A... [more]
Armc45.108e-3568.99armadillo repeat containing 4 [Source:MGI Symbol;A... [more]
Armc48.779e-3875.86armadillo repeat containing 4 [Source:MGI Symbol;A... [more]
Ctnnb11.581e-824.48catenin (cadherin associated protein), beta 1 [Sou... [more]
Ctnnb11.581e-824.48catenin (cadherin associated protein), beta 1 [Sou... [more]
back to top
BLAST of Armadillo repeat containing 4 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|B2RY50|ARMC4_MOUSE3.573e-3468.99Armadillo repeat-containing protein 4 OS=Mus muscu... [more]
sp|Q5T2S8|ARMC4_HUMAN1.167e-3568.47Armadillo repeat-containing protein 4 OS=Homo sapi... [more]
sp|Q9VM21|GUDU_DROME5.349e-16047.15Armadillo repeat-containing protein gudu OS=Drosop... [more]
sp|Q59MN0|VAC8_CANAL1.356e-926.57Vacuolar protein 8 OS=Candida albicans (strain SC5... [more]
sp|Q9WU82|CTNB1_RAT1.589e-824.23Catenin beta-1 OS=Rattus norvegicus OX=10116 GN=Ct... [more]
back to top
BLAST of Armadillo repeat containing 4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|229121585.212e-5474.76tr|A0A4S2M1Z9|A0A4S2M1Z9_OPIFE Uncharacterized pro... [more]
gnl|BL_ORD_ID|229210144.858e-5474.76tr|A0A4S2M213|A0A4S2M213_OPIFE Uncharacterized pro... [more]
gnl|BL_ORD_ID|225408522.103e-2973.70tr|A0A5J4NL79|A0A5J4NL79_9TREM Uncharacterized pro... [more]
gnl|BL_ORD_ID|238432682.888e-5076.37tr|V4CPB6|V4CPB6_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|249824933.935e-5375.08tr|C3YEZ0|C3YEZ0_BRAFL Uncharacterized protein OS=... [more]
back to top
BLAST of Armadillo repeat containing 4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
armc42.619e-2666.30armadillo repeat containing 4 [Source:ZFIN;Acc:ZDB... [more]
ctnnb21.283e-823.97catenin beta-1-like [Source:NCBI gene;Acc:10303457... [more]
ctnnb11.898e-823.97catenin beta 1 [Source:NCBI gene;Acc:103035854][more]
jupa5.739e-823.33junction plakoglobin-like [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Armadillo repeat containing 4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000008159.10.000e+069.86pep scaffold:Pmarinus_7.0:GL482338:1463:16382:1 ge... [more]
ENSPMAT00000010052.17.739e-4232.30pep scaffold:Pmarinus_7.0:GL486832:2469:9112:1 gen... [more]
CTNNB11.743e-1123.87catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
CTNNB17.690e-923.74catenin beta 1 [Source:HGNC Symbol;Acc:HGNC:2514][more]
back to top
BLAST of Armadillo repeat containing 4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
VAC87.803e-1024.37Phosphorylated and palmitoylated vacuolar membrane... [more]
back to top
BLAST of Armadillo repeat containing 4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438868.612e-1869.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490174.493e-14146.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458162.860e-4729.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384625.784e-1623.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO500646.258e-922.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Armadillo repeat containing 4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
armc42.558e-16652.46armadillo repeat containing 4 [Source:NCBI gene;Ac... [more]
armc45.485e-14548.49armadillo repeat containing 4 [Source:NCBI gene;Ac... [more]
ENSORLT00000004536.29.812e-923.77catenin beta-1 [Source:NCBI gene;Acc:101171502][more]
ctnnb11.629e-823.97catenin beta 1 [Source:NCBI gene;Acc:101166738][more]
ctnnb11.629e-823.97catenin beta 1 [Source:NCBI gene;Acc:101166738][more]
back to top
BLAST of Armadillo repeat containing 4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000057827.10.000e+098.25SMESG000057827.1[more]
SMESG000057827.10.000e+0100.00SMESG000057827.1[more]
SMESG000044790.16.028e-12537.15SMESG000044790.1[more]
SMESG000023906.18.545e-12437.15SMESG000023906.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031491 ID=SMED30031491|Name=Armadillo repeat containing 4|organism=Schmidtea mediterranea sexual|type=transcript|length=3959bp
GCAATTTTATCAATTTAATTCATTTAAAATAAAAATTAATTAATAACATC
TAATACAAAATATTTCACAATAAATGGGATTGACGTTAGCAAAATCAGCT
GAATGGACATCAGTGCATGGAGGTTTAGGTGGTAAATTAGAAAATACTCC
TTTAAATTCATTCATACTGGATGCAATTCATAAATTTATTGAAGAATTTT
GTGGTAAGAATCCAGATTCTATTGATTTCCAATTCAAACAAGCAATCTCG
TGGGAAACCTCGTTAAAATCACAAGATATTGGATCCAGCTGTGAATTAAT
AAATGGAAAATTTGTGTGGCTATCCAAAGACAAAAAGTTTCAAGCGATAA
CTCTTGTTCAATCAGACAGAGAACTGAATAAAATTGAAATCAGTTGCCTT
GACTCGATCTGGATGATACTAAAAGCTGCTGGTGGTAAATCGATGAGTGA
GTTAAGAATGATATTAGAAGATAACCGAGATCCAGTAAGCAAAATATTGG
GTGACAGATTTTCCACAGTATCCGGTGAGGATAGTAGCATTTATCGGTAT
GCAGATGAGATTATCAATGCTGGAACCGAAAAAGATTCCCCAGAAATCAT
TGAAAAGAAAAAAGTTTTTAAAATGTCTCTGGAATTTCACAATTTTGACG
TCAGGCTAATGCGTGACATGCTTGGTAAAATTGCTGAAACGGTTCGAGTA
AATCCTAAATTGGTTGAAAATGAGATTGATCTACTCGTCAAATTTTCCGG
ACCCCACAAGGATAAAAGTGCTCTGATTTCAATAGAACCAGTACCAATAT
ATAAATTTATTCATGAAAACGGATGTCGAGCACCACCCTGGAGACAACTG
CATGGCGAAATAAGCTATTTCATTGTGAGATTCCACAGTAAAAATGAGAT
CTGTGTCACGGCTTCATCGACCGGATGGTTTGTCAACAATGGCCCACAAG
CCGATTCGATGTTCGCTAGGAAAGACGATAAAATTTATTCCGACCTCATC
TCGTTATTGAAACAAGAAGATGAGCACTTTTCCAGCTTTATTAACACGGC
CGACCTAAAGGAATCATACAATCAAACGCGATCGGATCTTCGATTAGCCG
GTGATGCTGATAACGATTACTCGAGAAGCACAGCAGATCAAGATTCCGTT
GATGGGGGAAGAAACAAAACCGTTAAAATGAAGGTCAATCAGGGCTCCAA
ACATACTTGGAAAGAATCTCAAAAGGATAAATTGAAAGTCAGCAAGAAGT
GGGAAATCCTACAAATCAATAATCTGAATGAGGAAGAAACGACGAGAAGA
CTCAAATATTACGAAAATCGCAAGAGTGAGACTCGACATTCTAATCGAAA
CTCTGATTCTTTAAATAAATCTAGTACCGTAGTCACAAGTCCTATATCTA
ATGAACATCAAAATTTAGAAGATGATCATAAAGATGTTGAAAATACTGAT
GAGAAAATGAATATCAAAGAAGAGATAATTGAGAAAGACAAAGAGATTCA
GAAAGAAATTGATAATGTTGCTAACAATAGAGGGTATTCTGAGTCGAATA
CGAAACAAGACCTTAATGTTTCCAACAATTTAGAGAATGAGCAATTAAAT
GTGTTAAATAATAATTTAATAATCCAAGATGATGAAGTAAAATTGAAAAA
CACAATAAAATCGAAGAGAGAGTCTAAAGATGTAGATGAAAATGCTCCAA
ATTTTGGTGAATGGATGGAAAATAACTCAATGAGAATAAGGCGATATAGT
GAAATTCAGGAAACCGTCAGGGAGAGATTTAACAATGATGAATATACAGA
TTTGATCACGAGACTTCGATTTCAAGACGAAACTCGTCAAAGAAAGCATG
ACAAAAAGAAACTTGATAATCGAGAAAACGAAAATATGAGTGAAAGTAGT
TCAGAAAGTGAAGAAGATGAAGACGCTCCGGACAGACGCCAGGAAACAAG
TGATATGTCATCTGAGTATTGGCAAATTCAGAAGCTGGTCAAATACCTGA
AGGGAGGAAACCAGACCTCTACTATCATTTCGTTGTGTGCTTTGAGGGAT
TTGCCTTTGCATACTGAGAACTGTCAATTGGCCATTAGAGATGTCGGCGG
GTTGGAGGTTCTCATTAATTTATTGGAAACCGATGAAGTTCGGTGCAAAA
TTGGGTCATTGAAAATCCTCAAGGAAATATCTCATAATCCTCTGATTAGA
CGAGCCATTGCTGACCTAGGTGGTCTCAACACAATGGTTAACATTCTCAA
AGATCCAAATAGGGATCTGAAATGCTTGAGTGCGGAAACAATTGCAAATG
TGGCCAAGTTTCGTCGTGCTAGGCGAACAGTTCGTCATTATGGTGGTATC
AAGAAACTCGTTGGATTATTGGACTGCCCGAATCTCACTGGACCAGCAAA
TAGTCAAGCTCAACCTGCCGACATTGAACGAGATATTGAAGTAGCTCGAT
GTGTTGCTCTTGCTCTCTGGTCTTGTAGCAAATCCAAGAAAAACAAAGAG
GCCATGAAAAAAGCCGGAATCATCTCTTTGCTATCGAAACTGCTGAAATC
GAATCATGTGAATATGTTGATCCCAATCGTTGGTACTTTGCAGGAATGTG
CTTCTGAAAAAAGCTATCGTATTGCAATCAGAACAGAAGGAATGATTGAA
GATTTAGTGAAGAATCTAAAGAGCTCAAATAAAGAATTAGAGATGCATTG
TGCCGCTACAATTTTCAAGTGTGCAGAAGAGAAAGAAATTCGAGATCTTG
TGAGACATTATGGAGGTTTGGAACCGTTAGTCGCTCTCTTACAGCAGCAG
GATAACAAGGAGCTACTGGCTGCTGTCACCGGTGCGATATGGAAGTGTGC
GATTTCTCAGGAAAATGTAAAGAAATTTCAAGAATTGCAGGCAATAGAGA
AACTTGTAACTCTACTCAATGATCAACCGGAAGAAATGAACATGTATCTC
TACGTTGACTCTTCCTCAAATAAGATTAAACTTGTTCAAAGGATTGAAAA
AGTTCTTGTCAATGTGGTTGGAGCGTTAGGTGAAATGGCTAAAGATCCTC
CTAACAGAGCAGTGATTCGAAAAACCGGTGGTATCACACCACTTGTAAAT
TTGCTGACCGGTACAAATCAGGCTCTTCTTGTAAACACTACCAAGTCGGT
TGGAAGGTGTGCTGAAGAACCCGACAGTATGAGTATCATTGATAAACAAG
ATGGGGTGCGTTTATTGTGGTCATTATTGAAGAATCCTAACCCTGAAGTG
CAAGCCAATGCCGCATGGGCTATTTGTCCATGTATTGAAAACGCTAAGGA
TGCCGGGGAAATGGTTCGATCATTTGTCGGAGGATTGGAATTGATTGTGA
GCCTATTGAAATCGGAATATATTGAAGTGCTGGCCTCTGTGTGTGCAGCC
ATCGGGAAGATCGCAATGGATGAAGAGAATCTTGCTGTGATCACTGATCA
CGGAGTGGTGCCTTTATTAGCTCGGCTGACGACAACAACAGATGACCTGT
TGAGATGTCAGTTAGCAGAGGCAATTTCTCGGTGTTGTAATTGGGGGACG
AATAGAATAGATTTCGGCAAAACTGGTGCGGTGGCTCCTTTGGTAAAATA
TTTGAAGTCATCGGATGAATCGGTACATAGGTCGACAGCTAAAGCTCTTT
ATCAACTCAGTAAGCAGCCAGAAAATTGTGTGACAATGCATGAGGCTGGA
GTGGTGAAACTTTTACTTGGACTGGTCGGTTCAGCGGACGAGCAATTGCA
GGAGGCAGCTGCCAGTTGCATTGCAAATATCAGACGGTTGGCGCTCGCCA
ATGAAAAATCTCAACAGAAACTTTTAAAAATTACAAACTGAAATCATTGT
GATTGATTGTCAATTTTCAATAATCATTTTACTCAATAAATAAGTATAGG
GCTTTTCTGATTGGCTTATATATTTTTATTTTTATTATTTTAATTTGATA
ATTGTATAA
back to top

protein sequence of SMED30031491-orf-1

>SMED30031491-orf-1 ID=SMED30031491-orf-1|Name=SMED30031491-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1256bp
MGLTLAKSAEWTSVHGGLGGKLENTPLNSFILDAIHKFIEEFCGKNPDSI
DFQFKQAISWETSLKSQDIGSSCELINGKFVWLSKDKKFQAITLVQSDRE
LNKIEISCLDSIWMILKAAGGKSMSELRMILEDNRDPVSKILGDRFSTVS
GEDSSIYRYADEIINAGTEKDSPEIIEKKKVFKMSLEFHNFDVRLMRDML
GKIAETVRVNPKLVENEIDLLVKFSGPHKDKSALISIEPVPIYKFIHENG
CRAPPWRQLHGEISYFIVRFHSKNEICVTASSTGWFVNNGPQADSMFARK
DDKIYSDLISLLKQEDEHFSSFINTADLKESYNQTRSDLRLAGDADNDYS
RSTADQDSVDGGRNKTVKMKVNQGSKHTWKESQKDKLKVSKKWEILQINN
LNEEETTRRLKYYENRKSETRHSNRNSDSLNKSSTVVTSPISNEHQNLED
DHKDVENTDEKMNIKEEIIEKDKEIQKEIDNVANNRGYSESNTKQDLNVS
NNLENEQLNVLNNNLIIQDDEVKLKNTIKSKRESKDVDENAPNFGEWMEN
NSMRIRRYSEIQETVRERFNNDEYTDLITRLRFQDETRQRKHDKKKLDNR
ENENMSESSSESEEDEDAPDRRQETSDMSSEYWQIQKLVKYLKGGNQTST
IISLCALRDLPLHTENCQLAIRDVGGLEVLINLLETDEVRCKIGSLKILK
EISHNPLIRRAIADLGGLNTMVNILKDPNRDLKCLSAETIANVAKFRRAR
RTVRHYGGIKKLVGLLDCPNLTGPANSQAQPADIERDIEVARCVALALWS
CSKSKKNKEAMKKAGIISLLSKLLKSNHVNMLIPIVGTLQECASEKSYRI
AIRTEGMIEDLVKNLKSSNKELEMHCAATIFKCAEEKEIRDLVRHYGGLE
PLVALLQQQDNKELLAAVTGAIWKCAISQENVKKFQELQAIEKLVTLLND
QPEEMNMYLYVDSSSNKIKLVQRIEKVLVNVVGALGEMAKDPPNRAVIRK
TGGITPLVNLLTGTNQALLVNTTKSVGRCAEEPDSMSIIDKQDGVRLLWS
LLKNPNPEVQANAAWAICPCIENAKDAGEMVRSFVGGLELIVSLLKSEYI
EVLASVCAAIGKIAMDEENLAVITDHGVVPLLARLTTTTDDLLRCQLAEA
ISRCCNWGTNRIDFGKTGAVAPLVKYLKSSDESVHRSTAKALYQLSKQPE
NCVTMHEAGVVKLLLGLVGSADEQLQEAAASCIANIRRLALANEKSQQKL
LKITN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000225Armadillo
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005488binding
Vocabulary: biological process
TermDefinition
GO:0003341cilium movement
GO:0003356regulation of cilium beat frequency
GO:0007368determination of left/right symmetry
GO:0007507heart development
GO:0021591ventricular system development
GO:0030030cell projection organization
GO:0036158outer dynein arm assembly
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005856cytoskeleton
GO:0005929cilium
GO:0005930axoneme
GO:0042995cell projection
GO:0097546ciliary base
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 465..485
NoneNo IPR availableGENE3DG3DSA:1.25.10.110coord: 784..878
e-value: 4.9E-16
score: 60.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 427..444
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 414..451
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 343..365
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 588..607
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 588..629
NoneNo IPR availablePANTHERPTHR46241FAMILY NOT NAMEDcoord: 203..1248
IPR000225ArmadilloSMARTSM00185arm_5coord: 1157..1197
e-value: 10.0
score: 13.2
coord: 705..745
e-value: 16.0
score: 11.7
coord: 1073..1115
e-value: 190.0
score: 3.3
coord: 1198..1238
e-value: 0.15
score: 21.2
coord: 1032..1072
e-value: 270.0
score: 2.1
coord: 746..803
e-value: 26.0
score: 10.0
coord: 1116..1156
e-value: 12.0
score: 12.7
coord: 928..990
e-value: 12.0
score: 12.8
coord: 663..704
e-value: 24.0
score: 10.3
coord: 886..927
e-value: 2.7
score: 17.0
coord: 991..1031
e-value: 19.0
score: 11.0
coord: 804..844
e-value: 2.9
score: 16.9
IPR000225ArmadilloPFAMPF00514Armcoord: 1199..1236
e-value: 6.9E-5
score: 22.7
coord: 888..923
e-value: 1.4E-4
score: 21.8
IPR000225ArmadilloPROSITEPS50176ARM_REPEATcoord: 1086..1128
score: 9.572
IPR000225ArmadilloPROSITEPS50176ARM_REPEATcoord: 1168..1201
score: 9.712
IPR000225ArmadilloPROSITEPS50176ARM_REPEATcoord: 897..922
score: 8.557
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 1159..1252
e-value: 7.0E-16
score: 60.4
coord: 626..783
e-value: 1.4E-22
score: 82.4
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 884..1047
e-value: 8.2E-27
score: 96.2
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 1048..1158
e-value: 1.1E-15
score: 59.1
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 579..953
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 858..1238