SMED30031490

Overview
NameSMED30031490
Smed IDSMED30031490
Length (bp)1147
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30031490 (SMED30031490) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30031490 (SMED30031490) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30031490 (SMED30031490) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30031490 (SMED30031490) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031490

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30031490SMESG000017778.1 SmedASXL_008808SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30031490SMESG000017778.1 dd_Smed_v4_10175_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031490SMESG000017778.1 dd_Smed_v4_10175_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031490SMESG000017778.1 dd_Smed_v4_10175_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031490SMESG000017778.1 dd_Smed_v4_10175_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031490SMESG000017778.1 dd_Smed_v6_10175_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Category 4 cellSMED30031490SMESG000017778.1 dd_Smed_v4_10175_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031490SMESG000017778.1 dd_Smed_v4_10175_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30031490 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002502:2742..12076 +5590
Homology
BLAST of SMED30031490 vs. Ensembl Human
Match: AMN1 (antagonist of mitotic exit network 1 homolog [Source:HGNC Symbol;Acc:HGNC:27281])

HSP 1 Score: 133.265 bits (334), Expect = 5.454e-36
Identity = 72/254 (28.35%), Postives = 136/254 (53.54%), Query Frame = 1
Query:  106 QLQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            ++  L DLC+         ++ D+  LP   K +++ I+  +G+    +I E+ + +V  LDL   D++D  L +   C+ L  L +   +   V++T +G+  +  +   L    L  C  +TDE +++L+ NC  +++I+L GC  I D SL +L ++C  ++ +  + T+VSD G+ +L    C   L+E+ +  C  +TD ++E +  +C  + IL F  C  ITDHSR +L   +    +++KQ+ W++
Sbjct:    6 RVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLV--GPNKLKQVTWTV 257          
BLAST of SMED30031490 vs. Ensembl Human
Match: AMN1 (antagonist of mitotic exit network 1 homolog [Source:HGNC Symbol;Acc:HGNC:27281])

HSP 1 Score: 129.028 bits (323), Expect = 1.715e-34
Identity = 68/235 (28.94%), Postives = 129/235 (54.89%), Query Frame = 1
Query:  163 FIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            ++ D+  LP   K +++ I+  +G+    +I E+ + +V  LDL   D++D  L +   C+ L  L +   +   V++T +G+  +  +   L    L  C  +TDE +++L+ NC  +++I+L GC  I D SL +L ++C  ++ +  + T+VSD G+ +L    C   L+E+ +  C  +TD ++E +  +C  + IL F  C  ITDHSR +L   +    +++KQ+ W++
Sbjct:    7 YLTDIKPLPPNIKDRLIKIMSMQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLV--GPNKLKQVTWTV 239          
BLAST of SMED30031490 vs. Ensembl Human
Match: AMN1 (antagonist of mitotic exit network 1 homolog [Source:HGNC Symbol;Acc:HGNC:27281])

HSP 1 Score: 129.028 bits (323), Expect = 1.715e-34
Identity = 68/235 (28.94%), Postives = 129/235 (54.89%), Query Frame = 1
Query:  163 FIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            ++ D+  LP   K +++ I+  +G+    +I E+ + +V  LDL   D++D  L +   C+ L  L +   +   V++T +G+  +  +   L    L  C  +TDE +++L+ NC  +++I+L GC  I D SL +L ++C  ++ +  + T+VSD G+ +L    C   L+E+ +  C  +TD ++E +  +C  + IL F  C  ITDHSR +L   +    +++KQ+ W++
Sbjct:    7 YLTDIKPLPPNIKDRLIKIMSMQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLV--GPNKLKQVTWTV 239          
BLAST of SMED30031490 vs. Ensembl Human
Match: AMN1 (antagonist of mitotic exit network 1 homolog [Source:HGNC Symbol;Acc:HGNC:27281])

HSP 1 Score: 110.538 bits (275), Expect = 7.812e-28
Identity = 60/210 (28.57%), Postives = 113/210 (53.81%), Query Frame = 1
Query:  163 FIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            ++ D+  LP   K +++ I+  +G+    +I E+ + +V  LDL   D++D  L +   C+ L  L +   +   V++T +G+  +  +   L    L  C  +TDE +++L+ NC  +++I+L GC  I D SL +L ++C  ++ +  + T+VSD G+ +L    C   L+E+ +  C  +TD ++E +  +C  + IL F  C  IT
Sbjct:    7 YLTDIKPLPPNIKDRLIKIMSMQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLIT 216          
BLAST of SMED30031490 vs. Ensembl Human
Match: FBXL2 (F-box and leucine rich repeat protein 2 [Source:HGNC Symbol;Acc:HGNC:13598])

HSP 1 Score: 77.411 bits (189), Expect = 4.000e-15
Identity = 54/165 (32.73%), Postives = 89/165 (53.94%), Query Frame = 1
Query:  307 VTDD-ILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHT-LKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            +TD+ +++  + C  L +L ++   N    +TD  LT +  N   L+++    C ++TD     L+ NC  +E ++L  C LI D +LI L   C  ++AL+++    ++D GI  LS S C H  L+ L+LD C  ITD ++E L   C  L  L   +C+Q+T
Sbjct:  153 ITDEGVVQICRGCHRLQALCLSGCSN----LTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARNCHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSNSTCGHERLRVLELDNCLLITDVALEHLEN-CRGLERLELYDCQQVT 312          

HSP 2 Score: 67.3958 bits (163), Expect = 8.717e-12
Identity = 47/158 (29.75%), Postives = 76/158 (48.10%), Query Frame = 1
Query:  379 NFPVNITDKGLTNILPN-FKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALT-----------VARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            NF  ++  + + NI       LR + L  C  + D S+ + ++NC N+E +NL+GC  I D +  SL   CS +K +             + +R++D G+  + +    H L+ L L GC  +TD S+  L   C  L IL  + C  +TD    +LA
Sbjct:   59 NFQTDVEGRVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHIQNYCHELVSLNLQSCSRITDEGVVQICRG--CHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLA 214          

HSP 3 Score: 67.3958 bits (163), Expect = 9.637e-12
Identity = 41/125 (32.80%), Postives = 72/125 (57.60%), Query Frame = 1
Query:  448 VHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            ++L +C  ITDE ++ +   C  ++ + LSGC+ + D SL +L  +C  ++ L  AR + ++D G   L+++   H L+++ L+ C  ITD+++  LS  C  L  L+ S+C  ITD     L+N
Sbjct:  145 LNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQILEAARCSHLTDAGFTLLARN--CHELEKMDLEECILITDSTLIQLSIHCPKLQALSLSHCELITDDGILHLSN 267          
BLAST of SMED30031490 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 76.2554 bits (186), Expect = 5.663e-15
Identity = 51/136 (37.50%), Postives = 77/136 (56.62%), Query Frame = 1
Query:  394 ITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFL-SRFCIHLNILTFSNCRQITD 795
            +TD  + NI      L  + ++NC  I+D S++SL ++  N++V+ LSGC L+GD   I L   C  ++ L +   + +SD  I SL+ + C   L+EL L  C  ITD SI+ L S+    LN+L   NC Q+TD
Sbjct:  266 LTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLA-NNCT-ALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTD 399          

HSP 2 Score: 62.3882 bits (150), Expect = 1.897e-10
Identity = 43/166 (25.90%), Postives = 85/166 (51.20%), Query Frame = 1
Query:  340 CKNLTSLTIATVRNFPV-----------NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            C  LT +T+  + N               I+D+ L ++  +   L+V+ L+ C  + D   I L+  C  +E +++  C+LI D ++ SL  +C+ ++ L+++    ++D  I +L+ SK   TL  L+LD C  +TD+++  L R C  L  +   +C+ ++  +
Sbjct:  263 CFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLA-SKHRETLNVLELDNCPQLTDSTLSHL-RHCKALKRIDLYDCQNVSKEA 426          

HSP 3 Score: 62.003 bits (149), Expect = 2.503e-10
Identity = 46/177 (25.99%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  277 VNKLDLYG-NDVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            + +L L G  +V D  L  +T  C NL  L++   +     +TD    N+      L  ++L NC  ITD ++  + + CPN+  +N+S C+ I D+ +  ++ +C ++  L +         ++   ++  +  +K+L L  C  +TD +++ ++     L  L  SNC QI+D S
Sbjct:  125 LKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKR----VTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAH-MGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRS 296          

HSP 4 Score: 60.077 bits (144), Expect = 1.191e-9
Identity = 44/161 (27.33%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  340 CKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            CK+L +L +        N+      ++  +   ++ ++L  C  +TD ++ +++     +E + +S CN I D+SL+SL +   N+K L ++  T + D G   L++      L+ L ++ C  I+D++I  L+  C  L  L+ S+C  ITD S   LA+
Sbjct:  226 CKSLDTLILRGCEGLTENV----FGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARG--CRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLAS 380          
BLAST of SMED30031490 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 76.2554 bits (186), Expect = 5.663e-15
Identity = 51/136 (37.50%), Postives = 77/136 (56.62%), Query Frame = 1
Query:  394 ITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFL-SRFCIHLNILTFSNCRQITD 795
            +TD  + NI      L  + ++NC  I+D S++SL ++  N++V+ LSGC L+GD   I L   C  ++ L +   + +SD  I SL+ + C   L+EL L  C  ITD SI+ L S+    LN+L   NC Q+TD
Sbjct:  266 LTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLA-NNCT-ALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTD 399          

HSP 2 Score: 62.3882 bits (150), Expect = 1.897e-10
Identity = 43/166 (25.90%), Postives = 85/166 (51.20%), Query Frame = 1
Query:  340 CKNLTSLTIATVRNFPV-----------NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            C  LT +T+  + N               I+D+ L ++  +   L+V+ L+ C  + D   I L+  C  +E +++  C+LI D ++ SL  +C+ ++ L+++    ++D  I +L+ SK   TL  L+LD C  +TD+++  L R C  L  +   +C+ ++  +
Sbjct:  263 CFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLA-SKHRETLNVLELDNCPQLTDSTLSHL-RHCKALKRIDLYDCQNVSKEA 426          

HSP 3 Score: 62.003 bits (149), Expect = 2.503e-10
Identity = 46/177 (25.99%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  277 VNKLDLYG-NDVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            + +L L G  +V D  L  +T  C NL  L++   +     +TD    N+      L  ++L NC  ITD ++  + + CPN+  +N+S C+ I D+ +  ++ +C ++  L +         ++   ++  +  +K+L L  C  +TD +++ ++     L  L  SNC QI+D S
Sbjct:  125 LKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKR----VTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAH-MGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRS 296          

HSP 4 Score: 60.077 bits (144), Expect = 1.191e-9
Identity = 44/161 (27.33%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  340 CKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            CK+L +L +        N+      ++  +   ++ ++L  C  +TD ++ +++     +E + +S CN I D+SL+SL +   N+K L ++  T + D G   L++      L+ L ++ C  I+D++I  L+  C  L  L+ S+C  ITD S   LA+
Sbjct:  226 CKSLDTLILRGCEGLTENV----FGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARG--CRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLAS 380          
BLAST of SMED30031490 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 76.2554 bits (186), Expect = 5.663e-15
Identity = 51/136 (37.50%), Postives = 77/136 (56.62%), Query Frame = 1
Query:  394 ITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFL-SRFCIHLNILTFSNCRQITD 795
            +TD  + NI      L  + ++NC  I+D S++SL ++  N++V+ LSGC L+GD   I L   C  ++ L +   + +SD  I SL+ + C   L+EL L  C  ITD SI+ L S+    LN+L   NC Q+TD
Sbjct:  266 LTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLA-NNCT-ALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTD 399          

HSP 2 Score: 62.3882 bits (150), Expect = 1.897e-10
Identity = 43/166 (25.90%), Postives = 85/166 (51.20%), Query Frame = 1
Query:  340 CKNLTSLTIATVRNFPV-----------NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            C  LT +T+  + N               I+D+ L ++  +   L+V+ L+ C  + D   I L+  C  +E +++  C+LI D ++ SL  +C+ ++ L+++    ++D  I +L+ SK   TL  L+LD C  +TD+++  L R C  L  +   +C+ ++  +
Sbjct:  263 CFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLA-SKHRETLNVLELDNCPQLTDSTLSHL-RHCKALKRIDLYDCQNVSKEA 426          

HSP 3 Score: 62.003 bits (149), Expect = 2.503e-10
Identity = 46/177 (25.99%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  277 VNKLDLYG-NDVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            + +L L G  +V D  L  +T  C NL  L++   +     +TD    N+      L  ++L NC  ITD ++  + + CPN+  +N+S C+ I D+ +  ++ +C ++  L +         ++   ++  +  +K+L L  C  +TD +++ ++     L  L  SNC QI+D S
Sbjct:  125 LKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKR----VTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAH-MGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRS 296          

HSP 4 Score: 60.077 bits (144), Expect = 1.191e-9
Identity = 44/161 (27.33%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  340 CKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            CK+L +L +        N+      ++  +   ++ ++L  C  +TD ++ +++     +E + +S CN I D+SL+SL +   N+K L ++  T + D G   L++      L+ L ++ C  I+D++I  L+  C  L  L+ S+C  ITD S   LA+
Sbjct:  226 CKSLDTLILRGCEGLTENV----FGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARG--CRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLAS 380          
BLAST of SMED30031490 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 76.2554 bits (186), Expect = 5.663e-15
Identity = 51/136 (37.50%), Postives = 77/136 (56.62%), Query Frame = 1
Query:  394 ITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFL-SRFCIHLNILTFSNCRQITD 795
            +TD  + NI      L  + ++NC  I+D S++SL ++  N++V+ LSGC L+GD   I L   C  ++ L +   + +SD  I SL+ + C   L+EL L  C  ITD SI+ L S+    LN+L   NC Q+TD
Sbjct:  266 LTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLA-NNCT-ALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTD 399          

HSP 2 Score: 62.3882 bits (150), Expect = 1.897e-10
Identity = 43/166 (25.90%), Postives = 85/166 (51.20%), Query Frame = 1
Query:  340 CKNLTSLTIATVRNFPV-----------NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            C  LT +T+  + N               I+D+ L ++  +   L+V+ L+ C  + D   I L+  C  +E +++  C+LI D ++ SL  +C+ ++ L+++    ++D  I +L+ SK   TL  L+LD C  +TD+++  L R C  L  +   +C+ ++  +
Sbjct:  263 CFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLA-SKHRETLNVLELDNCPQLTDSTLSHL-RHCKALKRIDLYDCQNVSKEA 426          

HSP 3 Score: 62.003 bits (149), Expect = 2.503e-10
Identity = 46/177 (25.99%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  277 VNKLDLYG-NDVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            + +L L G  +V D  L  +T  C NL  L++   +     +TD    N+      L  ++L NC  ITD ++  + + CPN+  +N+S C+ I D+ +  ++ +C ++  L +         ++   ++  +  +K+L L  C  +TD +++ ++     L  L  SNC QI+D S
Sbjct:  125 LKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKR----VTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAH-MGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRS 296          

HSP 4 Score: 60.077 bits (144), Expect = 1.191e-9
Identity = 44/161 (27.33%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  340 CKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            CK+L +L +        N+      ++  +   ++ ++L  C  +TD ++ +++     +E + +S CN I D+SL+SL +   N+K L ++  T + D G   L++      L+ L ++ C  I+D++I  L+  C  L  L+ S+C  ITD S   LA+
Sbjct:  226 CKSLDTLILRGCEGLTENV----FGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARG--CRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLAS 380          
BLAST of SMED30031490 vs. Ensembl Celegans
Match: fbxl-1 (Uncharacterized F-box/LRR-repeat protein C02F5.7 [Source:UniProtKB/Swiss-Prot;Acc:P34284])

HSP 1 Score: 75.8702 bits (185), Expect = 8.107e-15
Identity = 51/136 (37.50%), Postives = 77/136 (56.62%), Query Frame = 1
Query:  394 ITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFL-SRFCIHLNILTFSNCRQITD 795
            +TD  + NI      L  + ++NC  I+D S++SL ++  N++V+ LSGC L+GD   I L   C  ++ L +   + +SD  I SL+ + C   L+EL L  C  ITD SI+ L S+    LN+L   NC Q+TD
Sbjct:  266 LTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLA-NNCT-ALRELSLSHCELITDESIQNLASKHRETLNVLELDNCPQLTD 399          

HSP 2 Score: 62.003 bits (149), Expect = 2.641e-10
Identity = 46/177 (25.99%), Postives = 87/177 (49.15%), Query Frame = 1
Query:  277 VNKLDLYG-NDVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            + +L L G  +V D  L  +T  C NL  L++   +     +TD    N+      L  ++L NC  ITD ++  + + CPN+  +N+S C+ I D+ +  ++ +C ++  L +         ++   ++  +  +K+L L  C  +TD +++ ++     L  L  SNC QI+D S
Sbjct:  125 LKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRCKR----VTDASCENLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISWCDAIQDRGVQIILSNCKSLDTLILRGCEGLTENVFGSVEAH-MGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRS 296          

HSP 3 Score: 62.003 bits (149), Expect = 2.837e-10
Identity = 43/166 (25.90%), Postives = 85/166 (51.20%), Query Frame = 1
Query:  340 CKNLTSLTIATVRNFPV-----------NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            C  LT +T+  + N               I+D+ L ++  +   L+V+ L+ C  + D   I L+  C  +E +++  C+LI D ++ SL  +C+ ++ L+++    ++D  I +L+ SK   TL  L+LD C  +TD+++  L R C  L  +   +C+ ++  +
Sbjct:  263 CFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARGCRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLA-SKHRETLNVLELDNCPQLTDSTLSHL-RHCKALKRIDLYDCQNVSKEA 426          

HSP 4 Score: 59.6918 bits (143), Expect = 1.502e-9
Identity = 44/161 (27.33%), Postives = 83/161 (51.55%), Query Frame = 1
Query:  340 CKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            CK+L +L +        N+      ++  +   ++ ++L  C  +TD ++ +++     +E + +S CN I D+SL+SL +   N+K L ++  T + D G   L++      L+ L ++ C  I+D++I  L+  C  L  L+ S+C  ITD S   LA+
Sbjct:  226 CKSLDTLILRGCEGLTENV----FGSVEAHMGAIKKLNLLQCFQLTDITVQNIANGATALEYLCMSNCNQISDRSLVSLGQHSHNLKVLELSGCTLLGDNGFIPLARG--CRQLERLDMEDCSLISDHTINSLANNCTALRELSLSHCELITDESIQNLAS 380          
BLAST of SMED30031490 vs. Ensembl Fly
Match: Fbxl7 (gene:FBgn0038385 transcript:FBtr0083201)

HSP 1 Score: 75.8702 bits (185), Expect = 1.706e-14
Identity = 46/159 (28.93%), Postives = 80/159 (50.31%), Query Frame = 1
Query:  307 VTDDILEY-TKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNC 780
            VTD  L++    C +L  L+++      +NITD GL  +      LR + +  C  ++D  +  ++  C  +  +N  GC  + D S+  L  SC  ++AL + +  VSD G+ +L++S     LK+L L  C  ITD  ++ ++ +C  L  L   +C
Sbjct:  593 VTDAGLKFVPSFCVSLKELSVSDC----LNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIARRCYKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKCDVSDAGLRALAES--CPNLKKLSLRSCDMITDRGVQCIAYYCRGLQQLNIQDC 745          

HSP 2 Score: 54.299 bits (129), Expect = 1.375e-7
Identity = 42/142 (29.58%), Postives = 74/142 (52.11%), Query Frame = 1
Query:  394 ITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            I D GL  ++ N   L  ++L  C  +TD  +  +   C +++ +++S C  I D  L  L +  + ++ L+VA+  RVSD G+  +++ +C + L+ L   GC  ++D+SI  L+R C  L  L    C  ++D     LA
Sbjct:  567 IDDMGLKIVVKNCPQLVYLYLRRCIQVTDAGLKFVPSFCVSLKELSVSDCLNITDFGLYELAKLGAALRYLSVAKCERVSDAGLKVIAR-RC-YKLRYLNARGCEAVSDDSITVLARSCPRLRALDIGKC-DVSDAGLRALA 705          
BLAST of SMED30031490 vs. Ensembl Fly
Match: CG9003 (gene:FBgn0033639 transcript:FBtr0330632)

HSP 1 Score: 67.3958 bits (163), Expect = 6.493e-12
Identity = 45/124 (36.29%), Postives = 70/124 (56.45%), Query Frame = 1
Query:  454 LNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS-RYILAN 819
            L++C+ ITD S  S+S  C  +  INL  C+ I D SL  L + C N+  + V+    +S+ G+ +L++  CV  L++    GC  I DN+I  L+++C  L +L   +C  ITD S R + AN
Sbjct:  125 LSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARG-CV-KLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAAN 246          

HSP 2 Score: 66.6254 bits (161), Expect = 1.154e-11
Identity = 39/130 (30.00%), Postives = 71/130 (54.62%), Query Frame = 1
Query:  436 LLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANF 822
             L+ + L  C+ + D+S+ +L+ +C N+E ++LS C  I D S  S+   CS + A+ +   + ++D  +  LS       L E+ +  CH I++N +E L+R C+ L   +   C+QI D++   LA +
Sbjct:   93 FLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDG--CPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKY 220          

HSP 3 Score: 66.2402 bits (160), Expect = 1.393e-11
Identity = 45/166 (27.11%), Postives = 77/166 (46.39%), Query Frame = 1
Query:  301 NDVTDDILEY-TKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            +++TD+ L+Y +  C NL  + ++        I++ G+  +      LR      C+ I D +I+ L++ CP++ V+NL  C  I D S+  L  +C  ++ L V++                 H L  L++ GC   TD   + L R C +L  +    C QITD
Sbjct:  155 SNITDNSLKYLSDGCPNLMEINVSWCHL----ISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQH-NHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITD 315          

HSP 4 Score: 57.3806 bits (137), Expect = 1.059e-8
Identity = 39/121 (32.23%), Postives = 63/121 (52.07%), Query Frame = 1
Query:  436 LLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKC-VHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            LL  + ++ CR  TD    +L  NC  +E ++L  C+ I D +L  L   C +++ LT++    ++D GI  L+   C    L  L+LD C  ITD ++E L   C +L  +   +C+ IT
Sbjct:  275 LLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTLEHLVS-CHNLQRIELFDCQLIT 394          
BLAST of SMED30031490 vs. Ensembl Fly
Match: CG9003 (gene:FBgn0033639 transcript:FBtr0113069)

HSP 1 Score: 67.0106 bits (162), Expect = 7.049e-12
Identity = 45/124 (36.29%), Postives = 70/124 (56.45%), Query Frame = 1
Query:  454 LNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS-RYILAN 819
            L++C+ ITD S  S+S  C  +  INL  C+ I D SL  L + C N+  + V+    +S+ G+ +L++  CV  L++    GC  I DN+I  L+++C  L +L   +C  ITD S R + AN
Sbjct:  125 LSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARG-CV-KLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAAN 246          

HSP 2 Score: 66.2402 bits (160), Expect = 1.253e-11
Identity = 39/130 (30.00%), Postives = 71/130 (54.62%), Query Frame = 1
Query:  436 LLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANF 822
             L+ + L  C+ + D+S+ +L+ +C N+E ++LS C  I D S  S+   CS + A+ +   + ++D  +  LS       L E+ +  CH I++N +E L+R C+ L   +   C+QI D++   LA +
Sbjct:   93 FLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDG--CPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKY 220          

HSP 3 Score: 66.2402 bits (160), Expect = 1.409e-11
Identity = 45/166 (27.11%), Postives = 77/166 (46.39%), Query Frame = 1
Query:  301 NDVTDDILEY-TKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            +++TD+ L+Y +  C NL  + ++        I++ G+  +      LR      C+ I D +I+ L++ CP++ V+NL  C  I D S+  L  +C  ++ L V++                 H L  L++ GC   TD   + L R C +L  +    C QITD
Sbjct:  155 SNITDNSLKYLSDGCPNLMEINVSWCHL----ISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQH-NHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITD 315          

HSP 4 Score: 56.9954 bits (136), Expect = 1.214e-8
Identity = 39/121 (32.23%), Postives = 63/121 (52.07%), Query Frame = 1
Query:  436 LLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKC-VHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            LL  + ++ CR  TD    +L  NC  +E ++L  C+ I D +L  L   C +++ LT++    ++D GI  L+   C    L  L+LD C  ITD ++E L   C +L  +   +C+ IT
Sbjct:  275 LLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTLEHLVS-CHNLQRIELFDCQLIT 394          
BLAST of SMED30031490 vs. Ensembl Fly
Match: CG9003 (gene:FBgn0033639 transcript:FBtr0330634)

HSP 1 Score: 67.0106 bits (162), Expect = 7.049e-12
Identity = 45/124 (36.29%), Postives = 70/124 (56.45%), Query Frame = 1
Query:  454 LNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS-RYILAN 819
            L++C+ ITD S  S+S  C  +  INL  C+ I D SL  L + C N+  + V+    +S+ G+ +L++  CV  L++    GC  I DN+I  L+++C  L +L   +C  ITD S R + AN
Sbjct:  125 LSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARG-CV-KLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAAN 246          

HSP 2 Score: 66.2402 bits (160), Expect = 1.253e-11
Identity = 39/130 (30.00%), Postives = 71/130 (54.62%), Query Frame = 1
Query:  436 LLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANF 822
             L+ + L  C+ + D+S+ +L+ +C N+E ++LS C  I D S  S+   CS + A+ +   + ++D  +  LS       L E+ +  CH I++N +E L+R C+ L   +   C+QI D++   LA +
Sbjct:   93 FLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDG--CPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKY 220          

HSP 3 Score: 66.2402 bits (160), Expect = 1.409e-11
Identity = 45/166 (27.11%), Postives = 77/166 (46.39%), Query Frame = 1
Query:  301 NDVTDDILEY-TKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            +++TD+ L+Y +  C NL  + ++        I++ G+  +      LR      C+ I D +I+ L++ CP++ V+NL  C  I D S+  L  +C  ++ L V++                 H L  L++ GC   TD   + L R C +L  +    C QITD
Sbjct:  155 SNITDNSLKYLSDGCPNLMEINVSWCHL----ISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQH-NHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITD 315          

HSP 4 Score: 56.9954 bits (136), Expect = 1.214e-8
Identity = 39/121 (32.23%), Postives = 63/121 (52.07%), Query Frame = 1
Query:  436 LLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKC-VHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            LL  + ++ CR  TD    +L  NC  +E ++L  C+ I D +L  L   C +++ LT++    ++D GI  L+   C    L  L+LD C  ITD ++E L   C +L  +   +C+ IT
Sbjct:  275 LLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTLEHLVS-CHNLQRIELFDCQLIT 394          
BLAST of SMED30031490 vs. Ensembl Fly
Match: CG9003 (gene:FBgn0033639 transcript:FBtr0088088)

HSP 1 Score: 67.0106 bits (162), Expect = 7.116e-12
Identity = 45/124 (36.29%), Postives = 70/124 (56.45%), Query Frame = 1
Query:  454 LNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS-RYILAN 819
            L++C+ ITD S  S+S  C  +  INL  C+ I D SL  L + C N+  + V+    +S+ G+ +L++  CV  L++    GC  I DN+I  L+++C  L +L   +C  ITD S R + AN
Sbjct:  152 LSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDGCPNLMEINVSWCHLISENGVEALARG-CV-KLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAAN 273          

HSP 2 Score: 66.6254 bits (161), Expect = 1.105e-11
Identity = 39/130 (30.00%), Postives = 71/130 (54.62%), Query Frame = 1
Query:  436 LLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANF 822
             L+ + L  C+ + D+S+ +L+ +C N+E ++LS C  I D S  S+   CS + A+ +   + ++D  +  LS       L E+ +  CH I++N +E L+R C+ L   +   C+QI D++   LA +
Sbjct:  120 FLKSLSLRGCQSVGDQSVRTLANHCHNIEHLDLSDCKKITDISTQSISRYCSKLTAINLHSCSNITDNSLKYLSDG--CPNLMEINVSWCHLISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKY 247          

HSP 3 Score: 66.2402 bits (160), Expect = 1.525e-11
Identity = 45/166 (27.11%), Postives = 77/166 (46.39%), Query Frame = 1
Query:  301 NDVTDDILEY-TKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            +++TD+ L+Y +  C NL  + ++        I++ G+  +      LR      C+ I D +I+ L++ CP++ V+NL  C  I D S+  L  +C  ++ L V++                 H L  L++ GC   TD   + L R C +L  +    C QITD
Sbjct:  182 SNITDNSLKYLSDGCPNLMEINVSWCHL----ISENGVEALARGCVKLRKFSSKGCKQINDNAIMCLAKYCPDLMVLNLHSCETITDSSIRQLAANCHKLQKLCVSKCADLTDLTLLSLSQH-NHLLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITD 342          

HSP 4 Score: 57.3806 bits (137), Expect = 1.144e-8
Identity = 39/121 (32.23%), Postives = 63/121 (52.07%), Query Frame = 1
Query:  436 LLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKC-VHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            LL  + ++ CR  TD    +L  NC  +E ++L  C+ I D +L  L   C +++ LT++    ++D GI  L+   C    L  L+LD C  ITD ++E L   C +L  +   +C+ IT
Sbjct:  302 LLNTLEVSGCRNFTDIGFQALGRNCKYLERMDLEECSQITDLTLAHLATGCPSLEKLTLSHCELITDDGIRHLTTGSCAAEILSVLELDNCPLITDRTLEHLVS-CHNLQRIELFDCQLIT 421          
BLAST of SMED30031490 vs. Ensembl Zebrafish
Match: amn1 (antagonist of mitotic exit network 1 homolog (S. cerevisiae) [Source:NCBI gene;Acc:751744])

HSP 1 Score: 120.939 bits (302), Expect = 1.362e-31
Identity = 76/254 (29.92%), Postives = 131/254 (51.57%), Query Frame = 1
Query:  109 LQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVR-NFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            + +L  LC   V+     + ED+  LP   K ++L I+   G     +I +L ++  + LDL    ++D  L      K + SL + T+       IT +GL  + P    L+VV L  C  +TD  I +L+ +C  +EVI+L GC+ + DK+L+ L  +C  + ++  + T V+D G+  L+   C  +LKELQ+  C  +TD ++  +   C ++ I  F  C  ITD SR  L N +    ++++Q+ W++
Sbjct:    4 IDSLMSLCAFSVAQRAEKY-EDIRMLPASVKDRLLRIMTSYGTVTDSNISQLVHSGTHTLDLQNCKISDSAL------KQINSLHLRTILLRGCAEITSEGLEVLAPRCPYLQVVDLTGCTAVTDSGIQALARHCKCLEVISLRGCSALSDKALLELGGNCKMLHSIYFSGTEVTDQGVIGLATGVCSCSLKELQMVRCRNLTDLAVTAVLTNCANIRIFNFHGCPLITDKSREALQNLI--GPNKIQQVSWTV 248          
BLAST of SMED30031490 vs. Ensembl Zebrafish
Match: amn1 (antagonist of mitotic exit network 1 homolog (S. cerevisiae) [Source:NCBI gene;Acc:751744])

HSP 1 Score: 120.939 bits (302), Expect = 1.362e-31
Identity = 76/254 (29.92%), Postives = 131/254 (51.57%), Query Frame = 1
Query:  109 LQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVR-NFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            + +L  LC   V+     + ED+  LP   K ++L I+   G     +I +L ++  + LDL    ++D  L      K + SL + T+       IT +GL  + P    L+VV L  C  +TD  I +L+ +C  +EVI+L GC+ + DK+L+ L  +C  + ++  + T V+D G+  L+   C  +LKELQ+  C  +TD ++  +   C ++ I  F  C  ITD SR  L N +    ++++Q+ W++
Sbjct:    4 IDSLMSLCAFSVAQRAEKY-EDIRMLPASVKDRLLRIMTSYGTVTDSNISQLVHSGTHTLDLQNCKISDSAL------KQINSLHLRTILLRGCAEITSEGLEVLAPRCPYLQVVDLTGCTAVTDSGIQALARHCKCLEVISLRGCSALSDKALLELGGNCKMLHSIYFSGTEVTDQGVIGLATGVCSCSLKELQMVRCRNLTDLAVTAVLTNCANIRIFNFHGCPLITDKSREALQNLI--GPNKIQQVSWTV 248          
BLAST of SMED30031490 vs. Ensembl Zebrafish
Match: amn1 (antagonist of mitotic exit network 1 homolog (S. cerevisiae) [Source:NCBI gene;Acc:751744])

HSP 1 Score: 88.5817 bits (218), Expect = 3.830e-20
Identity = 57/192 (29.69%), Postives = 97/192 (50.52%), Query Frame = 1
Query:  109 LQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVR-NFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLK 681
            + +L  LC   V+     + ED+  LP   K ++L I+   G     +I +L ++  + LDL    ++D  L      K + SL + T+       IT +GL  + P    L+VV L  C  +TD  I +L+ +C  +EVI+L GC+ + DK+L+ L  +C  + ++  + T V+D G+  L+   C  +LK
Sbjct:    4 IDSLMSLCAFSVAQRAEKY-EDIRMLPASVKDRLLRIMTSYGTVTDSNISQLVHSGTHTLDLQNCKISDSAL------KQINSLHLRTILLRGCAEITSEGLEVLAPRCPYLQVVDLTGCTAVTDSGIQALARHCKCLEVISLRGCSALSDKALLELGGNCKMLHSIYFSGTEVTDQGVIGLATGVCSCSLK 188          
BLAST of SMED30031490 vs. Ensembl Zebrafish
Match: fbxl20 (F-box and leucine-rich repeat protein 20 [Source:ZFIN;Acc:ZDB-GENE-081031-27])

HSP 1 Score: 77.0258 bits (188), Expect = 5.692e-15
Identity = 52/169 (30.77%), Postives = 91/169 (53.85%), Query Frame = 1
Query:  295 YGNDVT-DDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            + + VT D I    + C  L  L +         + D+ L +I  +   L  ++L  C  ITDE +I++   C  ++ + +SGC  I D  L +L ++C  ++ L VAR ++++D+G  SL+++   H L+++ L+ C  ITD ++  LS  C  L +L+ S+C  ITD
Sbjct:  178 WCDQVTKDGIQALVRCCPGLKGLFLKGC----TQLEDEALKHIGGHCPELVTLNLQTCSQITDEGLITICRGCHRLQSLCVSGCANITDAILNALGQNCPRLRILEVARCSQLTDVGFTSLARN--CHELEKMDLEECVQITDATLIQLSIHCPRLQVLSLSHCELITD 340          

HSP 2 Score: 68.9366 bits (167), Expect = 2.718e-12
Identity = 59/217 (27.19%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  184 LPNRAKVKI---LDI--LCKRGKANKK-SIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPV----NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVART-RVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            LP    ++I   LD+  LC+  + ++  ++  L  +   ++DL+  D   DI    +V +N++      +R   +     + D  L     N + + ++ LN C  ITD +  SLS+ CP ++ ++L+ C  I + SL +L E C  ++ L ++   +V+  GI +L   +C   LK L L GC  + D +++ +   C  L  L    C QITD  
Sbjct:   28 LPKELLLRIFSFLDVVTLCRCAQVSRSWNVLALDGSNWQRIDLF--DFQRDI--EGRVVENISKRCGGFLRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCNSLSKFCPKLKHLDLASCTSITNLSLKALSEGCPLLEQLNISWCDQVTKDGIQAL--VRCCPGLKGLFLKGCTQLEDEALKHIGGHCPELVTLNLQTCSQITDEG 238          

HSP 3 Score: 63.1586 bits (152), Expect = 1.565e-10
Identity = 52/165 (31.52%), Postives = 77/165 (46.67%), Query Frame = 1
Query:  304 DVTDDIL-EYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVH-TLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            ++TD IL    + C  L  L +A        +TD G T++  N   L  + L  C  ITD ++I LS +CP ++V++LS C LI                         +D GI  L    C H  L+ ++LD C  ITD S+E L + C  L+ +   +C+QIT
Sbjct:  259 NITDAILNALGQNCPRLRILEVARCSQ----LTDVGFTSLARNCHELEKMDLEECVQITDATLIQLSIHCPRLQVLSLSHCELI-------------------------TDDGIRQLGSGPCAHDRLEVIELDNCPLITDASLEHL-KSCHSLDRIELYDCQQIT 393          
BLAST of SMED30031490 vs. Ensembl Zebrafish
Match: fbxl2 (F-box and leucine-rich repeat protein 2 [Source:ZFIN;Acc:ZDB-GENE-030925-12])

HSP 1 Score: 75.485 bits (184), Expect = 1.517e-14
Identity = 49/169 (28.99%), Postives = 91/169 (53.85%), Query Frame = 1
Query:  295 YGNDVTDDILEY-TKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            + + +T D +E  ++ C  L +L +         + D  L ++  +   L  +++ +C  ITD+  +SL   C  ++++ +SGC+ I D SL +L  +C  +K L  AR + V+D G   L+++   H ++++ L+ C  +TDN++  LS  C  L  L+ S+C  ITD
Sbjct:  174 WCDQITSDGIEALSRGCTALRALFLRGC----TQLDDTALKHLQKHCPELMTINMQSCTQITDDGFVSLCRGCHKLQMVCISGCSNITDASLTALGLNCQRLKILEAARCSHVTDAGFTVLARN--CHEMEKMDLEECILVTDNTLVQLSIHCPRLQALSLSHCELITD 336          

HSP 2 Score: 74.3294 bits (181), Expect = 4.056e-14
Identity = 50/164 (30.49%), Postives = 87/164 (53.05%), Query Frame = 1
Query:  307 VTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHT-LKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            +TDD   +  +C+    L +  +     NITD  LT +  N + L+++    C ++TD     L+ NC  ME ++L  C L+ D +L+ L   C  ++AL+++    ++D GI  LS S C    L+ ++LD C  ITD ++E L + C  L  +   +C+Q++
Sbjct:  230 ITDD--GFVSLCRGCHKLQMVCISGCS-NITDASLTALGLNCQRLKILEAARCSHVTDAGFTVLARNCHEMEKMDLEECILVTDNTLVQLSIHCPRLQALSLSHCELITDDGIRHLSSSVCGQERLQVVELDNCPLITDITLEHL-KNCQRLERIELYDCQQVS 389          

HSP 3 Score: 69.707 bits (169), Expect = 1.270e-12
Identity = 59/211 (27.96%), Postives = 102/211 (48.34%), Query Frame = 1
Query:  232 GKANKKSIKELANNQVNKLDLYG-NDVTDDI-LEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQM 855
            G A+ K+  +   N +  L+L G   +TD   +  +K C  L  L + +     V+IT+  L  +    ++L  ++L+ C  IT + I +LS  C  +  + L GC  + D +L  L + C  +  + +   T+++D G  SL +    H L+ + + GC  ITD S+  L   C  L IL  + C  +TD    +LA    R+  +M++M
Sbjct:  101 GDASMKTFAQNCRN-IEHLNLNGCTKITDSTCISLSKFCFKLRHLDLTSC----VSITNHALKALSEGCRMLENLNLSWCDQITSDGIEALSRGCTALRALFLRGCTQLDDTALKHLQKHCPELMTINMQSCTQITDDGFVSLCRG--CHKLQMVCISGCSNITDASLTALGLNCQRLKILEAARCSHVTDAGFTVLA----RNCHEMEKM 300          

HSP 4 Score: 65.855 bits (159), Expect = 2.397e-11
Identity = 45/141 (31.91%), Postives = 71/141 (50.35%), Query Frame = 1
Query:  379 NFPVNITDKGLTNILPN-FKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            NF  +I  + + NI       LR + L  C  + D S+ + ++NC N+E +NL+GC  I D + ISL + C  ++ L +     +++  + +LS+      L+ L L  C  IT + IE LSR C  L  L    C Q+ D
Sbjct:   68 NFQTDIEGRVVENISKRCGGFLRQLSLRGCLSVGDASMKTFAQNCRNIEHLNLNGCTKITDSTCISLSKFCFKLRHLDLTSCVSITNHALKALSEG--CRMLENLNLSWCDQITSDGIEALSRGCTALRALFLRGCTQLDD 206          

HSP 5 Score: 56.6102 bits (135), Expect = 2.512e-8
Identity = 33/138 (23.91%), Postives = 64/138 (46.38%), Query Frame = 1
Query:  391 NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
             IT  G+  +      LR + L  C  + D ++  L ++CP +  IN+  C  I D   +SL   C  ++ + ++  + ++D  + +L  +     LK L+   C ++TD     L+R C  +  +    C  +TD++
Sbjct:  177 QITSDGIEALSRGCTALRALFLRGCTQLDDTALKHLQKHCPELMTINMQSCTQITDDGFVSLCRGCHKLQMVCISGCSNITDASLTALGLN--CQRLKILEAARCSHVTDAGFTVLARNCHEMEKMDLEECILVTDNT 312          
BLAST of SMED30031490 vs. Ensembl Xenopus
Match: adcy3 (adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-1007339])

HSP 1 Score: 73.559 bits (179), Expect = 9.668e-14
Identity = 57/194 (29.38%), Postives = 101/194 (52.06%), Query Frame = 1
Query:  247 KSIKELANNQVNKLDLYGND--VTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            K+I E    Q+ +L++   D    D I    K C  L  L++         + D+ L  I  +   L  ++L  C  ITD+ +I++   C  ++ +  SGC+ I D  L +L ++C  ++ L VAR ++++D+G  +L+++   H L+++ L+ C  ITD+++  LS  C  L +L+ S+C  ITD     L N
Sbjct:  149 KAISE-GCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGC----TQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRGCHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKN--CHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGN 335          

HSP 2 Score: 68.5514 bits (166), Expect = 4.233e-12
Identity = 58/219 (26.48%), Postives = 101/219 (46.12%), Query Frame = 1
Query:  247 KSIKELANNQVNKLDLYGN-DVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTV---------------------------ARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            ++I +     + KL L G   V D+ L  + + C+N+  L +    N    ITD   T++      LR + L +C  IT+ S+ ++SE CP +E +N+S C+ I    + +LV+ C  ++ L++                           A ++++D G+ ++ +    H L+ L   GC  ITD+ +  L + C  L IL  + C Q+TD     LA
Sbjct:   70 ENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNL----NGCTKITDATSTSLSKFCSKLRQLDLASCTSITNLSLKAISEGCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRG--CHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLA 282          

HSP 3 Score: 62.003 bits (149), Expect = 6.162e-10
Identity = 51/166 (30.72%), Postives = 76/166 (45.78%), Query Frame = 1
Query:  301 NDVTDDIL-EYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVH-TLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            +++TD IL    + C  L  L +A        +TD G T +  N   L  + L  C  ITD ++I LS +CP ++V++LS C LI                         +D GI  L    C H  L+ ++LD C  ITD S+E L + C  L  +   +C+QI+
Sbjct:  245 SNITDSILNALGQNCPRLRILEVARCSQ----LTDLGFTTLAKNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELI-------------------------TDDGIRHLGNGACAHDRLEVIELDNCPLITDASLEHL-KSCQSLERIELYDCQQIS 380          
BLAST of SMED30031490 vs. Ensembl Xenopus
Match: adcy3 (adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-1007339])

HSP 1 Score: 73.559 bits (179), Expect = 1.024e-13
Identity = 57/194 (29.38%), Postives = 101/194 (52.06%), Query Frame = 1
Query:  247 KSIKELANNQVNKLDLYGND--VTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            K+I E    Q+ +L++   D    D I    K C  L  L++         + D+ L  I  +   L  ++L  C  ITD+ +I++   C  ++ +  SGC+ I D  L +L ++C  ++ L VAR ++++D+G  +L+++   H L+++ L+ C  ITD+++  LS  C  L +L+ S+C  ITD     L N
Sbjct:  133 KAISE-GCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGC----TQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRGCHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKN--CHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGN 319          

HSP 2 Score: 68.5514 bits (166), Expect = 4.604e-12
Identity = 58/219 (26.48%), Postives = 101/219 (46.12%), Query Frame = 1
Query:  247 KSIKELANNQVNKLDLYGN-DVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTV---------------------------ARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            ++I +     + KL L G   V D+ L  + + C+N+  L +    N    ITD   T++      LR + L +C  IT+ S+ ++SE CP +E +N+S C+ I    + +LV+ C  ++ L++                           A ++++D G+ ++ +    H L+ L   GC  ITD+ +  L + C  L IL  + C Q+TD     LA
Sbjct:   54 ENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNL----NGCTKITDATSTSLSKFCSKLRQLDLASCTSITNLSLKAISEGCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRG--CHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLA 266          

HSP 3 Score: 61.6178 bits (148), Expect = 7.264e-10
Identity = 51/166 (30.72%), Postives = 76/166 (45.78%), Query Frame = 1
Query:  301 NDVTDDIL-EYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVH-TLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            +++TD IL    + C  L  L +A        +TD G T +  N   L  + L  C  ITD ++I LS +CP ++V++LS C LI                         +D GI  L    C H  L+ ++LD C  ITD S+E L + C  L  +   +C+QI+
Sbjct:  229 SNITDSILNALGQNCPRLRILEVARCSQ----LTDLGFTTLAKNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELI-------------------------TDDGIRHLGNGACAHDRLEVIELDNCPLITDASLEHL-KSCQSLERIELYDCQQIS 364          
BLAST of SMED30031490 vs. Ensembl Xenopus
Match: adcy3 (adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-1007339])

HSP 1 Score: 73.559 bits (179), Expect = 1.153e-13
Identity = 57/194 (29.38%), Postives = 101/194 (52.06%), Query Frame = 1
Query:  247 KSIKELANNQVNKLDLYGND--VTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            K+I E    Q+ +L++   D    D I    K C  L  L++         + D+ L  I  +   L  ++L  C  ITD+ +I++   C  ++ +  SGC+ I D  L +L ++C  ++ L VAR ++++D+G  +L+++   H L+++ L+ C  ITD+++  LS  C  L +L+ S+C  ITD     L N
Sbjct:  158 KAISE-GCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGC----TQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRGCHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKN--CHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGN 344          

HSP 2 Score: 68.1662 bits (165), Expect = 5.396e-12
Identity = 57/209 (27.27%), Postives = 97/209 (46.41%), Query Frame = 1
Query:  277 VNKLDLYGN-DVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTV---------------------------ARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            + KL L G   V D+ L  + + C+N+  L +    N    ITD   T++      LR + L +C  IT+ S+ ++SE CP +E +N+S C+ I    + +LV+ C  ++ L++                           A ++++D G+ ++ +    H L+ L   GC  ITD+ +  L + C  L IL  + C Q+TD     LA
Sbjct:   89 LRKLSLRGCLGVGDNALRTFAQNCRNIEVLNL----NGCTKITDATSTSLSKFCSKLRQLDLASCTSITNLSLKAISEGCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRG--CHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLA 291          

HSP 3 Score: 62.003 bits (149), Expect = 6.352e-10
Identity = 51/166 (30.72%), Postives = 76/166 (45.78%), Query Frame = 1
Query:  301 NDVTDDIL-EYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVH-TLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            +++TD IL    + C  L  L +A        +TD G T +  N   L  + L  C  ITD ++I LS +CP ++V++LS C LI                         +D GI  L    C H  L+ ++LD C  ITD S+E L + C  L  +   +C+QI+
Sbjct:  254 SNITDSILNALGQNCPRLRILEVARCSQ----LTDLGFTTLAKNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELI-------------------------TDDGIRHLGNGACAHDRLEVIELDNCPLITDASLEHL-KSCQSLERIELYDCQQIS 389          
BLAST of SMED30031490 vs. Ensembl Xenopus
Match: adcy3 (adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-1007339])

HSP 1 Score: 73.559 bits (179), Expect = 1.157e-13
Identity = 57/194 (29.38%), Postives = 101/194 (52.06%), Query Frame = 1
Query:  247 KSIKELANNQVNKLDLYGND--VTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            K+I E    Q+ +L++   D    D I    K C  L  L++         + D+ L  I  +   L  ++L  C  ITD+ +I++   C  ++ +  SGC+ I D  L +L ++C  ++ L VAR ++++D+G  +L+++   H L+++ L+ C  ITD+++  LS  C  L +L+ S+C  ITD     L N
Sbjct:  159 KAISE-GCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGC----TQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRGCHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKN--CHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGN 345          

HSP 2 Score: 68.5514 bits (166), Expect = 4.684e-12
Identity = 58/219 (26.48%), Postives = 101/219 (46.12%), Query Frame = 1
Query:  247 KSIKELANNQVNKLDLYGN-DVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTV---------------------------ARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            ++I +     + KL L G   V D+ L  + + C+N+  L +    N    ITD   T++      LR + L +C  IT+ S+ ++SE CP +E +N+S C+ I    + +LV+ C  ++ L++                           A ++++D G+ ++ +    H L+ L   GC  ITD+ +  L + C  L IL  + C Q+TD     LA
Sbjct:   80 ENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNL----NGCTKITDATSTSLSKFCSKLRQLDLASCTSITNLSLKAISEGCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRG--CHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLA 292          

HSP 3 Score: 62.003 bits (149), Expect = 5.980e-10
Identity = 51/166 (30.72%), Postives = 76/166 (45.78%), Query Frame = 1
Query:  301 NDVTDDIL-EYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVH-TLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            +++TD IL    + C  L  L +A        +TD G T +  N   L  + L  C  ITD ++I LS +CP ++V++LS C LI                         +D GI  L    C H  L+ ++LD C  ITD S+E L + C  L  +   +C+QI+
Sbjct:  255 SNITDSILNALGQNCPRLRILEVARCSQ----LTDLGFTTLAKNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELI-------------------------TDDGIRHLGNGACAHDRLEVIELDNCPLITDASLEHL-KSCQSLERIELYDCQQIS 390          
BLAST of SMED30031490 vs. Ensembl Xenopus
Match: adcy3 (adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-1007339])

HSP 1 Score: 73.559 bits (179), Expect = 1.175e-13
Identity = 57/194 (29.38%), Postives = 101/194 (52.06%), Query Frame = 1
Query:  247 KSIKELANNQVNKLDLYGND--VTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            K+I E    Q+ +L++   D    D I    K C  L  L++         + D+ L  I  +   L  ++L  C  ITD+ +I++   C  ++ +  SGC+ I D  L +L ++C  ++ L VAR ++++D+G  +L+++   H L+++ L+ C  ITD+++  LS  C  L +L+ S+C  ITD     L N
Sbjct:  241 KAISE-GCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGC----TQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRGCHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLAKN--CHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGN 427          

HSP 2 Score: 68.1662 bits (165), Expect = 6.776e-12
Identity = 58/219 (26.48%), Postives = 101/219 (46.12%), Query Frame = 1
Query:  247 KSIKELANNQVNKLDLYGN-DVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTV---------------------------ARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            ++I +     + KL L G   V D+ L  + + C+N+  L +    N    ITD   T++      LR + L +C  IT+ S+ ++SE CP +E +N+S C+ I    + +LV+ C  ++ L++                           A ++++D G+ ++ +    H L+ L   GC  ITD+ +  L + C  L IL  + C Q+TD     LA
Sbjct:  162 ENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLNL----NGCTKITDATSTSLSKFCSKLRQLDLASCTSITNLSLKAISEGCPQLEQLNISWCDQISKDGIQALVKGCGGLRLLSLKGCTQLEDEALKFIGSHCPELVTLNLQACSQITDDGLITICRG--CHKLQSLCASGCSNITDSILNALGQNCPRLRILEVARCSQLTDLGFTTLA 374          

HSP 3 Score: 62.003 bits (149), Expect = 6.001e-10
Identity = 51/166 (30.72%), Postives = 76/166 (45.78%), Query Frame = 1
Query:  301 NDVTDDIL-EYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVH-TLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            +++TD IL    + C  L  L +A        +TD G T +  N   L  + L  C  ITD ++I LS +CP ++V++LS C LI                         +D GI  L    C H  L+ ++LD C  ITD S+E L + C  L  +   +C+QI+
Sbjct:  337 SNITDSILNALGQNCPRLRILEVARCSQ----LTDLGFTTLAKNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELI-------------------------TDDGIRHLGNGACAHDRLEVIELDNCPLITDASLEHL-KSCQSLERIELYDCQQIS 472          
BLAST of SMED30031490 vs. Ensembl Mouse
Match: Amn1 (antagonist of mitotic exit network 1 [Source:MGI Symbol;Acc:MGI:2442933])

HSP 1 Score: 134.035 bits (336), Expect = 1.980e-36
Identity = 73/250 (29.20%), Postives = 140/250 (56.00%), Query Frame = 1
Query:  118 LFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            L +LC++ +      +I D+ +LP+  K +++ I+  RG+    +I E+ + +V +LDL   D++D  L++   C+ L +L + + R    +IT +G+  +  +   L  ++L  C  +TDE +++L+ NC  +++I+L GC  I D SL +L ++C  ++ + ++ T+VSD G+ +L    C   L+E+ +  C  +TD ++E     C  + IL F  C  ITD S+ +L   +     ++KQ+ WS+
Sbjct:   10 LLELCLQYLVINISRYISDIKYLPSNIKDRLIKIMSIRGRITDSNISEVLHPEVQRLDLRSCDISDVALQHLCKCRKLKALNLKSCREHRNSITSEGIKAVASSCSDLHEIYLKGCCSVTDEGVLALALNCHLLKIIDLGGCLGITDVSLHALGKNCPFLQCVDISTTQVSDNGVVALVSGPCAKQLEEINMRYCINLTDKAVEAALTACPRICILLFHGCPLITDRSQEVLEQLI--GSRKLKQVTWSV 257          
BLAST of SMED30031490 vs. Ensembl Mouse
Match: Amn1 (antagonist of mitotic exit network 1 [Source:MGI Symbol;Acc:MGI:2442933])

HSP 1 Score: 117.857 bits (294), Expect = 9.841e-31
Identity = 64/213 (30.05%), Postives = 119/213 (55.87%), Query Frame = 1
Query:  229 RGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            RG+    +I E+ + +V +LDL   D++D  L++   C+ L +L + + R    +IT +G+  +  +   L  ++L  C  +TDE +++L+ NC  +++I+L GC  I D SL +L ++C  ++ + ++ T+VSD G+ +L    C   L+E+ +  C  +TD ++E     C  + IL F  C  ITD S+ +L   +     ++KQ+ WS+
Sbjct:    4 RGRITDSNISEVLHPEVQRLDLRSCDISDVALQHLCKCRKLKALNLKSCREHRNSITSEGIKAVASSCSDLHEIYLKGCCSVTDEGVLALALNCHLLKIIDLGGCLGITDVSLHALGKNCPFLQCVDISTTQVSDNGVVALVSGPCAKQLEEINMRYCINLTDKAVEAALTACPRICILLFHGCPLITDRSQEVLEQLI--GSRKLKQVTWSV 214          
BLAST of SMED30031490 vs. Ensembl Mouse
Match: Fbxl2 (F-box and leucine-rich repeat protein 2 [Source:MGI Symbol;Acc:MGI:1919429])

HSP 1 Score: 80.8777 bits (198), Expect = 3.067e-16
Identity = 55/165 (33.33%), Postives = 89/165 (53.94%), Query Frame = 1
Query:  307 VTDD-ILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHT-LKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            +TDD +++  + C  L +L ++   N    +TD  LT +  N   L+V+    C ++TD     L+ NC  +E ++L  C LI D +L+ L   C  ++AL+++    ++D GI  LS S C H  L+ L+LD C  +TD S+E L   C  L  L   +C+Q+T
Sbjct:  221 ITDDGVVQICRGCHRLQALCLSGCSN----LTDASLTALGLNCPRLQVLEAARCSHLTDAGFTLLARNCHELEKMDLEECVLITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSSTCGHERLRVLELDNCLLVTDASLEHLEN-CRGLERLELYDCQQVT 380          

HSP 2 Score: 70.4774 bits (171), Expect = 8.880e-13
Identity = 47/171 (27.49%), Postives = 91/171 (53.22%), Query Frame = 1
Query:  295 YGNDVTDDILEY-TKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            + + +T + +E   + C+ L +L +         + D+ L +I  +   L  ++L +C  ITD+ ++ +   C  ++ + LSGC+ + D SL +L  +C  ++ L  AR + ++D G   L+++   H L+++ L+ C  ITD+++  LS  C  L  L+ S+C  ITD  
Sbjct:  165 WCDQITKEGIEALVRGCRGLKALLLRGC----TQLEDEALKHIQNHCHELVSLNLQSCSRITDDGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQVLEAARCSHLTDAGFTLLARN--CHELEKMDLEECVLITDSTLVQLSIHCPKLQALSLSHCELITDEG 329          

HSP 3 Score: 68.9366 bits (167), Expect = 2.700e-12
Identity = 58/193 (30.05%), Postives = 94/193 (48.70%), Query Frame = 1
Query:  247 KSIKELANNQVNKLDLYGN-DVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTV-ARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            ++I +     + KL L G   V D  L+ + + C+N+  L +    N    ITD    ++      L+ + L +C  +T+ S+  +SE C N+E +NLS C+ I  + + +LV  C  +KAL +   T++ D  +  + Q+ C H L  L L  C  ITD+ +  + R C  L  L  S C  +TD S   L 
Sbjct:   70 ENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNL----NGCTKITDSTCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHI-QNHC-HELVSLNLQSCSRITDDGVVQICRGCHRLQALCLSGCSNLTDASLTALG 256          

HSP 4 Score: 65.855 bits (159), Expect = 2.308e-11
Identity = 53/194 (27.32%), Postives = 92/194 (47.42%), Query Frame = 1
Query:  250 SIKELANN--QVNKLDLYG-NDVTDDIL-EYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            S+K  A N   +  L+L G   +TD      ++ C  L  L + +     V++T+  L  I    + L  ++L+ C  IT E I +L   C  ++ + L GC  + D++L  +   C  + +L +   +R++D G+  + +    H L+ L L GC  +TD S+  L   C  L +L  + C  +TD    +LA
Sbjct:   95 SLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSC----VSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNHCHELVSLNLQSCSRITDDGVVQICRG--CHRLQALCLSGCSNLTDASLTALGLNCPRLQVLEAARCSHLTDAGFTLLA 282          
BLAST of SMED30031490 vs. Ensembl Mouse
Match: Fbxl2 (F-box and leucine-rich repeat protein 2 [Source:MGI Symbol;Acc:MGI:1919429])

HSP 1 Score: 80.8777 bits (198), Expect = 3.067e-16
Identity = 55/165 (33.33%), Postives = 89/165 (53.94%), Query Frame = 1
Query:  307 VTDD-ILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHT-LKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            +TDD +++  + C  L +L ++   N    +TD  LT +  N   L+V+    C ++TD     L+ NC  +E ++L  C LI D +L+ L   C  ++AL+++    ++D GI  LS S C H  L+ L+LD C  +TD S+E L   C  L  L   +C+Q+T
Sbjct:  221 ITDDGVVQICRGCHRLQALCLSGCSN----LTDASLTALGLNCPRLQVLEAARCSHLTDAGFTLLARNCHELEKMDLEECVLITDSTLVQLSIHCPKLQALSLSHCELITDEGILHLSSSTCGHERLRVLELDNCLLVTDASLEHLEN-CRGLERLELYDCQQVT 380          

HSP 2 Score: 70.4774 bits (171), Expect = 8.880e-13
Identity = 47/171 (27.49%), Postives = 91/171 (53.22%), Query Frame = 1
Query:  295 YGNDVTDDILEY-TKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            + + +T + +E   + C+ L +L +         + D+ L +I  +   L  ++L +C  ITD+ ++ +   C  ++ + LSGC+ + D SL +L  +C  ++ L  AR + ++D G   L+++   H L+++ L+ C  ITD+++  LS  C  L  L+ S+C  ITD  
Sbjct:  165 WCDQITKEGIEALVRGCRGLKALLLRGC----TQLEDEALKHIQNHCHELVSLNLQSCSRITDDGVVQICRGCHRLQALCLSGCSNLTDASLTALGLNCPRLQVLEAARCSHLTDAGFTLLARN--CHELEKMDLEECVLITDSTLVQLSIHCPKLQALSLSHCELITDEG 329          

HSP 3 Score: 68.9366 bits (167), Expect = 2.700e-12
Identity = 58/193 (30.05%), Postives = 94/193 (48.70%), Query Frame = 1
Query:  247 KSIKELANNQVNKLDLYGN-DVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTV-ARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            ++I +     + KL L G   V D  L+ + + C+N+  L +    N    ITD    ++      L+ + L +C  +T+ S+  +SE C N+E +NLS C+ I  + + +LV  C  +KAL +   T++ D  +  + Q+ C H L  L L  C  ITD+ +  + R C  L  L  S C  +TD S   L 
Sbjct:   70 ENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNL----NGCTKITDSTCYSLSRFCSKLKHLDLTSCVSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHI-QNHC-HELVSLNLQSCSRITDDGVVQICRGCHRLQALCLSGCSNLTDASLTALG 256          

HSP 4 Score: 65.855 bits (159), Expect = 2.308e-11
Identity = 53/194 (27.32%), Postives = 92/194 (47.42%), Query Frame = 1
Query:  250 SIKELANN--QVNKLDLYG-NDVTDDIL-EYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            S+K  A N   +  L+L G   +TD      ++ C  L  L + +     V++T+  L  I    + L  ++L+ C  IT E I +L   C  ++ + L GC  + D++L  +   C  + +L +   +R++D G+  + +    H L+ L L GC  +TD S+  L   C  L +L  + C  +TD    +LA
Sbjct:   95 SLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSC----VSVTNSSLKGISEGCRNLEYLNLSWCDQITKEGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNHCHELVSLNLQSCSRITDDGVVQICRG--CHRLQALCLSGCSNLTDASLTALGLNCPRLQVLEAARCSHLTDAGFTLLA 282          
BLAST of SMED30031490 vs. Ensembl Mouse
Match: Fbxl20 (F-box and leucine-rich repeat protein 20 [Source:MGI Symbol;Acc:MGI:1919444])

HSP 1 Score: 75.0998 bits (183), Expect = 2.325e-14
Identity = 53/177 (29.94%), Postives = 94/177 (53.11%), Query Frame = 1
Query:  295 YGNDVT-DDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            + + VT D I    + C  L +L +         + D+ L  I  +   L  ++L  C  ITDE +I++   C  ++ +  SGC+ I D  L +L ++C  ++ L VAR ++++D+G  +L+++   H L+++ L+ C  ITD+++  LS  C  L +L+ S+C  ITD     L N
Sbjct:  178 WCDQVTKDGIQALVRGCGGLKALFLKGC----TQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARN--CHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGN 348          

HSP 2 Score: 65.4698 bits (158), Expect = 3.743e-11
Identity = 58/219 (26.48%), Postives = 97/219 (44.29%), Query Frame = 1
Query:  247 KSIKELANNQVNKLDLYGN-DVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVART---------------------------RVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            ++I +     + KL L G   V D+ L  + + C+N+  L++    N     TD   T++      LR + L +C  IT+ S+ +LSE CP +E +N+S C+ +    + +LV  C  +KAL +                              +++D G+ ++ +    H L+ L   GC  ITD  +  L + C  L IL  + C Q+TD     LA
Sbjct:   83 ENISKRCGGFLRKLSLRGCLGVGDNALRTFAQNCRNIEVLSL----NGCTKTTDATCTSLSKFCSKLRHLDLASCTSITNMSLKALSEGCPLLEQLNISWCDQVTKDGIQALVRGCGGLKALFLKGCTQLEDEALKYIGAHCPELVTLNLQTCLQITDEGLITICRG--CHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLA 295          

HSP 3 Score: 62.7734 bits (151), Expect = 2.526e-10
Identity = 52/189 (27.51%), Postives = 86/189 (45.50%), Query Frame = 1
Query:  313 DDILEYTKV-CKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCN--------------------------LIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVH-TLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            D+ L+Y    C  L +L + T     + ITD+GL  I      L+ +  + C  ITD  + +L +NCP + ++ ++ C+                           I D +LI L   C  ++ L+++    ++D GI  L    C H  L+ ++LD C  ITD S+E L + C  L  +   +C+QIT
Sbjct:  210 DEALKYIGAHCPELVTLNLQTC----LQITDEGLITICRGCHKLQSLCASGCSNITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARNCHELEKMDLEECVQITDSTLIQLSIHCPRLQVLSLSHCELITDDGIRHLGNGACAHDQLEVIELDNCPLITDASLEHL-KSCHSLERIELYDCQQIT 393          
BLAST of SMED30031490 vs. UniProt/SwissProt
Match: sp|Q5U201|AMN1_RAT (Protein AMN1 homolog OS=Rattus norvegicus OX=10116 GN=Amn1 PE=2 SV=2)

HSP 1 Score: 137.887 bits (346), Expect = 4.720e-37
Identity = 75/250 (30.00%), Postives = 139/250 (55.60%), Query Frame = 1
Query:  118 LFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            L +LC+R +      +I D+ +LP   K +++ I+  RG+    +I E+ + +V +LDL   +++D  L++   C+ L +L + + R    +IT +G+  +  +   L  + L  C  +TDE +++L+ NC  +++I+L GC  I D+SL +L ++C  ++ +  + T+VSD G+ +L    C   L+E+ +  C  +TD ++E     C  + IL F  C  ITDHSR +L   +     ++KQ+ WS+
Sbjct:   10 LLELCLRCLIINISRYISDIKYLPPNIKDRLIKIMSMRGRITDSNINEVLHPEVQRLDLRSCNISDVALQHLCKCRKLKALNLKSCREHRNSITSEGIKAVASSCSDLHEISLKGCCSVTDEGVLALALNCQLLKIIDLGGCLSITDESLHALGKNCPFLQCVDFSTTQVSDNGVVALVSGPCAKQLEEINMGYCINLTDKAVEAALTACPQICILLFHGCPLITDHSREVLEQLI--GSRKLKQVTWSV 257          
BLAST of SMED30031490 vs. UniProt/SwissProt
Match: sp|Q5R8X9|AMN1_PONAB (Protein AMN1 homolog OS=Pongo abelii OX=9601 GN=AMN1 PE=2 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.148e-35
Identity = 73/254 (28.74%), Postives = 136/254 (53.54%), Query Frame = 1
Query:  106 QLQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            ++  L DLC+         ++ D+  LP   K +++ I+  +G+    +I E+ + +V  LDL   D++D  L +   C+ L  L +   +   V++T +G+  +  +   L    L  C  +TDE +++L+ NC  +++INL GC  I D SL +L ++C  ++ +  + T+VSD G+ +L    C   L+E+ +  C  +TD ++E +  +C  + IL F  C  ITDHSR +L   +    +++KQ+ W++
Sbjct:    6 RVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGRITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKVVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIINLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLV--GPNKLKQVTWTV 257          
BLAST of SMED30031490 vs. UniProt/SwissProt
Match: sp|Q8IY45|AMN1_HUMAN (Protein AMN1 homolog OS=Homo sapiens OX=9606 GN=AMN1 PE=2 SV=4)

HSP 1 Score: 133.265 bits (334), Expect = 2.619e-35
Identity = 72/254 (28.35%), Postives = 136/254 (53.54%), Query Frame = 1
Query:  106 QLQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            ++  L DLC+         ++ D+  LP   K +++ I+  +G+    +I E+ + +V  LDL   D++D  L +   C+ L  L +   +   V++T +G+  +  +   L    L  C  +TDE +++L+ NC  +++I+L GC  I D SL +L ++C  ++ +  + T+VSD G+ +L    C   L+E+ +  C  +TD ++E +  +C  + IL F  C  ITDHSR +L   +    +++KQ+ W++
Sbjct:    6 RVSQLLDLCLWCFMKNISRYLTDIKPLPPNIKDRLIKIMSMQGQITDSNISEILHPEVQTLDLRSCDISDAALLHLSNCRKLKKLNLNASKGNRVSVTSEGIKAVASSCSYLHEASLKRCCNLTDEGVVALALNCQLLKIIDLGGCLSITDVSLHALGKNCPFLQCVDFSATQVSDSGVIALVSGPCAKKLEEIHMGHCVNLTDGAVEAVLTYCPQIRILLFHGCPLITDHSREVLEQLV--GPNKLKQVTWTV 257          
BLAST of SMED30031490 vs. UniProt/SwissProt
Match: sp|Q32L08|AMN1_BOVIN (Protein AMN1 homolog OS=Bos taurus OX=9913 GN=AMN1 PE=2 SV=2)

HSP 1 Score: 133.265 bits (334), Expect = 3.508e-35
Identity = 75/254 (29.53%), Postives = 137/254 (53.94%), Query Frame = 1
Query:  106 QLQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            ++  L DLC+         +I D+  LP   K +++ I+  +G+    +I E+ + +V  LDL   D++D  L +   C+ L  L + + +   ++IT KG+  +  +   L    L  C  +TDE +++L+ NC  +++I+L GC  I D SL +L E+C+ ++ +  + T+VSD G+ +L    C   L+E+ +  C  +TD ++E +   C  + IL F  C  ITDHSR +L   +    +++KQ+ W++
Sbjct:    6 RVSQLLDLCLWCFMKNISRYITDIKPLPPNIKDRLIKIMSVQGQITDSNISEILHPEVQTLDLRSCDISDTALLHLCNCRKLKKLNLKSSKENRISITSKGIKAVASSCSYLHEASLKRCCNLTDEGVLALALNCRLLKIIDLGGCLGITDVSLQALGENCAFLQCVDFSATQVSDHGVVALVSGPCAKKLEEIHMGHCVNLTDEAVEAVLTCCPQICILLFHGCPLITDHSREVLEQLV--GPNKLKQVTWTV 257          
BLAST of SMED30031490 vs. UniProt/SwissProt
Match: sp|Q0P4D1|AMN1_DANRE (Protein AMN1 homolog OS=Danio rerio OX=7955 GN=amn1 PE=2 SV=1)

HSP 1 Score: 120.939 bits (302), Expect = 1.028e-30
Identity = 76/254 (29.92%), Postives = 131/254 (51.57%), Query Frame = 1
Query:  109 LQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVR-NFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            + +L  LC   V+     + ED+  LP   K ++L I+   G     +I +L ++  + LDL    ++D  L      K + SL + T+       IT +GL  + P    L+VV L  C  +TD  I +L+ +C  +EVI+L GC+ + DK+L+ L  +C  + ++  + T V+D G+  L+   C  +LKELQ+  C  +TD ++  +   C ++ I  F  C  ITD SR  L N +    ++++Q+ W++
Sbjct:    4 IDSLMSLCAFSVAQRAEKY-EDIRMLPASVKDRLLRIMTSYGTVTDSNISQLVHSGTHTLDLQNCKISDSAL------KQINSLHLRTILLRGCAEITSEGLEVLAPRCPYLQVVDLTGCTAVTDSGIQALARHCKCLEVISLRGCSALSDKALLELGGNCKMLHSIYFSGTEVTDQGVIGLATGVCSCSLKELQMVRCRNLTDLAVTAVLTNCANIRIFNFHGCPLITDKSREALQNLI--GPNKIQQVSWTV 248          
BLAST of SMED30031490 vs. TrEMBL
Match: A0A1S3K294 (protein AMN1 homolog OS=Lingula unguis OX=7574 GN=LOC106178198 PE=4 SV=1)

HSP 1 Score: 171.785 bits (434), Expect = 2.840e-47
Identity = 82/251 (32.67%), Postives = 156/251 (62.15%), Query Frame = 1
Query:  115 TLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            TL ++ +  +      ++E LD LP   K K+L ++ KRG     +I+++ ++ V  LDL  +DVTD  L+Y + CK+L  + + + +    NI+ +G+ +++ + + L++++L  C  ++D+++I++S+ CP +  +N+ GC+LI DKSL +L E+   +K++  ++TRV+D G+ SL+   C  TLKE+ +DGC  +TD ++E ++ FC  ++IL F  C  ITD +R  + +  +   + +KQ+ W+I
Sbjct:   18 TLLNISVLSMVGHLSDYLEALDGLPPNLKDKLLHLMSKRGLITDGNIQKVVHSGVRMLDLSESDVTDQGLQYVRKCKDLKKIDLNSAKQSRTNISSEGIISVVTSCRQLQIIYLRRCLNVSDDAVIAISQQCPQLRQLNIGGCHLITDKSLQALGENSRFLKSVNFSKTRVTDEGVISLATGVCSATLKEIHMDGCVQLTDEAVEAVTNFCPAIDILLFHGCPHITDRARQAIEDLSQHD-AHLKQVTWTI 267          
BLAST of SMED30031490 vs. TrEMBL
Match: A7RXZ5 (Predicted protein OS=Nematostella vectensis OX=45351 GN=v1g164009 PE=4 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 4.831e-42
Identity = 87/253 (34.39%), Postives = 141/253 (55.73%), Query Frame = 1
Query:  109 LQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            L +L   CIR ++         L  LP   K  ++ +  KRG  +   + ++ +  +  LDL  +D +D+ L   +VCK L  L +  V++   NIT  G+  I  +   L+ V+L  C  I DE++I+L+ENCP +  +NL GC  I D+SL +L +    +++L V++T+++D GI+SL+   C  +LKEL L  C  ITD+ +E +   C ++ IL F NC  +TD SRY +    +R G  MKQ+ W++
Sbjct:   11 LDSLQTSCIRAIADHVSQHKGGLKDLPREVKDNLVLLFSKRGLLSDDVLPKIVSPLIRDLDLSESDTSDEGLMALQVCKKLRKLDLNAVKDRRENITSNGIITISQSCHDLQTVYLRRCTSIGDEAVIALAENCPQLMHLNLGGCLQITDRSLKALAKHSKFLQSLNVSKTKITDTGIFSLTSGCCTQSLKELHLAHCKDITDDGVESVLMLCPNVTILIFHNCPLVTDRSRYAMEEVAQRGGV-MKQLSWTV 262          
BLAST of SMED30031490 vs. TrEMBL
Match: A0A3M6TQ81 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00001908 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 1.480e-41
Identity = 87/256 (33.98%), Postives = 147/256 (57.42%), Query Frame = 1
Query:  100 FYQLQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            F  + +L + C+R V+ +       L  LP   K K++++L KRG     ++  + +  + +L+L    ++D  L +  VCKNL  L +   +N   ++T +G++ +  +   L+ V+L  C  +TD++I +L++NC  +E +NL GCN I D SL  +  +C  +++L ++ T+V+D GI  L+  KC H++KE+QL  C  I+D+SIE L   C  +NIL F  C  +TD SR  L   M R G +MKQ+ W++
Sbjct:    4 FAVVSSLQNHCLRAVAGQLPNHETSLAQLPVEIKTKLVNLLSKRGLLTDANLGNVLHPTLRELELCECAISDRGLSFICVCKNLRKLDLNATKNSRADVTSEGMSRVFLSCCCLQTVYLRRCVNLTDDAIAALTQNCLQLEHLNLCGCNKITDTSLQLIAHNCKFLQSLNLSNTKVTDNGILCLTSGKCQHSIKEVQLSHCVNISDDSIEALLTCCPRINILIFDGCPNVTDRSRQALEEVMLR-GGKMKQLSWTV 258          
BLAST of SMED30031490 vs. TrEMBL
Match: A0A286XRP2 (Antagonist of mitotic exit network 1 homolog OS=Cavia porcellus OX=10141 GN=AMN1 PE=4 SV=1)

HSP 1 Score: 143.665 bits (361), Expect = 1.180e-36
Identity = 77/254 (30.31%), Postives = 140/254 (55.12%), Query Frame = 1
Query:  106 QLQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            ++  L DLC+         +I D+  LP   K +++ I+  +G+    +I E+ + +V  LDL   D++D  L +   C+ L  L + + +   V+IT +G+  +  +   L+   L  C  +TDE +++L+ NC  +++I+L GC  I D SL +L E+CS +K +  + T+VSD G+ +L    C   L+E+ +  C ++TD+++E +  +C  + IL F  C  ITDHSR +L        +++KQ+ W++
Sbjct:    6 RVSRLLDLCLWCFMENISRYITDIKPLPPNIKDRLIKIMSMQGRITDSNINEILHPEVQTLDLQSCDISDTALLHLCNCRKLKKLNLNSSKGSRVSITSEGIKAVASSCSYLQEASLKRCHSLTDEGVLALALNCRLLKIIDLGGCLSITDVSLCALGENCSLLKCVDFSATQVSDSGVVALVSGPCAKKLEEIHMGHCVHLTDDAVEAVVTYCPQIRILLFHECPLITDHSREVLEQL--SGPNKLKQVTWTV 257          
BLAST of SMED30031490 vs. TrEMBL
Match: A0A3L7H6H0 (AMN1 OS=Cricetulus griseus OX=10029 GN=CgPICR_016410 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 4.926e-36
Identity = 77/250 (30.80%), Postives = 140/250 (56.00%), Query Frame = 1
Query:  118 LFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            L +LC+R +      +I D+ +LP   K +++ I+  RG+    +I E+ + +V +LDL   D++D  L++   C+ L +L + + R    +IT +G+  +  +   L  + L  C  +TDE +++L+ NC  +++I+L GC  I DKSL +L ++C  ++ +  + T+VSD G+ +L    C   L+E+ +  C  +TD ++E +   C  + IL F  C  ITDHSR +L   +     ++KQ+ WS+
Sbjct:   10 LVELCLRCLIINISRYISDIKYLPPNIKDRLIKIMSTRGRITDSNINEVLHPEVQRLDLRSCDISDLALQHLCKCRKLKALNLKSSREHRNSITSEGIKAVASSCSDLHEISLKGCCNVTDEGVLALALNCQLLKIIDLGGCLSITDKSLQALGKNCPFLQCVDFSTTQVSDSGVVALVSGPCAKQLEEINMGYCINLTDKAVEAVLTACPQICILLFHGCPLITDHSREVLEQLV--GSRKLKQVTWSV 257          
BLAST of SMED30031490 vs. Ensembl Cavefish
Match: amn1 (antagonist of mitotic exit network 1 homolog [Source:NCBI gene;Acc:103044731])

HSP 1 Score: 106.301 bits (264), Expect = 2.869e-26
Identity = 67/253 (26.48%), Postives = 128/253 (50.59%), Query Frame = 1
Query:  109 LQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            + +L +L    V+     + + +  LP  AK K++ I+  +G     +I ++ +  +  L+L   +++D  L     C  L ++ +       V+IT +GL ++  +   L+VV L  C  +TD+ + +L+ +C  +EVI+L  C  I D +L  L  +C  + ++    T V+D G+  L+   C  +LKELQ+  CH +TD ++  +   C ++    F  C  ITD SR  L N +    ++++ + W++
Sbjct:    4 VDSLMNLSAVSVAQNAEKYRDCIRTLPCSAKDKLVRIMTAQGTVTDSNIDQVLHPGIRTLELQNCNISDSALRKIH-CPQLRTILLTRC----VHITSEGLEDLASHCPCLQVVDLTGCTAVTDQGVQALARSCKWLEVISLMECTRITDVALTELGANCRFLYSIYFGGTNVTDEGVLGLATGVCSQSLKELQMVRCHNLTDKAVAVILSNCANIRTFNFHGCPLITDKSREALHNLI--GPNKIQHVSWTV 249          
BLAST of SMED30031490 vs. Ensembl Cavefish
Match: amn1 (antagonist of mitotic exit network 1 homolog [Source:NCBI gene;Acc:103044731])

HSP 1 Score: 95.1301 bits (235), Expect = 2.372e-22
Identity = 61/230 (26.52%), Postives = 114/230 (49.57%), Query Frame = 1
Query:  115 TLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSR 804
            +L +L    V+     + + +  LP  AK K++ I+  +G     +I ++ +  +  L+L   +++D  L     C  L ++ +       V+IT +GL ++  +   L+VV L  C  +TD+ + +L+ +C  +EVI+L  C  I D +L  L  +C  + ++    T V+D G+  L+   C  +LKELQ+  CH +TD ++  +   C ++    F  C  IT   +
Sbjct:    6 SLMNLSAVSVAQNAEKYRDCIRTLPCSAKDKLVRIMTAQGTVTDSNIDQVLHPGIRTLELQNCNISDSALRKIH-CPQLRTILLTRC----VHITSEGLEDLASHCPCLQVVDLTGCTAVTDQGVQALARSCKWLEVISLMECTRITDVALTELGANCRFLYSIYFGGTNVTDEGVLGLATGVCSQSLKELQMVRCHNLTDKAVAVILSNCANIRTFNFHGCPLITGECQ 230          
BLAST of SMED30031490 vs. Ensembl Cavefish
Match: fbxl2 (F-box and leucine-rich repeat protein 2 [Source:ZFIN;Acc:ZDB-GENE-030925-12])

HSP 1 Score: 76.6406 bits (187), Expect = 5.600e-15
Identity = 50/169 (29.59%), Postives = 91/169 (53.85%), Query Frame = 1
Query:  295 YGNDVTDDILEY-TKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            + + +T D +E  ++ C  L +L +         + D  L ++  +   L  +++ +C  ITDE  +SL   C  ++++ +SGC+ I D SL +L  +C  +K L  AR + V+D G   L+++   H ++++ L+ C  +TDN++  LS  C  L  L+ S+C  ITD
Sbjct:  162 WCDQITRDGIEALSRGCNGLKALFLRGC----TQLDDTALKHLQKHCPELVTINMQSCTQITDEGFVSLCRGCHKLQMVCVSGCSNITDASLTALGLNCQRLKILEAARCSHVTDAGFTVLARN--CHEMEKMDLEECILVTDNTLVQLSIHCPRLQALSLSHCELITD 324          

HSP 2 Score: 75.0998 bits (183), Expect = 2.050e-14
Identity = 51/165 (30.91%), Postives = 87/165 (52.73%), Query Frame = 1
Query:  304 DVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHT-LKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
             +TD+   +  +C+    L +  V     NITD  LT +  N + L+++    C ++TD     L+ NC  ME ++L  C L+ D +L+ L   C  ++AL+++    ++D GI  LS S C    L+ ++LD C  ITD ++E L + C  L  +   +C+Q+T
Sbjct:  217 QITDE--GFVSLCRGCHKLQMVCVSGCS-NITDASLTALGLNCQRLKILEAARCSHVTDAGFTVLARNCHEMEKMDLEECILVTDNTLVQLSIHCPRLQALSLSHCELITDDGIRHLSSSVCGQERLQVVELDNCPLITDITLEHL-KSCQRLERIELYDCQQVT 377          

HSP 3 Score: 71.633 bits (174), Expect = 2.815e-13
Identity = 59/211 (27.96%), Postives = 105/211 (49.76%), Query Frame = 1
Query:  232 GKANKKSIKELANNQVNKLDLYG-NDVTDDI-LEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQM 855
            G A+ K+  +   N + +L+L G   +TD   +  +K C  L +L + +     V+IT+  L  +    ++L  ++L+ C  IT + I +LS  C  ++ + L GC  + D +L  L + C  +  + +   T+++D G  SL +    H L+ + + GC  ITD S+  L   C  L IL  + C  +TD    +LA    R+  +M++M
Sbjct:   89 GDASMKTFAQNCRN-IEQLNLNGCTKITDSTCISLSKFCSKLRNLDLTSC----VSITNHALKALSEGCRMLENLNLSWCDQITRDGIEALSRGCNGLKALFLRGCTQLDDTALKHLQKHCPELVTINMQSCTQITDEGFVSLCRG--CHKLQMVCVSGCSNITDASLTALGLNCQRLKILEAARCSHVTDAGFTVLA----RNCHEMEKM 288          

HSP 4 Score: 66.6254 bits (161), Expect = 1.038e-11
Identity = 46/141 (32.62%), Postives = 72/141 (51.06%), Query Frame = 1
Query:  379 NFPVNITDKGLTNILPN-FKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            NF  +I  + + NI       LR + L  C  + D S+ + ++NC N+E +NL+GC  I D + ISL + CS ++ L +     +++  + +LS+      L+ L L  C  IT + IE LSR C  L  L    C Q+ D
Sbjct:   56 NFQTDIEGRVVENISKRCGGFLRQLSLRGCLSVGDASMKTFAQNCRNIEQLNLNGCTKITDSTCISLSKFCSKLRNLDLTSCVSITNHALKALSEG--CRMLENLNLSWCDQITRDGIEALSRGCNGLKALFLRGCTQLDD 194          
BLAST of SMED30031490 vs. Ensembl Cavefish
Match: fbxl20 (F-box and leucine rich repeat protein 20 [Source:NCBI gene;Acc:103040563])

HSP 1 Score: 76.2554 bits (186), Expect = 7.753e-15
Identity = 51/169 (30.18%), Postives = 91/169 (53.85%), Query Frame = 1
Query:  295 YGNDVT-DDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            + + VT D I    + C  L  L +         + D+ L +I  +   L  ++L  C  ITDE +I++   C  ++ + +SGC  I D  L +L ++C  ++ L VAR ++++D+G  +L+++   H L+++ L+ C  ITD ++  LS  C  L +L+ S+C  ITD
Sbjct:  178 WCDQVTKDGIQALVRCCPGLKGLFLKGC----TQLEDEALKHIGAHCPELVTLNLQTCSQITDEGLITICRGCHRLQSLCVSGCANITDAILNALGQNCPRLRILEVARCSQLTDVGFTTLARN--CHELEKMDLEECVQITDATLIQLSIHCPRLQVLSLSHCELITD 340          

HSP 2 Score: 68.9366 bits (167), Expect = 1.923e-12
Identity = 59/217 (27.19%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  184 LPNRAKVKI---LDI--LCKRGKANKK-SIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPV----NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVART-RVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            LP    ++I   LD+  LC+  + ++  ++  L  +   ++DL+  D   DI    +V +N++      +R   +     + D  L     N + + ++ LN C  ITD +  SLS+ CP ++ ++L+ C  I + SL +L E C  ++ L ++   +V+  GI +L   +C   LK L L GC  + D +++ +   C  L  L    C QITD  
Sbjct:   28 LPKELLLRIFSFLDVVTLCRCAQVSRSWNVLALDGSNWQRIDLF--DFQRDI--EGRVVENISKRCGGFLRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCNSLSKFCPKLKHLDLASCTSITNLSLKALSEGCPLLEQLNISWCDQVTKDGIQAL--VRCCPGLKGLFLKGCTQLEDEALKHIGAHCPELVTLNLQTCSQITDEG 238          

HSP 3 Score: 62.7734 bits (151), Expect = 2.131e-10
Identity = 52/165 (31.52%), Postives = 76/165 (46.06%), Query Frame = 1
Query:  304 DVTDDIL-EYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVH-TLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            ++TD IL    + C  L  L +A        +TD G T +  N   L  + L  C  ITD ++I LS +CP ++V++LS C LI                         +D GI  L    C H  L+ ++LD C  ITD S+E L + C  L+ +   +C+QIT
Sbjct:  259 NITDAILNALGQNCPRLRILEVARCSQ----LTDVGFTTLARNCHELEKMDLEECVQITDATLIQLSIHCPRLQVLSLSHCELI-------------------------TDDGIRHLGSGPCAHDRLEVIELDNCPLITDASLEHL-KTCHSLDRIELYDCQQIT 393          
BLAST of SMED30031490 vs. Ensembl Cavefish
Match: si:dkey-192l18.9 (F-box/LRR-repeat protein 7-like [Source:NCBI gene;Acc:103043891])

HSP 1 Score: 70.8626 bits (172), Expect = 5.309e-13
Identity = 44/145 (30.34%), Postives = 76/145 (52.41%), Query Frame = 1
Query:  388 VNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            V++ DKGL  I  +   L  ++L  C  ++DE++  L+ +CP +  ++LS C LI D  L  +      ++ L+VA  TR++D+G+  +++      L+ L   GC  +TD  +  L+R C  L  L    C  ++D    ILA+
Sbjct:  283 VSLEDKGLHAIASHCPRLTHLYLRRCSRLSDEALRQLALHCPALRELSLSDCRLISDFGLREVARMEGRLRYLSVAHCTRITDVGLRYVARY--CPRLRYLNARGCEGLTDQGLGHLARSCPRLRSLDVGRCPLVSDMGLEILAH 425          

HSP 2 Score: 59.3066 bits (142), Expect = 2.573e-9
Identity = 43/193 (22.28%), Postives = 93/193 (48.19%), Query Frame = 1
Query:  274 QVNKLDLYG--NDVTDDILEYTKVCKNLTSLTIATVRNFP-VNITDK---GLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMER 831
            ++ +L++ G  N   + + +    C NL  L ++       +++T +    L+ I      LR + + +C  + D+ + +++ +CP +  + L  C+ + D++L  L   C  ++ L+++  R +SD G+  +++ +    L+ L +  C  ITD  + +++R+C  L  L    C  +TD     LA    R
Sbjct:  213 ELRRLEVAGCYNVTNEAVFDVVSRCPNLEHLDVSGCPKVTCISLTQETSVQLSPIQGQQTGLRYLDMGDCVSLEDKGLHAIASHCPRLTHLYLRRCSRLSDEALRQLALHCPALRELSLSDCRLISDFGLREVARME--GRLRYLSVAHCTRITDVGLRYVARYCPRLRYLNARGCEGLTDQGLGHLARSCPR 403          

HSP 3 Score: 53.1434 bits (126), Expect = 2.814e-7
Identity = 46/202 (22.77%), Postives = 86/202 (42.57%), Query Frame = 1
Query:  337 VCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIG----------------------------------DKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVH--TLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMER 831
            VC  L ++  +  R     ++D+GL  +  +   LR + +  C  +T+E++  +   CPN+E +++SGC  +                                   DK L ++   C  +  L + R +R+SD  +  L+    +H   L+EL L  C  I+D  +  ++R    L  L+ ++C +ITD     +A +  R
Sbjct:  184 VCLTLETVVASGCRR----LSDRGLHVVAQSCPELRRLEVAGCYNVTNEAVFDVVSRCPNLEHLDVSGCPKVTCISLTQETSVQLSPIQGQQTGLRYLDMGDCVSLEDKGLHAIASHCPRLTHLYLRRCSRLSDEALRQLA----LHCPALRELSLSDCRLISDFGLREVARMEGRLRYLSVAHCTRITDVGLRYVARYCPR 377          
BLAST of SMED30031490 vs. Ensembl Sea Lamprey
Match: amn1 (antagonist of mitotic exit network 1 homolog (S. cerevisiae) [Source:NCBI gene;Acc:751744])

HSP 1 Score: 138.272 bits (347), Expect = 8.261e-39
Identity = 74/242 (30.58%), Postives = 139/242 (57.44%), Query Frame = 1
Query:  142 VSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            V+  +  +  +++ LP+  K K+L +L K+G+   ++I +  N QV KL+     +TD+ L     CK L  L +        N+T +G+  +     LLR V L+ C  +TD +II L+ +CP + ++NL GC+ +GD SL +L  + S+++ +  A+T+V+D G+ +L    C  +L+E+ +D C  +TD ++E + + C  +  L F  C  +T+HSR IL ++M+ + + ++ + W++
Sbjct:   20 VARAFPRYSGEVEQLPHNLKTKLLYLLVKQGEITDQNIGKFVNPQVKKLNFSRCRITDECLRQLTSCKLLLVLILNNT-----NVTSEGVEILAACCPLLRDVELSQCTELTDRAIIKLAASCPQLWILNLRGCHRLGDASLHALGRASSSLQFINFAKTQVTDEGVIALVNGACSKSLEEVHMDHCPSLTDKAVEAVLKSCPQIKYLHFHECPLMTEHSRVILDDYMQ-AHNHLQSVTWTV 255          
BLAST of SMED30031490 vs. Ensembl Sea Lamprey
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 70.8626 bits (172), Expect = 8.358e-14
Identity = 40/140 (28.57%), Postives = 70/140 (50.00%), Query Frame = 1
Query:  397 TDKGLTNILPNF-KLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYI 810
            TD GL ++       LR + L +C  +TD ++  L   CP +  +N  GC  + D+ L SL   C  +++L V R   V+D+G+  L++      LK L L GC  +++  +  ++  C  L +L+  +C    D  R++
Sbjct:  266 TDAGLRDVAAALGPRLRYLSLAHCERVTDVTLRCLGRRCPGLRYLNARGCLGVTDRGLESLGRGCPRLRSLDVGRCPLVTDVGLEVLARG--CPGLKRLGLKGCEGVSERGLRGVALCCPGLQLLSVQDCNLSPDTLRFV 403          

HSP 2 Score: 58.151 bits (139), Expect = 1.049e-9
Identity = 44/193 (22.80%), Postives = 88/193 (45.60%), Query Frame = 1
Query:  274 QVNKLDLYG-NDVTD-DILEYTKVCKNLTSLTIATVRNFP-VNITDKGLTNILP---NFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMER 831
            ++ +L++ G  ++++  +LE    C NL  L ++       V++  +      P      LLR + ++ C  +TDE +++++ +CP +  + L  C  + D  L +L   C+ ++ L++      +D G+  ++ +     L+ L L  C  +TD ++  L R C  L  L    C  +TD     L     R
Sbjct:  141 ELRRLEVSGCGEISNRGLLEVVTRCPNLEHLDVSDCPEITCVSLIPEASCQACPLHSRHLLLRHLDMSGCSGLTDEGLLAVARHCPRLARLYLRRCPGVADGGLRALARHCTALRELSLCDCPTATDAGLRDVAAAL-GPRLRYLSLAHCERVTDVTLRCLGRRCPGLRYLNARGCLGVTDRGLESLGRGCPR 332          

HSP 3 Score: 53.1434 bits (126), Expect = 5.167e-8
Identity = 33/131 (25.19%), Postives = 62/131 (47.33%), Query Frame = 1
Query:  454 LNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSL-SQSKC----VHT----LKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            L+    + D  +++++  CP +  + +SGC  I ++ L+ +V  C N++ L V  +   +I   SL  ++ C    +H+    L+ L + GC  +TD  +  ++R C  L  L    C  + D     LA 
Sbjct:  121 LSGSPALGDAGLLTVARRCPELRRLEVSGCGEISNRGLLEVVTRCPNLEHLDV--SDCPEITCVSLIPEASCQACPLHSRHLLLRHLDMSGCSGLTDEGLLAVARHCPRLARLYLRRCPGVADGGLRALAR 249          

HSP 4 Score: 46.595 bits (109), Expect = 5.327e-6
Identity = 19/75 (25.33%), Postives = 39/75 (52.00%), Query Frame = 1
Query:  388 VNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTV 612
            + +TD+GL ++      LR + +  C  +TD  +  L+  CP ++ + L GC  + ++ L  +   C  ++ L+V
Sbjct:  316 LGVTDRGLESLGRGCPRLRSLDVGRCPLVTDVGLEVLARGCPGLKRLGLKGCEGVSERGLRGVALCCPGLQLLSV 390          
BLAST of SMED30031490 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003881.1 (pep scaffold:Pmarinus_7.0:GL477033:429527:460683:1 gene:ENSPMAG00000003530.1 transcript:ENSPMAT00000003881.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.8626 bits (172), Expect = 8.865e-14
Identity = 46/162 (28.40%), Postives = 83/162 (51.23%), Query Frame = 1
Query:  334 KVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            K C  L  L + +       IT+  L  +    K L  ++++ C  +T++ I +L+  C +M+V+ L GC ++ D SL  + + C  +  L +   +RV+D G+ ++ +    H L+ L + GC+ +TD  +  L   C HL IL  + C Q++D    +LA
Sbjct:  141 KFCSKLKQLDLTSC----TAITNHSLKALSDGCKGLEHLNVSWCDQVTEDGITALARECHSMKVLLLKGCYMVNDVSLKQIGKYCPELVTLNLQNCSRVTDDGVITVCRG--CHKLQSLSVSGCNALTDALLNALGHNCYHLRILEVAGCSQLSDTGFQMLA 296          

HSP 2 Score: 66.6254 bits (161), Expect = 2.256e-12
Identity = 51/167 (30.54%), Postives = 83/167 (49.70%), Query Frame = 1
Query:  307 VTDD-ILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR---VSDIGIYSLSQSKCVHT-LKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            VTDD ++   + C  L SL+++        +TD  L  +  N   LR++ +  C  ++D     L+ NC ++E ++L  C  I D +LI L   C  ++ L  + +    ++D GI  L    C H  L  L+LD C  +TD S+E L + C  L  +   +C+QIT
Sbjct:  235 VTDDGVITVCRGCHKLQSLSVSGCNA----LTDALLNALGHNCYHLRILEVAGCSQLSDTGFQMLARNCHDLEKMDLEECIQITDATLIQLSLHCPRLQVLMQSLSHCELITDDGIRHLGNGACSHERLTVLELDNCPLVTDASLEHL-KGCQSLQRVELYDCQQIT 396          

HSP 3 Score: 65.4698 bits (158), Expect = 6.115e-12
Identity = 38/152 (25.00%), Postives = 74/152 (48.68%), Query Frame = 1
Query:  340 CKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            CK L  L ++    +   +T+ G+T +      ++V+ L  C  + D S+  + + CP +  +NL  C+ + D  +I++   C  +++L+V+        + +     C H L+ L++ GC  ++D   + L+R C  L  +    C QITD
Sbjct:  169 CKGLEHLNVS----WCDQVTEDGITALARECHSMKVLLLKGCYMVNDVSLKQIGKYCPELVTLNLQNCSRVTDDGVITVCRGCHKLQSLSVSGCNALTDALLNALGHNCYH-LRILEVAGCSQLSDTGFQMLARNCHDLEKMDLEECIQITD 315          

HSP 4 Score: 64.3142 bits (155), Expect = 1.125e-11
Identity = 45/167 (26.95%), Postives = 79/167 (47.31%), Query Frame = 1
Query:  379 NFPVNITDKGLTNILPN-FKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVART---------------------------RVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            NF  +I  + + NI       LR + L  C  + D ++ + S+NC N+E ++L+GC  I D +  SL + CS +K L +                              +V++ GI +L++    H++K L L GC+ + D S++ + ++C  L  L   NC ++TD
Sbjct:   73 NFQRDIEGRVVENISKRCGGFLRQLSLRGCLGVGDSALRTFSQNCRNIETLSLNGCTKITDNTCASLGKFCSKLKQLDLTSCTAITNHSLKALSDGCKGLEHLNVSWCDQVTEDGITALARE--CHSMKVLLLKGCYMVNDVSLKQIGKYCPELVTLNLQNCSRVTD 237          
BLAST of SMED30031490 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008139.1 (pep scaffold:Pmarinus_7.0:GL476334:657211:690462:-1 gene:ENSPMAG00000007325.1 transcript:ENSPMAT00000008139.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 2.278e-13
Identity = 44/143 (30.77%), Postives = 77/143 (53.85%), Query Frame = 1
Query:  394 ITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILAN 819
            + D  L  +      L  ++L NC  +TDE +I++   C  ++ ++LSGC  + D  L +L  +C  ++ L V+  +++SD G   L+++   H L+++ L+ C  ITD ++  LS  C  L +L+ S+C  ITD     L N
Sbjct:  206 VNDGALKQVGKYSPGLITLNLQNCSRLTDEGVITMCRGCHKLQSLSLSGCTALTDAVLNALGHNCPQLRILEVSSCSQLSDAGFQVLARN--CHELEKMDLEECILITDATLMQLSINCPRLTVLSLSHCELITDDGIRHLTN 346          

HSP 2 Score: 64.6994 bits (156), Expect = 9.896e-12
Identity = 38/125 (30.40%), Postives = 67/125 (53.60%), Query Frame = 1
Query:  451 HLN--NCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            HLN   C  ++++ I +L   CP M+V+ L GC+++ D +L  + +    +  L +   +R++D G+ ++ +    H L+ L L GC  +TD  +  L   C  L IL  S+C Q++D    +LA
Sbjct:  171 HLNVSWCDNVSEDGITALVRECPGMKVLLLKGCHMVNDGALKQVGKYSPGLITLNLQNCSRLTDEGVITMCRG--CHKLQSLSLSGCTALTDAVLNALGHNCPQLRILEVSSCSQLSDAGFQVLA 293          

HSP 3 Score: 62.3882 bits (150), Expect = 5.480e-11
Identity = 39/143 (27.27%), Postives = 73/143 (51.05%), Query Frame = 1
Query:  379 NFPVNITDKGLTNILPN-FKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            NF  +I  + + NI       LR + L  C+ + D ++ + ++NC N+E++NL+GC  I D +  SL + CS +K L +   T +++  + +L  S     L+ L +  C  ++++ I  L R C  + +L    C  + D +
Sbjct:   68 NFQRDIEGRVVENISKRCGGFLRQLGLRGCQGVGDSALRTFAQNCRNIEILNLNGCTKITDNTCSSLGKFCSKLKQLDLTSCTSITNHSLKALRCSDGCKGLEHLNVSWCDNVSEDGITALVRECPGMKVLLLKGCHMVNDGA 210          

HSP 4 Score: 58.5362 bits (140), Expect = 1.043e-9
Identity = 43/161 (26.71%), Postives = 75/161 (46.58%), Query Frame = 1
Query:  394 ITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCN--------------------------LIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHT-LKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            +TD+G+  +      L+ + L+ C  +TD  + +L  NCP + ++ +S C+                          LI D +L+ L  +C  +  L+++    ++D GI  L+   C H  L  L+LD C  +TD S+E L + C  L  +   +C+QIT
Sbjct:  232 LTDEGVITMCRGCHKLQSLSLSGCTALTDAVLNALGHNCPQLRILEVSSCSQLSDAGFQVLARNCHELEKMDLEECILITDATLMQLSINCPRLTVLSLSHCELITDDGIRHLTNGACSHERLTVLELDNCPLVTDASLEHL-KGCQSLQRVELYDCQQIT 391          
BLAST of SMED30031490 vs. Ensembl Sea Lamprey
Match: FBXL7 (F-box and leucine rich repeat protein 7 [Source:HGNC Symbol;Acc:HGNC:13604])

HSP 1 Score: 64.3142 bits (155), Expect = 7.396e-12
Identity = 41/142 (28.87%), Postives = 67/142 (47.18%), Query Frame = 1
Query:  397 TDKGLTNILPNFKLLRVVHLN--NCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS-RYI 810
            +D GL  +       R+ +L   +C  ITD  +  L + CP +  +N+ GC  + D  + SL   C  + AL V    RVSD+G+ +L+  +    L+ + L GC  ++   +  L+  C  L  L+   C   T  S RY+
Sbjct:  144 SDLGLREVAAALGA-RLAYLGAAHCGRITDGGMRHLGQRCPALRYVNVRGCEAVTDAGVGSLARGCLALAALDVGSCPRVSDLGLVTLAARQ--PGLRCVGLRGCGAVSGAGLRALADGCPQLRRLSVQGCDVATAESLRYV 282          

HSP 2 Score: 55.8398 bits (133), Expect = 4.138e-9
Identity = 39/149 (26.17%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  355 SLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVES-CSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            SL  A +R+  V+          PN   L   ++  C  + D ++ +L+  CP +  I+ S C L  D  L  +  +  + +  L  A   R++D G+  L Q +C   L+ + + GC  +TD  +  L+R C+ L  L   +C +++D
Sbjct:   90 SLEAAALRSLAVHC---------PNLTHL---YVRRCPALGDGALRALARGCPRLRAISFSDCPLPSDLGLREVAAALGARLAYLGAAHCGRITDGGMRHLGQ-RC-PALRYVNVRGCEAVTDAGVGSLARGCLALAALDVGSCPRVSD 224          

HSP 3 Score: 52.7582 bits (125), Expect = 3.859e-8
Identity = 29/120 (24.17%), Postives = 56/120 (46.67%), Query Frame = 1
Query:  391 NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTV-ARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFC 747
             ITD G+ ++      LR V++  C  +TD  + SL+  C  +  +++  C  + D  L++L      ++ + +     VS  G+ +L+       L+ L + GC   T  S+ ++ R C
Sbjct:  169 RITDGGMRHLGQRCPALRYVNVRGCEAVTDAGVGSLARGCLALAALDVGSCPRVSDLGLVTLAARQPGLRCVGLRGCGAVSGAGLRALADG--CPQLRRLSVQGCDVATAESLRYVRRRC 286          
BLAST of SMED30031490 vs. Ensembl Yeast
Match: GRR1 (F-box protein component of an SCF ubiquitin-ligase complex; modular substrate specificity factor which associates with core SCF (Cdc53p, Skp1p and Hrt1p/Rbx1p) to form the SCF(Grr1) complex; SCF(Grr1) acts as a ubiquitin-protein ligase directing ubiquitination of substrates such as: Gic2p, Mks1p, Mth1p, Cln1p, Cln2p and Cln3p; involved in carbon catabolite repression, glucose-dependent divalent cation transport, glucose transport, morphogenesis, and sulfite detoxification [Source:SGD;Acc:S000003850])

HSP 1 Score: 48.9062 bits (115), Expect = 9.686e-7
Identity = 42/146 (28.77%), Postives = 75/146 (51.37%), Query Frame = 1
Query:  295 YGNDVTDDIL-EYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVA-RTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSI 726
            +  ++TD++  E +KV  ++ SL +  +     NITDK + +I+     LR V L  C  ITD S+  LS+   N++ ++   C  I D  + +L  SC+ I+ +  A  T +++  +Y L+    +  LK + L  C  +TD  +
Sbjct:  553 HNTNITDNLFQELSKVVDDMPSLRLIDLSGCE-NITDKTIESIVNLAPKLRNVFLGKCSRITDASLFQLSKLGKNLQTVHFGHCFNITDNGVRALFHSCTRIQYVDFACCTNLTNRTLYELAD---LPKLKRIGLVKCTQMTDEGL 694          

HSP 2 Score: 46.9802 bits (110), Expect = 3.996e-6
Identity = 42/184 (22.83%), Postives = 84/184 (45.65%), Query Frame = 1
Query:  277 VNKLDLYG-NDVTDDILE-YTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQS-KCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            +  +D+ G  DV+DD+ +     C  +    +   RN    +T   L N + +  +L+ + +     + DE +  L+  CP +  ++++    + D SL+ L+     ++   +   T ++D     LS+    + +L+ + L GC  ITD +IE +      L  +    C +ITD S + L+
Sbjct:  442 LQSVDITGIRDVSDDVFDTLATYCPRVQGFYVPQARN----VTFDSLRNFIVHSPMLKRIKITANNNMNDELVELLANKCPLLVEVDITLSPNVTDSSLLKLLTRLVQLREFRITHNTNITDNLFQELSKVVDDMPSLRLIDLSGCENITDKTIESIVNLAPKLRNVFLGKCSRITDASLFQLS 621          
BLAST of SMED30031490 vs. Ensembl Nematostella
Match: EDO43749 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXZ5])

HSP 1 Score: 157.918 bits (398), Expect = 6.682e-46
Identity = 87/253 (34.39%), Postives = 141/253 (55.73%), Query Frame = 1
Query:  109 LQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSI 867
            L +L   CIR ++         L  LP   K  ++ +  KRG  +   + ++ +  +  LDL  +D +D+ L   +VCK L  L +  V++   NIT  G+  I  +   L+ V+L  C  I DE++I+L+ENCP +  +NL GC  I D+SL +L +    +++L V++T+++D GI+SL+   C  +LKEL L  C  ITD+ +E +   C ++ IL F NC  +TD SRY +    +R G  MKQ+ W++
Sbjct:   11 LDSLQTSCIRAIADHVSQHKGGLKDLPREVKDNLVLLFSKRGLLSDDVLPKIVSPLIRDLDLSESDTSDEGLMALQVCKKLRKLDLNAVKDRRENITSNGIITISQSCHDLQTVYLRRCTSIGDEAVIALAENCPQLMHLNLGGCLQITDRSLKALAKHSKFLQSLNVSKTKITDTGIFSLTSGCCTQSLKELHLAHCKDITDDGVESVLMLCPNVTILIFHNCPLVTDRSRYAMEEVAQRGGV-MKQLSWTV 262          
BLAST of SMED30031490 vs. Ensembl Nematostella
Match: EDO38838 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBR5])

HSP 1 Score: 78.1814 bits (191), Expect = 8.828e-17
Identity = 52/173 (30.06%), Postives = 98/173 (56.65%), Query Frame = 1
Query:  325 EYTKVCKNLTSLTIATVRNFPVN--ITDKGLTNILPNFKLLRVVHLNN--CRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFME 828
            E+  +C++         R+  V+  ITDK + +++     +R++  ++  C  +TD S+  ++ +CP ++ +NL+G +LI ++ L ++  SC +++ L ++  +RVSD G+ +L+ SKC   L++L L  C  +TD S+  +SR C  L  L  S C +ITD     L+ + E
Sbjct:   27 EWNILCRDSRFWGAVDFRSCHVSGEITDKIVESVVAYSCKIRIIDFSSKRCHAVTDTSLTHVANHCPGLQRLNLTGKSLITNRGLGAIARSCGDLEQLFLSGCSRVSDRGVRTLA-SKCPK-LEKLSLSNCLRLTDKSLSAISRKCSSLKTLDLSGCVKITDRGIKALSRYSE 197          

HSP 2 Score: 56.9954 bits (136), Expect = 1.821e-9
Identity = 37/122 (30.33%), Postives = 56/122 (45.90%), Query Frame = 1
Query:  394 ITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLN 759
            IT++GL  I  +   L  + L+ C  ++D  + +L+  CP +E ++LS C  + DKSL ++   CS                           +LK L L GC  ITD  I+ LSR+  HL 
Sbjct:  106 ITNRGLGAIARSCGDLEQLFLSGCSRVSDRGVRTLASKCPKLEKLSLSNCLRLTDKSLSAISRKCS---------------------------SLKTLDLSGCVKITDRGIKALSRYSEHLT 200          
BLAST of SMED30031490 vs. Ensembl Nematostella
Match: EDO34009 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQL5])

HSP 1 Score: 68.1662 bits (165), Expect = 6.754e-13
Identity = 44/160 (27.50%), Postives = 77/160 (48.12%), Query Frame = 1
Query:  340 CKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQ------SKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            C  LT+LT  T+  F                 LL+ + L+ CR+++ + II +S  C ++E+++L+GC  I D S+ SL   C+ +K + +        G YS+S        +   +L +L L GC  ++  +I  +  +C  L  L   +CR +T+ S
Sbjct:  115 CSTLTNLTSFTIAEF---------------CPLLKEIRLSECRWVSPDGIIQVSLCCKDLEIVDLTGCWEITDHSVCSLASFCNKLKVILLN-------GCYSISDDSVRAIGRLCPSLTDLGLCGCWRVSXPAISHIGEYCSKLKFLAVKDCRDVTEAS 252          
BLAST of SMED30031490 vs. Ensembl Nematostella
Match: EDO45889 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRU9])

HSP 1 Score: 65.4698 bits (158), Expect = 7.195e-12
Identity = 46/138 (33.33%), Postives = 72/138 (52.17%), Query Frame = 1
Query:  388 VNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            V   D GL  +  +  LL  ++L  C  +TD  I  ++ NC  ++ ++ S C  + D SL  + ++   +K L+VA+  VSD GI  + +  CVH LK L + GC  +TD  I F+ + C+ L  L    C  ITD +
Sbjct:  172 VAFDDMGLRTVGLSCGLLENLYLRRCTQVTDVGIRHIANNCRQLKELSTSDCYKVRDFSLKEMAKNIPTLKYLSVAKCPVSDTGIKYIGR-YCVH-LKYLNVRGCEAVTDAGIAFVVQNCLKLRSLDIGKC-AITDSA 306          

HSP 2 Score: 49.2914 bits (116), Expect = 1.500e-6
Identity = 35/158 (22.15%), Postives = 74/158 (46.84%), Query Frame = 1
Query:  343 KNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVH--TLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYI 810
            K L++     VR+F +    K +   +P  K L V        ++D  I  +   C +++ +N+ GC  + D  +  +V++C  +++L + +  ++D  + ++     +H   LK+L + GC  ++ N I+ ++  C ++  L    C    D   YI
Sbjct:  216 KELSTSDCYKVRDFSL----KEMAKNIPTLKYLSVAKCP----VSDTGIKYIGRYCVHLKYLNVRGCEAVTDAGIAFVVQNCLKLRSLDIGKCAITDSALNTIG----IHCPQLKKLSMKGCDRVSVNGIKCIANQCCNIQYLNVQECNLDYDTFVYI 361          
BLAST of SMED30031490 vs. Ensembl Nematostella
Match: EDO45813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRS0])

HSP 1 Score: 63.5438 bits (153), Expect = 4.765e-11
Identity = 52/193 (26.94%), Postives = 88/193 (45.60%), Query Frame = 1
Query:  301 NDVTDDIL-EYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINL--------------------------SGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
              VTD+ L   +K C  L  L I+    +   I+ +GL  +    + L       C  +TDE ++ L+++C  ++VIN+                          SGC  + D +L  L   C  ++ L VA+ ++ +D G  +L +    H L+ + L+ C  ITD+++  LS +C  L  L+ S+C  ITD
Sbjct:  167 GQVTDNSLNALSKGCSKLHHLNIS----WCCQISTQGLKLLAQGCRQLITFIAKGCALLTDEGLLHLTKSCTQLQVINIHSCENVRNAGVEQISKYCKDLRFLCVSGCIQLTDVALQHLGAGCPELRTLEVAQCSQFTDAGFQALCRG--CHNLQRMDLEECVLITDSTLNHLSLWCSGLQKLSLSHCELITD 353          

HSP 2 Score: 60.8474 bits (146), Expect = 3.557e-10
Identity = 50/196 (25.51%), Postives = 93/196 (47.45%), Query Frame = 1
Query:  220 LCKRGKANK-KSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPV----NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQI 789
            LC+  + +K  ++  L  +   ++DL+  D   DI EY  V  NL+      ++   +    ++ D  L     N + +  + L +C+ ITD + ISLS  C  + ++N+S C  + D SL +L + CS +  L ++   ++S  G+  L+Q      L      GC  +TD  +  L++ C  L ++   +C  +
Sbjct:   58 LCRCARVSKLWNVLALDGSNWQRVDLF--DFQTDIEEY--VVSNLSKRCGGFLKKLSLRGCKSVGDYALRIFAQNCRNIEDLVLEDCKKITDSTCISLSTYCSRLSLLNVSSCGQVTDNSLNALSKGCSKLHHLNISWCCQISTQGLKLLAQG--CRQLITFIAKGCALLTDEGLLHLTKSCTQLQVINIHSCENV 247          

HSP 3 Score: 57.3806 bits (137), Expect = 3.905e-9
Identity = 40/166 (24.10%), Postives = 79/166 (47.59%), Query Frame = 1
Query:  394 ITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCI-----------------------------HLNILTFSNCRQITDHS 801
            +TD+GL ++  +   L+V+++++C  + +  +  +S+ C ++  + +SGC  + D +L  L   C  ++ L VA+ ++ +D G  +L +    H L+ + L+ C  ITD+++  LS +C                              HL  L   NC  ITD++
Sbjct:  221 LTDEGLLHLTKSCTQLQVINIHSCENVRNAGVEQISKYCKDLRFLCVSGCIQLTDVALQHLGAGCPELRTLEVAQCSQFTDAGFQALCRG--CHNLQRMDLEECVLITDSTLNHLSLWCSGLQKLSLSHCELITDDGIHQLGASPCATEHLEFLELDNCPLITDNA 384          

HSP 4 Score: 50.447 bits (119), Expect = 6.043e-7
Identity = 46/165 (27.88%), Postives = 72/165 (43.64%), Query Frame = 1
Query:  304 DVTDDILEYTKV-CKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCV-HTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
             +TD  L++    C  L +L +A    F    TD G   +      L+ + L  C  ITD ++  LS  C  ++ ++LS C LI                         +D GI+ L  S C    L+ L+LD C  ITDN++++L + C  L  +   +C+ IT
Sbjct:  272 QLTDVALQHLGAGCPELRTLEVAQCSQF----TDAGFQALCRGCHNLQRMDLEECVLITDSTLNHLSLWCSGLQKLSLSHCELI-------------------------TDDGIHQLGASPCATEHLEFLELDNCPLITDNALDYLVQ-CHQLKRIELYDCQLIT 406          
BLAST of SMED30031490 vs. Ensembl Medaka
Match: fbxl2 (F-box/LRR-repeat protein 2 [Source:NCBI gene;Acc:101157070])

HSP 1 Score: 78.1814 bits (191), Expect = 1.825e-15
Identity = 52/169 (30.77%), Postives = 89/169 (52.66%), Query Frame = 1
Query:  295 YGNDVTDDILEY-TKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            + + +T D +E   + C  L +L +         + D  L +   +   L  +++ +C  ITDE ++SL   C  ++V+ +SGC  I D SL +L  +C  +K L  AR + V+D G   L+++   H L+++ L+ C  +TDN++  LS  C  L  L+ S+C  ITD
Sbjct:  174 WCDQITRDGIEALARGCMGLRALFLRGC----TQLDDGALKHFQKHCPELTTINMQSCTQITDEGLVSLCRGCHKLQVLCVSGCGNITDASLTALGLNCPRLKILEAARCSHVTDAGFTVLARN--CHELEKMDLEECILVTDNTLVQLSIHCPRLQALSLSHCELITD 336          

HSP 2 Score: 73.9442 bits (180), Expect = 4.782e-14
Identity = 52/164 (31.71%), Postives = 86/164 (52.44%), Query Frame = 1
Query:  307 VTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHT-LKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            +TD+ L    +C+    L +  V     NITD  LT +  N   L+++    C ++TD     L+ NC  +E ++L  C L+ D +L+ L   C  ++AL+++    ++D GI +LS S C    L  L+LD C  ITD ++E L + C  L  +   +C+Q+T
Sbjct:  230 ITDEGL--VSLCRGCHKLQVLCVSGCG-NITDASLTALGLNCPRLKILEAARCSHVTDAGFTVLARNCHELEKMDLEECILVTDNTLVQLSIHCPRLQALSLSHCELITDDGIRALSSSTCGQERLTVLELDNCPLITDVTLEHL-KSCHRLERIELYDCQQVT 389          

HSP 3 Score: 70.0922 bits (170), Expect = 7.870e-13
Identity = 46/143 (32.17%), Postives = 74/143 (51.75%), Query Frame = 1
Query:  379 NFPVNITDKGLTNILPN-FKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            NF  +I  + + NI       LR + L  C  + D S+ + ++NC N+EV+NL+GC  I D + +SL + CS ++ L +     +S+  + +LS       L+ L L  C  IT + IE L+R C+ L  L    C Q+ D +
Sbjct:   68 NFQTDIEGRVVENISKRCGGFLRQLSLRGCLSVGDASMKTFAQNCRNIEVLNLNGCTKITDSTCLSLSKFCSKLRQLDLTSCVSISNHSLKALSDG--CRMLETLNLSWCDQITRDGIEALARGCMGLRALFLRGCTQLDDGA 208          

HSP 4 Score: 69.707 bits (169), Expect = 1.182e-12
Identity = 55/198 (27.78%), Postives = 95/198 (47.98%), Query Frame = 1
Query:  232 GKANKKSIKELANNQVNKLDLYG-NDVTDDI-LEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILA 816
            G A+ K+  +   N +  L+L G   +TD   L  +K C  L  L + +     V+I++  L  +    ++L  ++L+ C  IT + I +L+  C  +  + L GC  + D +L    + C  +  + +   T+++D G+ SL +    H L+ L + GC  ITD S+  L   C  L IL  + C  +TD    +LA
Sbjct:  101 GDASMKTFAQNCRN-IEVLNLNGCTKITDSTCLSLSKFCSKLRQLDLTSC----VSISNHSLKALSDGCRMLETLNLSWCDQITRDGIEALARGCMGLRALFLRGCTQLDDGALKHFQKHCPELTTINMQSCTQITDEGLVSLCRG--CHKLQVLCVSGCGNITDASLTALGLNCPRLKILEAARCSHVTDAGFTVLA 291          
BLAST of SMED30031490 vs. Ensembl Medaka
Match: fbxl20 (F-box/LRR-repeat protein 20 [Source:NCBI gene;Acc:101160411])

HSP 1 Score: 75.485 bits (184), Expect = 1.485e-14
Identity = 51/169 (30.18%), Postives = 89/169 (52.66%), Query Frame = 1
Query:  295 YGNDVT-DDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            + + VT D I    + C  L  L +         + D+ L  I      L  ++L  C  ITDE +I++   C  ++ + +SGC  I D  L +L ++C  ++ L VAR ++++D+G  +L+++   H L+++ L+ C  ITD ++  LS  C  L +L+ S+C  ITD
Sbjct:  178 WCDQVTKDGIQALVRSCPGLKGLFLKGC----TQLEDEALKQIGAYCPELVTLNLQTCSQITDEGLITICRGCHRLQSLCVSGCANITDAILHALGQNCPRLRILEVARCSQLTDVGFTTLARN--CHELEKMDLEECVQITDGTLIQLSIHCPRLQVLSLSHCELITD 340          

HSP 2 Score: 70.0922 bits (170), Expect = 7.474e-13
Identity = 59/217 (27.19%), Postives = 107/217 (49.31%), Query Frame = 1
Query:  184 LPNRAKVKI---LDI--LCKRGKANKK-SIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPV----NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVART-RVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            LP    ++I   LD+  LC+  + ++  ++  L  +   ++DL+  D   DI    +V +N++      +R   +     + D  L     N + + ++ LN C  ITD +  SLS+ CP ++ ++L+ C  I + SL +L E C +++ L ++   +V+  GI +L +S     LK L L GC  + D +++ +  +C  L  L    C QITD  
Sbjct:   28 LPKELLLRIFSFLDVVTLCRCAQVSRSWNVLALDGSNWQRIDLF--DFQRDI--EGRVVENISKRCGGFLRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCSSLSKFCPKLKHLDLASCTSITNLSLKALSEGCHSLEQLNISWCDQVTKDGIQALVRS--CPGLKGLFLKGCTQLEDEALKQIGAYCPELVTLNLQTCSQITDEG 238          

HSP 3 Score: 62.7734 bits (151), Expect = 2.176e-10
Identity = 52/165 (31.52%), Postives = 76/165 (46.06%), Query Frame = 1
Query:  304 DVTDDILEY-TKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVH-TLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            ++TD IL    + C  L  L +A        +TD G T +  N   L  + L  C  ITD ++I LS +CP ++V++LS C LI                         +D GI  L    C H  L+ ++LD C  ITD S+E L + C  L+ +   +C+QIT
Sbjct:  259 NITDAILHALGQNCPRLRILEVARCSQ----LTDVGFTTLARNCHELEKMDLEECVQITDGTLIQLSIHCPRLQVLSLSHCELI-------------------------TDDGIRHLGSGPCAHDCLEVIELDNCPLITDASLEHL-KSCHSLDRIELYDCQQIT 393          
BLAST of SMED30031490 vs. Ensembl Medaka
Match: fbxl20 (F-box/LRR-repeat protein 20 [Source:NCBI gene;Acc:101160411])

HSP 1 Score: 75.485 bits (184), Expect = 1.485e-14
Identity = 51/169 (30.18%), Postives = 89/169 (52.66%), Query Frame = 1
Query:  295 YGNDVT-DDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            + + VT D I    + C  L  L +         + D+ L  I      L  ++L  C  ITDE +I++   C  ++ + +SGC  I D  L +L ++C  ++ L VAR ++++D+G  +L+++   H L+++ L+ C  ITD ++  LS  C  L +L+ S+C  ITD
Sbjct:  178 WCDQVTKDGIQALVRSCPGLKGLFLKGC----TQLEDEALKQIGAYCPELVTLNLQTCSQITDEGLITICRGCHRLQSLCVSGCANITDAILHALGQNCPRLRILEVARCSQLTDVGFTTLARN--CHELEKMDLEECVQITDGTLIQLSIHCPRLQVLSLSHCELITD 340          

HSP 2 Score: 70.0922 bits (170), Expect = 7.474e-13
Identity = 59/217 (27.19%), Postives = 107/217 (49.31%), Query Frame = 1
Query:  184 LPNRAKVKI---LDI--LCKRGKANKK-SIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPV----NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVART-RVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHS 801
            LP    ++I   LD+  LC+  + ++  ++  L  +   ++DL+  D   DI    +V +N++      +R   +     + D  L     N + + ++ LN C  ITD +  SLS+ CP ++ ++L+ C  I + SL +L E C +++ L ++   +V+  GI +L +S     LK L L GC  + D +++ +  +C  L  L    C QITD  
Sbjct:   28 LPKELLLRIFSFLDVVTLCRCAQVSRSWNVLALDGSNWQRIDLF--DFQRDI--EGRVVENISKRCGGFLRKLSLRGCLGVGDSALRTFAQNCRNIELLSLNGCTKITDSTCSSLSKFCPKLKHLDLASCTSITNLSLKALSEGCHSLEQLNISWCDQVTKDGIQALVRS--CPGLKGLFLKGCTQLEDEALKQIGAYCPELVTLNLQTCSQITDEG 238          

HSP 3 Score: 62.7734 bits (151), Expect = 2.176e-10
Identity = 52/165 (31.52%), Postives = 76/165 (46.06%), Query Frame = 1
Query:  304 DVTDDILEY-TKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVH-TLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            ++TD IL    + C  L  L +A        +TD G T +  N   L  + L  C  ITD ++I LS +CP ++V++LS C LI                         +D GI  L    C H  L+ ++LD C  ITD S+E L + C  L+ +   +C+QIT
Sbjct:  259 NITDAILHALGQNCPRLRILEVARCSQ----LTDVGFTTLARNCHELEKMDLEECVQITDGTLIQLSIHCPRLQVLSLSHCELI-------------------------TDDGIRHLGSGPCAHDCLEVIELDNCPLITDASLEHL-KSCHSLDRIELYDCQQIT 393          
BLAST of SMED30031490 vs. Ensembl Medaka
Match: si:dkey-192l18.9 (F-box and leucine rich repeat protein 7 [Source:NCBI gene;Acc:101166834])

HSP 1 Score: 64.3142 bits (155), Expect = 5.795e-11
Identity = 43/149 (28.86%), Postives = 80/149 (53.69%), Query Frame = 1
Query:  391 NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSL--ISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFME 828
            ++ D+GL  I  +   L  ++L  C  +TDE++  L+  C ++  ++LS C L+GD  L  ++ +E C  ++ L+VA  TR++D+G+  +++      L+ L   GC  +TD+ +  L+R C  L  L    C  ++D     LA + +
Sbjct:  242 SLEDEGLRTIAAHCPRLTHLYLRRCVRLTDEALRHLALYCSSIRELSLSDCRLVGDFGLREVARLEGC--LRYLSVAHCTRITDVGVRYVARY--CPRLRYLNARGCEGLTDHGLGHLARSCPKLKSLDVGKCPLVSDSGLEQLAMYCQ 386          

HSP 2 Score: 60.8474 bits (146), Expect = 7.475e-10
Identity = 42/170 (24.71%), Postives = 79/170 (46.47%), Query Frame = 1
Query:  307 VTDDILEYTKV-CKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYI 810
            +TD+ L +  + C ++  L+++  R     + D GL  +      LR + + +C  ITD  +  ++  CP +  +N  GC  + D  L  L  SC  +K+L V +   VSD G+  L+       L+ + L  C  ++   ++ L+  C  L +L   +C    +  R++
Sbjct:  269 LTDEALRHLALYCSSIRELSLSDCRL----VGDFGLREVARLEGCLRYLSVAHCTRITDVGVRYVARYCPRLRYLNARGCEGLTDHGLGHLARSCPKLKSLDVGKCPLVSDSGLEQLAMY--CQGLRRVSLRACESVSGRGLKALAANCCELQLLNVQDCEVSPEALRFV 432          

HSP 3 Score: 50.8322 bits (120), Expect = 1.379e-6
Identity = 44/161 (27.33%), Postives = 74/161 (45.96%), Query Frame = 1
Query:  358 LTIATVR-NFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKC--------------VHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            LT+ TV  N    +TD+GL  +      LR + +  C  I++ ++  +   CPN+E +NLSGC+ +   + ISL +  S    L ++      I I+ L  + C                 L  L L  C  +TD ++  L+ +C  +  L+ S+CR + D
Sbjct:  144 LTLETVVVNGCKRLTDRGLHVLAQCCPELRRLEVAGCYNISNGAVFEVVTRCPNLEHLNLSGCSKV---TCISLTQEAS----LQLSPLHGQQISIHYLDMTDCFSLEDEGLRTIAAHCPRLTHLYLRRCVRLTDEALRHLALYCSSIRELSLSDCRLVGD 297          
BLAST of SMED30031490 vs. Ensembl Medaka
Match: si:dkey-192l18.9 (F-box and leucine rich repeat protein 7 [Source:NCBI gene;Acc:101166834])

HSP 1 Score: 64.6994 bits (156), Expect = 5.861e-11
Identity = 43/149 (28.86%), Postives = 80/149 (53.69%), Query Frame = 1
Query:  391 NITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSL--ISLVESCSNIKALTVAR-TRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFME 828
            ++ D+GL  I  +   L  ++L  C  +TDE++  L+  C ++  ++LS C L+GD  L  ++ +E C  ++ L+VA  TR++D+G+  +++      L+ L   GC  +TD+ +  L+R C  L  L    C  ++D     LA + +
Sbjct:  275 SLEDEGLRTIAAHCPRLTHLYLRRCVRLTDEALRHLALYCSSIRELSLSDCRLVGDFGLREVARLEGC--LRYLSVAHCTRITDVGVRYVARY--CPRLRYLNARGCEGLTDHGLGHLARSCPKLKSLDVGKCPLVSDSGLEQLAMYCQ 419          

HSP 2 Score: 60.8474 bits (146), Expect = 8.004e-10
Identity = 42/170 (24.71%), Postives = 79/170 (46.47%), Query Frame = 1
Query:  307 VTDDILEYTKV-CKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTR-VSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYI 810
            +TD+ L +  + C ++  L+++  R     + D GL  +      LR + + +C  ITD  +  ++  CP +  +N  GC  + D  L  L  SC  +K+L V +   VSD G+  L+       L+ + L  C  ++   ++ L+  C  L +L   +C    +  R++
Sbjct:  302 LTDEALRHLALYCSSIRELSLSDCRL----VGDFGLREVARLEGCLRYLSVAHCTRITDVGVRYVARYCPRLRYLNARGCEGLTDHGLGHLARSCPKLKSLDVGKCPLVSDSGLEQLAMY--CQGLRRVSLRACESVSGRGLKALAANCCELQLLNVQDCEVSPEALRFV 465          

HSP 3 Score: 50.8322 bits (120), Expect = 1.366e-6
Identity = 44/161 (27.33%), Postives = 74/161 (45.96%), Query Frame = 1
Query:  358 LTIATVR-NFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKC--------------VHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITD 795
            LT+ TV  N    +TD+GL  +      LR + +  C  I++ ++  +   CPN+E +NLSGC+ +   + ISL +  S    L ++      I I+ L  + C                 L  L L  C  +TD ++  L+ +C  +  L+ S+CR + D
Sbjct:  177 LTLETVVVNGCKRLTDRGLHVLAQCCPELRRLEVAGCYNISNGAVFEVVTRCPNLEHLNLSGCSKV---TCISLTQEAS----LQLSPLHGQQISIHYLDMTDCFSLEDEGLRTIAAHCPRLTHLYLRRCVRLTDEALRHLALYCSSIRELSLSDCRLVGD 330          
BLAST of SMED30031490 vs. Planmine SMEST
Match: SMESG000017778.1 (SMESG000017778.1)

HSP 1 Score: 536.569 bits (1381), Expect = 0.000e+0
Identity = 263/263 (100.00%), Postives = 263/263 (100.00%), Query Frame = 1
Query:   85 MVNQNFYQLQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSISV 873
            MVNQNFYQLQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSISV
Sbjct:    1 MVNQNFYQLQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSISV 263          
BLAST of SMED30031490 vs. Planmine SMEST
Match: SMESG000017778.1 (SMESG000017778.1)

HSP 1 Score: 483.797 bits (1244), Expect = 8.561e-174
Identity = 238/238 (100.00%), Postives = 238/238 (100.00%), Query Frame = 1
Query:  160 MFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSISV 873
            MFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSISV
Sbjct:    1 MFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERSGSQMKQMFWSISV 238          
BLAST of SMED30031490 vs. Planmine SMEST
Match: SMESG000061329.1 (SMESG000061329.1)

HSP 1 Score: 153.68 bits (387), Expect = 2.628e-44
Identity = 84/236 (35.59%), Postives = 135/236 (57.20%), Query Frame = 1
Query:   85 MVNQNFYQLQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            MV  + +  Q L +LC R +   +  +     +L N  K  I+ ILCK+GK N  ++  L +  + K+DL   D+  ++L    VC NL  L + +++ +  ++ D GLT +    K L+ + L  C  I+D+ II+L   CP ++++NL+GC  I D +L +L + C  ++ LTVA T +SD G+  ++QSK    L+E+ LDGC  ITD+SI  L + C  L +LT+SNC+  T
Sbjct:    1 MVGLSCFNTQCLSELCCRNIISNFIPYENVFQYLSNNNKENIVKILCKKGKLNSNNLYYLGHEFIKKIDLSFCDINSELLSQLTVCINLRELILDSIKGYRYDVHDSGLTILFSKLKRLQNIQLKRCAAISDKPIIALVTTCPEIQILNLNGCLKISDNTLEALADHCFKLRVLTVANTNISDKGLAYIAQSKFASKLEEVNLDGCSKITDSSIYNLEKNCFGLKLLTYSNCQMTT 236          
BLAST of SMED30031490 vs. Planmine SMEST
Match: SMESG000051239.1 (SMESG000051239.1)

HSP 1 Score: 134.42 bits (337), Expect = 7.168e-37
Identity = 79/231 (34.20%), Postives = 138/231 (59.74%), Query Frame = 1
Query:  100 FYQLQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQIT 792
            ++ +QTL +LCIR +++ +  + +D   +P   K ++L ++ KR     +S+ +L  + + K+DL    + + I +   +CK LT + +   R    ++TD+GL  +      LR + L NC  ITD++I+ +S+ C  +E +NL  C  I D SL SL E  +N+  + + +T++SD+GI +L++S C + LKE+Q+D C  +T+ SIE LS  C+ L++ TFSNC  I+
Sbjct:    3 WFSVQTLQELCIRFLAYNHIRYEKDFGIIPESMKNRLLSLILKRRYLQTESVLKLMVSTIRKIDLSSISLDERIFKKLSLCKYLTFVNLNNDRCPRYDVTDEGLITMTSGCSHLRNIQLRNCVLITDDAILYISKRCAQLENLNLYNCIQISDSSLESLSEYATNLIGINLVKTQISDLGIKTLAESSCANKLKEIQIDSCKGVTNKSIELLSTSCLKLHLFTFSNCYNIS 233          
BLAST of SMED30031490 vs. Planmine SMEST
Match: SMESG000018452.1 (SMESG000018452.1)

HSP 1 Score: 116.701 bits (291), Expect = 2.178e-30
Identity = 65/223 (29.15%), Postives = 123/223 (55.16%), Query Frame = 1
Query:  109 LQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRGKANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNFPVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINLSGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKELQLDGCHYITDNSIEFLSRFCIHLNILTFSN 777
            ++TL+ L I K+S  +   I     LPN+ K  +L I    G  + + + +L N    ++DL   + +D +L+  K C NL  + + ++      I+D G  +++ N K L  + L  C  + D SI  +++ CPN+ V++L+ C  + D +LI L + CS +  L +  T+++D G+     ++C   +KEL L+ C+ IT N+I+ L + C +L++++F++
Sbjct:    6 IKTLYLLSISKISLYHSTHIFPFTVLPNKIKNDLLGIFMNNGSLSSEVLSQLVNQDTRRIDLSYCEPSDQMLQCVKSCTNLNKMIVNSISKTHPQISDSGFLHVITNLKYLTTIRLRKCEKLRDFSITIMAQTCPNLVVVDLNDCYKLTDVALIELGKRCSKLLKLCLCGTQITDNGMNQFLTNECRLNIKELLLNSCYGITMNTIKNLPKLCPNLSVISFTD 228          
The following BLAST results are available for this feature:
BLAST of SMED30031490 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AMN15.454e-3628.35antagonist of mitotic exit network 1 homolog [Sour... [more]
AMN11.715e-3428.94antagonist of mitotic exit network 1 homolog [Sour... [more]
AMN11.715e-3428.94antagonist of mitotic exit network 1 homolog [Sour... [more]
AMN17.812e-2828.57antagonist of mitotic exit network 1 homolog [Sour... [more]
FBXL24.000e-1532.73F-box and leucine rich repeat protein 2 [Source:HG... [more]
back to top
BLAST of SMED30031490 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxl-15.663e-1537.50Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-15.663e-1537.50Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-15.663e-1537.50Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-15.663e-1537.50Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
fbxl-18.107e-1537.50Uncharacterized F-box/LRR-repeat protein C02F5.7 ... [more]
back to top
BLAST of SMED30031490 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Fbxl71.706e-1428.93gene:FBgn0038385 transcript:FBtr0083201[more]
CG90036.493e-1236.29gene:FBgn0033639 transcript:FBtr0330632[more]
CG90037.049e-1236.29gene:FBgn0033639 transcript:FBtr0113069[more]
CG90037.049e-1236.29gene:FBgn0033639 transcript:FBtr0330634[more]
CG90037.116e-1236.29gene:FBgn0033639 transcript:FBtr0088088[more]
back to top
BLAST of SMED30031490 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
amn11.362e-3129.92antagonist of mitotic exit network 1 homolog (S. c... [more]
amn11.362e-3129.92antagonist of mitotic exit network 1 homolog (S. c... [more]
amn13.830e-2029.69antagonist of mitotic exit network 1 homolog (S. c... [more]
fbxl205.692e-1530.77F-box and leucine-rich repeat protein 20 [Source:Z... [more]
fbxl21.517e-1428.99F-box and leucine-rich repeat protein 2 [Source:ZF... [more]
back to top
BLAST of SMED30031490 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adcy39.668e-1429.38adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-10... [more]
adcy31.024e-1329.38adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-10... [more]
adcy31.153e-1329.38adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-10... [more]
adcy31.157e-1329.38adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-10... [more]
adcy31.175e-1329.38adenylate cyclase 3 [Source:Xenbase;Acc:XB-GENE-10... [more]
back to top
BLAST of SMED30031490 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Amn11.980e-3629.20antagonist of mitotic exit network 1 [Source:MGI S... [more]
Amn19.841e-3130.05antagonist of mitotic exit network 1 [Source:MGI S... [more]
Fbxl23.067e-1633.33F-box and leucine-rich repeat protein 2 [Source:MG... [more]
Fbxl23.067e-1633.33F-box and leucine-rich repeat protein 2 [Source:MG... [more]
Fbxl202.325e-1429.94F-box and leucine-rich repeat protein 20 [Source:M... [more]
back to top
BLAST of SMED30031490 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5U201|AMN1_RAT4.720e-3730.00Protein AMN1 homolog OS=Rattus norvegicus OX=10116... [more]
sp|Q5R8X9|AMN1_PONAB1.148e-3528.74Protein AMN1 homolog OS=Pongo abelii OX=9601 GN=AM... [more]
sp|Q8IY45|AMN1_HUMAN2.619e-3528.35Protein AMN1 homolog OS=Homo sapiens OX=9606 GN=AM... [more]
sp|Q32L08|AMN1_BOVIN3.508e-3529.53Protein AMN1 homolog OS=Bos taurus OX=9913 GN=AMN1... [more]
sp|Q0P4D1|AMN1_DANRE1.028e-3029.92Protein AMN1 homolog OS=Danio rerio OX=7955 GN=amn... [more]
back to top
BLAST of SMED30031490 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3K2942.840e-4732.67protein AMN1 homolog OS=Lingula unguis OX=7574 GN=... [more]
A7RXZ54.831e-4234.39Predicted protein OS=Nematostella vectensis OX=453... [more]
A0A3M6TQ811.480e-4133.98Uncharacterized protein OS=Pocillopora damicornis ... [more]
A0A286XRP21.180e-3630.31Antagonist of mitotic exit network 1 homolog OS=Ca... [more]
A0A3L7H6H04.926e-3630.80AMN1 OS=Cricetulus griseus OX=10029 GN=CgPICR_0164... [more]
back to top
BLAST of SMED30031490 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
amn12.869e-2626.48antagonist of mitotic exit network 1 homolog [Sour... [more]
amn12.372e-2226.52antagonist of mitotic exit network 1 homolog [Sour... [more]
fbxl25.600e-1529.59F-box and leucine-rich repeat protein 2 [Source:ZF... [more]
fbxl207.753e-1530.18F-box and leucine rich repeat protein 20 [Source:N... [more]
si:dkey-192l18.95.309e-1330.34F-box/LRR-repeat protein 7-like [Source:NCBI gene;... [more]
back to top
BLAST of SMED30031490 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
amn18.261e-3930.58antagonist of mitotic exit network 1 homolog (S. c... [more]
FBXL78.358e-1428.57F-box and leucine rich repeat protein 7 [Source:HG... [more]
ENSPMAT00000003881.18.865e-1428.40pep scaffold:Pmarinus_7.0:GL477033:429527:460683:1... [more]
ENSPMAT00000008139.12.278e-1330.77pep scaffold:Pmarinus_7.0:GL476334:657211:690462:-... [more]
FBXL77.396e-1228.87F-box and leucine rich repeat protein 7 [Source:HG... [more]
back to top
BLAST of SMED30031490 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GRR19.686e-728.77F-box protein component of an SCF ubiquitin-ligase... [more]
back to top
BLAST of SMED30031490 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO437496.682e-4634.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388388.828e-1730.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO340096.754e-1327.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458897.195e-1233.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458134.765e-1126.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30031490 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fbxl21.825e-1530.77F-box/LRR-repeat protein 2 [Source:NCBI gene;Acc:1... [more]
fbxl201.485e-1430.18F-box/LRR-repeat protein 20 [Source:NCBI gene;Acc:... [more]
fbxl201.485e-1430.18F-box/LRR-repeat protein 20 [Source:NCBI gene;Acc:... [more]
si:dkey-192l18.95.795e-1128.86F-box and leucine rich repeat protein 7 [Source:NC... [more]
si:dkey-192l18.95.861e-1128.86F-box and leucine rich repeat protein 7 [Source:NC... [more]
back to top
BLAST of SMED30031490 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017778.10.000e+0100.00SMESG000017778.1[more]
SMESG000017778.18.561e-174100.00SMESG000017778.1[more]
SMESG000061329.12.628e-4435.59SMESG000061329.1[more]
SMESG000051239.17.168e-3734.20SMESG000051239.1[more]
SMESG000018452.12.178e-3029.15SMESG000018452.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031490 ID=SMED30031490|Name=SMED30031490|organism=Schmidtea mediterranea sexual|type=transcript|length=1147bp
GAAACGCAAAACGTTTAAAATAATATATAAAAATATAAAATTGAATAGCA
AAAATTTTACATAATTATAATTTAAATCTGAAACATGGTCAATCAAAATT
TTTATCAATTGCAAACTTTATTTGACTTGTGTATTAGAAAAGTTTCCCAT
GAATATTATATGTTTATTGAAGATTTAGATTTCCTTCCCAACAGAGCAAA
AGTAAAAATCCTTGATATTCTATGTAAACGAGGTAAAGCTAATAAAAAGT
CTATTAAAGAGTTAGCTAACAATCAAGTTAATAAATTGGATTTATATGGT
AACGATGTAACGGACGATATCCTAGAATATACAAAAGTTTGTAAAAATCT
AACCTCCCTAACTATTGCAACAGTGAGAAATTTCCCTGTTAATATTACTG
ATAAAGGCCTAACAAATATTCTTCCAAATTTCAAACTGTTGCGAGTTGTC
CATTTAAACAACTGCCGCTACATCACAGATGAGTCAATAATAAGCCTGTC
AGAAAATTGCCCAAATATGGAAGTCATTAATTTATCCGGATGCAATTTGA
TCGGGGACAAATCCCTCATATCTCTCGTGGAATCTTGTTCAAACATAAAA
GCCCTAACGGTTGCTAGGACACGAGTCAGCGACATTGGCATTTATTCGTT
GTCACAGAGCAAATGCGTCCATACATTGAAAGAGCTGCAATTAGATGGCT
GCCATTACATCACAGATAATTCAATCGAATTCCTCAGCAGATTTTGCATT
CATTTAAACATTCTTACATTTTCCAACTGCCGGCAAATTACAGACCATTC
TAGATACATTCTCGCCAACTTTATGGAGCGGTCAGGCAGTCAAATGAAGC
AAATGTTCTGGTCGATCTCTGTTTGATTTCTCACGTTGAACTATTATTAG
ATTGCCATTATCATTATTATCATTATATATTTAATCAATCAATTGTGCAG
TTTGTCGTGGTTTGTGATTTATTGTATTTATTCTTTTTTTTACAAACGTT
TCATCGGTTTTACATTTGTTTTTGATTATGTGATTTAATTTTCAATTTAA
TTTTTTCTTCCCGTTTTACAATTGAAAAATAATTATTATCCTTTATTTAC
ATGTTCAATTTTGATTTGACAAATAAATTTTATTTCGTTGAAAACAA
back to top

protein sequence of SMED30031490-orf-1

>SMED30031490-orf-1 ID=SMED30031490-orf-1|Name=SMED30031490-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=264bp
MVNQNFYQLQTLFDLCIRKVSHEYYMFIEDLDFLPNRAKVKILDILCKRG
KANKKSIKELANNQVNKLDLYGNDVTDDILEYTKVCKNLTSLTIATVRNF
PVNITDKGLTNILPNFKLLRVVHLNNCRYITDESIISLSENCPNMEVINL
SGCNLIGDKSLISLVESCSNIKALTVARTRVSDIGIYSLSQSKCVHTLKE
LQLDGCHYITDNSIEFLSRFCIHLNILTFSNCRQITDHSRYILANFMERS
GSQMKQMFWSISV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR006553Leu-rich_rpt_Cys-con_subtyp
IPR001611Leu-rich_rpt
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004842ubiquitin-protein transferase activity
GO:0005516calmodulin binding
GO:0019903protein phosphatase binding
GO:0036312phosphatidylinositol 3-kinase regulatory subunit binding
Vocabulary: biological process
TermDefinition
GO:0006511ubiquitin-dependent protein catabolic process
GO:0006513protein monoubiquitination
GO:0010506regulation of autophagy
GO:0014066regulation of phosphatidylinositol 3-kinase signaling
GO:0016567protein ubiquitination
GO:0031146SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0019005SCF ubiquitin ligase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006553Leucine-rich repeat, cysteine-containing subtypeSMARTSM00367LRR_CC_2coord: 221..246
e-value: 0.59
score: 19.2
coord: 116..141
e-value: 1.1
score: 18.2
coord: 142..167
e-value: 0.036
score: 23.2
coord: 168..192
e-value: 16.0
score: 12.9
coord: 86..115
e-value: 160.0
score: 5.2
coord: 195..220
e-value: 21.0
score: 12.1
IPR001611Leucine-rich repeatPFAMPF13516LRR_6coord: 141..164
e-value: 0.03
score: 14.4
coord: 196..217
e-value: 0.65
score: 10.2
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 3..255
e-value: 2.9E-34
score: 120.2
NoneNo IPR availablePANTHERPTHR13382MITOCHONDRIAL ATP SYNTHASE COUPLING FACTOR Bcoord: 55..189
NoneNo IPR availablePANTHERPTHR13382MITOCHONDRIAL ATP SYNTHASE COUPLING FACTOR Bcoord: 179..239
NoneNo IPR availablePANTHERPTHR13382:SF6SCF E3 UBIQUITIN LIGASE COMPLEX F-BOX PROTEIN GRR1coord: 55..189
coord: 179..239
NoneNo IPR availableSUPERFAMILYSSF52047RNI-likecoord: 65..244