SMED30031471

Overview
NameSMED30031471
Smed IDSMED30031471
Length (bp)3055
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30031471 (SMED30031471) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30031471 (SMED30031471) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30031471 (SMED30031471) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30031471 (SMED30031471) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031471

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031471SMESG000050535.1 SMESG000050533.1 dd_Smed_v4_5107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031471SMESG000050535.1 SMESG000050533.1 dd_Smed_v4_5107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031471SMESG000050535.1 SMESG000050533.1 dd_Smed_v4_5107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031471SMESG000050535.1 SMESG000050533.1 dd_Smed_v4_5107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031471SMESG000050535.1 SMESG000050533.1 dd_Smed_v4_5107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031471SMESG000050535.1 SMESG000050533.1 dd_Smed_v4_5107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031471SMESG000050535.1 SMESG000050533.1 dd_Smed_v4_5107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031471SMESG000050535.1 SMESG000050533.1 dd_Smed_v4_5107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031471SMESG000050535.1 SMESG000050533.1 dd_Smed_v4_5107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031471SMESG000050535.1 SMESG000050533.1 dd_Smed_v4_5107_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30031471 vs. Planmine SMEST
Match: SMESG000050533.1 (SMESG000050533.1)

HSP 1 Score: 968.763 bits (2503), Expect = 0.000e+0
Identity = 515/516 (99.81%), Postives = 515/516 (99.81%), Query Frame = 3
Query: 1434 MTNKRKGEIITSSPIKITKLDSSYSFEIVNNPIFTPHKSSPDGLINLFALVLNLVPLKLPIDNGVCTILTNSCVTIQEGIQEPALRNIKINHESCKANGVSEIIANIYSIFNEPEKEVLNISFMKFIWVKYFPQELSNFNLMILFYRFVKLLMLYTMFNKSLVTXXXXXXXXXXXXXXXNFNFKSSVSTFKKRQLSCFSHKFDKYFKEHDQLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFTVGPLLNYFISSINSIHNKMEPFQIEVVYGAIRTLRFCLRKINLKLVQTSFTKPYLFDFKTKNMDHHCTEVKKEINWLCKELKYYQCVLFTDKHYDFINCILDFSWRLECTIKVNSDPLQPKPICEPLVFHNPMQFVQTFTTFQCPIFIQYHPESELEYLNTCLKTKWIGILHEAFIGSLPEPCGARIIKEINVLLPPTWGLFTFNEAIIESSKMYYERFQKLAETDPSGWYTKFSKTKHCAMNWLIQYQLPVDGLEVLHDYQYVLESKYKYS 2981
            MTNKRKGEIITSSPIKITKLDSSYSFEIVNNPIFTPHKSSPDGLINLFALVLNLVPLKLPIDNGVCTILTNSCVTIQEGIQEPALRNIKINHESCKANGVSEIIANIYSIFNEPEKEVLNISFMKFIWVKYFPQELSNFNLMILFYRFVKLLMLYTMFNKSLVTKKLVIDVIEKIDVIVNFNFKSSVSTFKKRQLSCFSHKFDKYFKEHDQLHVLYSKLSNSKSLVVNSKKLDITIKKKKIEFTVGPLLNYFISSINSIHNKMEPFQIEVVYGAIRTLRFCLRKINLKLVQTSFTKPYLFDFKTKNMDHHCTEVKKEINWLCKELKYYQCVLFTDKHYDFINCILDFSWRLECTIKVNSDPLQPKPICEPLVFHNPMQFVQTFT FQCPIFIQYHPESELEYLNTCLKTKWIGILHEAFIGSLPEPCGARIIKEINVLLPPTWGLFTFNEAIIESSKMYYERFQKLAETDPSGWYTKFSKTKHCAMNWLIQYQLPVDGLEVLHDYQYVLESKYKYS
Sbjct:    1 MTNKRKGEIITSSPIKITKLDSSYSFEIVNNPIFTPHKSSPDGLINLFALVLNLVPLKLPIDNGVCTILTNSCVTIQEGIQEPALRNIKINHESCKANGVSEIIANIYSIFNEPEKEVLNISFMKFIWVKYFPQELSNFNLMILFYRFVKLLMLYTMFNKSLVTKKLVIDVIEKIDVIVNFNFKSSVSTFKKRQLSCFSHKFDKYFKEHDQLHVLYSKLSNSKSLVVNSKKLDITIKKKKIEFTVGPLLNYFISSINSIHNKMEPFQIEVVYGAIRTLRFCLRKINLKLVQTSFTKPYLFDFKTKNMDHHCTEVKKEINWLCKELKYYQCVLFTDKHYDFINCILDFSWRLECTIKVNSDPLQPKPICEPLVFHNPMQFVQTFTAFQCPIFIQYHPESELEYLNTCLKTKWIGILHEAFIGSLPEPCGARIIKEINVLLPPTWGLFTFNEAIIESSKMYYERFQKLAETDPSGWYTKFSKTKHCAMNWLIQYQLPVDGLEVLHDYQYVLESKYKYS 516          
BLAST of SMED30031471 vs. Planmine SMEST
Match: SMESG000050535.1 (SMESG000050535.1)

HSP 1 Score: 532.332 bits (1370), Expect = 0.000e+0
Identity = 258/258 (100.00%), Postives = 258/258 (100.00%), Query Frame = 3
Query:  120 MIICSPSLAISNDTSGDYHTFIPDKYELIFNNSMCDIAFIVTHQPLMSKLDKLQNYFQSELKFSTYCTYIEDNESLKFYLRDLKTHDVSYALLLHDSFENRNFYDLYVLHKDEVLPNITLEKVISLVRSDFDNMMSKVKILKNIPSKWPHSVKPEDLEYSKINDKLRYYFCLLSDSRTLSIEELNYVNDYLVTRKELLQISKTKNIFEKDNFIQPSKFVFKGPNRTGTVIKLSRAEDYDSEPSLKYTTLDVGFAGSLS 893
            MIICSPSLAISNDTSGDYHTFIPDKYELIFNNSMCDIAFIVTHQPLMSKLDKLQNYFQSELKFSTYCTYIEDNESLKFYLRDLKTHDVSYALLLHDSFENRNFYDLYVLHKDEVLPNITLEKVISLVRSDFDNMMSKVKILKNIPSKWPHSVKPEDLEYSKINDKLRYYFCLLSDSRTLSIEELNYVNDYLVTRKELLQISKTKNIFEKDNFIQPSKFVFKGPNRTGTVIKLSRAEDYDSEPSLKYTTLDVGFAGSLS
Sbjct:    1 MIICSPSLAISNDTSGDYHTFIPDKYELIFNNSMCDIAFIVTHQPLMSKLDKLQNYFQSELKFSTYCTYIEDNESLKFYLRDLKTHDVSYALLLHDSFENRNFYDLYVLHKDEVLPNITLEKVISLVRSDFDNMMSKVKILKNIPSKWPHSVKPEDLEYSKINDKLRYYFCLLSDSRTLSIEELNYVNDYLVTRKELLQISKTKNIFEKDNFIQPSKFVFKGPNRTGTVIKLSRAEDYDSEPSLKYTTLDVGFAGSLS 258          

HSP 2 Score: 131.339 bits (329), Expect = 0.000e+0
Identity = 96/99 (96.97%), Postives = 98/99 (98.99%), Query Frame = 1
Query:  895 RLHHQVSSHSKSKRLNRHPFRMRSYKAQMYSLLKDXXXXXXXXXKSLXXXXXXXXXXXXXXXXXXXIIEIISLLSGRFVLRKSNATNSYPISRKSIKFW 1191
            RLHHQVSSHSKSKRLNRHPFRMRSYKAQMYSLLKDPRIIIPIRRKSLRNP+RTNQKRNK+N NGNQIIEIISLLSGRFVLRKSNATNSYPISRKSIKFW
Sbjct:  259 RLHHQVSSHSKSKRLNRHPFRMRSYKAQMYSLLKDPRIIIPIRRKSLRNPDRTNQKRNKKNRNGNQIIEIISLLSGRFVLRKSNATNSYPISRKSIKFW 357          
BLAST of SMED30031471 vs. Planmine SMEST
Match: SMESG000050537.1 (SMESG000050537.1)

HSP 1 Score: 345.51 bits (885), Expect = 2.293e-103
Identity = 228/632 (36.08%), Postives = 367/632 (58.07%), Query Frame = 3
Query: 1134 AEIKRNKFVSNLEKIDKVLVKTAQMSKLSINYLKAT-LSNNFSQKVDRSVTIKYFKSSYYKNRMNYVAPMLVVRPLVPLNQNKKLVDLTSASDGDNQNSDKMTNKRKGEIITSSPI-----KITKLDSSYSFEI-------VNNPIFTPH----KSSPDGLINLFALVLNLVPLKLPIDNGVCTILTNSCVTIQEGIQEPALRNIKINHESCKANGVSEIIANIYSIFNEPEKEVLNISFMKFIWVKYFPQELSNFNLMILFYRFVKLLMLYTMFNKSLVTXXXXXXXXXXXXXXXNFNFKSSVSTFKKRQLSCFSHKFDKYFKEHDQLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFTVGPLLNYFISSINSIHNKMEPFQIEVVYGAIRTLRFCLRKI-NLKLVQTSFTKPYLFDFKTKNMDHHCTEVKKEINWLCKELKYYQCVLFTDKHYDFINCILDFSWRLECTIKVNSDPLQPKPICEPLVFHNPMQFVQTFTTFQCPIFIQYHPESELEYLNTCLKTKWIGILHEAFIGSLPEPCGARIIKEINVLLPPTWGLFTFNEAIIESSKMYYERFQKLAETDPSGWYTKFSKTKHCAMNWLIQYQLPVD-GLEVLHDYQYVLESKY 2972
            A+I  N F SNL++I  + +   Q+   S   ++   +    + K + S   +Y KS+Y+ N+  +              ++  ++ L+S S       D +      E ITSS +     K+  LD S S  +       +  P  T      K++PD L+N+F  + + +P  LP DN +  I+ N C  IQ GI EP+L+ +KI++ESCK NG +EI+ +IY I+   EK V +I  +++IW KYFP  LSNF+L+++FY+F+K+L+++ +FN      +++ + +EK+++I NF+F   + +  K+ L+C S  F    + H  LH  Y  L +   + +++KKLD  IKK+KIEF + PLL YF++++ SIH +M+  Q E+VY AIRTLR+CLR I  +    T F  P  F   +++ ++   +++ EI WL  E+KYYQCVLFT+KHYDFINC+LDFS+ +E  I  +SD    +   + LV  +  QF+++F  F+  + +QYH +SE+  L   LK  W+ IL +AF G   +  G RI+KEIN LLP  WGL TF+EA+++++K  Y  + K+A+ +P+GW+  FSK K   + WL   QL ++  +E L   + +L +++
Sbjct:  302 AKIITNTFGSNLQQIKSITIARGQLKPFSYEVIQGGGILKTEAIKKNDSQREEYSKSNYFINQNLW-------------REDDDIISLSSGSCTPPIEYDLIPISPPDEQITSSKVDLGKRKLATLDLSESNSLPKLHKIDLRKPEITASTLVIKNTPDVLVNMFRFIAHAMPYDLPHDNAILNIMINYCNDIQNGIMEPSLKIVKIDYESCKINGANEIVKSIYGIYEVAEKNVEDIVDLQYIWKKYFPDHLSNFSLLVVFYKFIKMLIIFRLFNSQSDRLQIISNTVEKLNLIANFDFYLPLLS-DKQHLNCISELFGNTLESHSDLHTKYFDLPHISEIAISTKKLDNVIKKRKIEFVLSPLLKYFVNTLKSIHQQMKLAQTELVYKAIRTLRYCLRVIYPINSPTTVFIVPKTF---SESGNNGYKDIQDEIKWLLDEIKYYQCVLFTEKHYDFINCVLDFSFVVEGII--DSDSSTSRSNTDSLVVLDTDQFIESFAAFEG-MNLQYHADSEISCLKHFLKESWVQILQKAFRGLSTDGKGKRIVKEINNLLPELWGLKTFDEAVVDAAKCNYTEWTKIAQNNPTGWHESFSKVKFAGIVWLNTNQLSLNKAVEELQRCENMLRNEF 913          

HSP 2 Score: 116.316 bits (290), Expect = 3.584e-26
Identity = 71/176 (40.34%), Postives = 109/176 (61.93%), Query Frame = 3
Query:  198 ELIFNNSMCDIAFIVTHQPLMSKLDKLQNYFQSELKFSTYCTYIEDNESLKFYLRDLKTHDVSYALLLHDSFENRNFYDLYVLHK-DEVLPNITLEKVISLVRSDFDNMMSKVKILKNIPSKWPHSVKPEDLEYSKINDKLRYYFCLLSDSRTLSIEELNYVNDYLVTRKELLQIS 722
            ELIFN    D+A I+TH  L+S + +LQN+F  + KF+T+  YI D   LKF +RDLK H ++YA+++++    +   DLYVL+   E+   + L +V  LVR D  N   ++K L   PSK+PH   P++ E+  +N++ RY  CLLSD+R L ++EL  +N +L  RK  ++ S
Sbjct:   40 ELIFNKPTFDMALIITHTSLISDICELQNFFHKKHKFTTHVIYIPDVSKLKFCIRDLKLHRITYAIVINEYGLIQGKMDLYVLYPIIEIQKRMNLSEVDDLVRDDSYNTSIQIKSLMEKPSKYPH---PKN-EF-HVNNETRYQLCLLSDNRMLKMQELQNLNRFLCQRKAEMERS 210          
BLAST of SMED30031471 vs. Planmine SMEST
Match: SMESG000050537.1 (SMESG000050537.1)

HSP 1 Score: 342.043 bits (876), Expect = 2.534e-102
Identity = 221/618 (35.76%), Postives = 360/618 (58.25%), Query Frame = 3
Query: 1134 AEIKRNKFVSNLEKIDKVLVKTAQMSKLSINYLKAT-LSNNFSQKVDRSVTIKYFKSSYYKNRMNYVAPMLVVRPLVPLNQN--KKLVDLTSASDGDNQNSDKMTNKRKGEIITSSPIKITKLDSSYSFEIVNNPIFTPHKSSPDGLINLFALVLNLVPLKLPIDNGVCTILTNSCVTIQEGIQEPALRNIKINHESCKANGVSEIIANIYSIFNEPEKEVLNISFMKFIWVKYFPQELSNFNLMILFYRFVKLLMLYTMFNKSLVTXXXXXXXXXXXXXXXNFNFKSSVSTFKKRQLSCFSHKFDKYFKEHDQLHXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFTVGPLLNYFISSINSIHNKMEPFQIEVVYGAIRTLRFCLRKI-NLKLVQTSFTKPYLFDFKTKNMDHHCTEVKKEINWLCKELKYYQCVLFTDKHYDFINCILDFSWRLECTIKVNSDPLQPKPICEPLVFHNPMQFVQTFTTFQCPIFIQYHPESELEYLNTCLKTKWIGILHEAFIGSLPEPCGARIIKEINVLLPPTWGLFTFNEAIIESSKMYYERFQKLAETDPSGWYTKFSKTKHCAMNWLIQYQLPVD-GLEVLHDYQYVLESKY 2972
            A+I  N F SNL++I  + +   Q+   S   ++   +    + K + S   +Y KS+Y+                  +NQN  ++  D+ S S G  +    +       +     I + K + + S  ++        K++PD L+N+F  + + +P  LP DN +  I+ N C  IQ GI EP+L+ +KI++ESCK NG +EI+ +IY I+   EK V +I  +++IW KYFP  LSNF+L+++FY+F+K+L+++ +FN      +++ + +EK+++I NF+F   + +  K+ L+C S  F    + H  LH  Y  L +   + +++KKLD  IKK+KIEF + PLL YF++++ SIH +M+  Q E+VY AIRTLR+CLR I  +    T F  P  F   +++ ++   +++ EI WL  E+KYYQCVLFT+KHYDFINC+LDFS+ +E  I  +SD    +   + LV  +  QF+++F  F+  + +QYH +SE+  L   LK  W+ IL +AF G   +  G RI+KEIN LLP  WGL TF+EA+++++K  Y  + K+A+ +P+GW+  FSK K   + WL   QL ++  +E L   + +L +++
Sbjct:  302 AKIITNTFGSNLQQIKSITIARGQLKPFSYEVIQGGGILKTEAIKKNDSQREEYSKSNYF------------------INQNLWREDDDIISLSSGCKRKLATLDLSESNSLPKLHKIDLRKPEITASTLVI--------KNTPDVLVNMFRFIAHAMPYDLPHDNAILNIMINYCNDIQNGIMEPSLKIVKIDYESCKINGANEIVKSIYGIYEVAEKNVEDIVDLQYIWKKYFPDHLSNFSLLVVFYKFIKMLIIFRLFNSQSDRLQIISNTVEKLNLIANFDFYLPLLS-DKQHLNCISELFGNTLESHSDLHTKYFDLPHISEIAISTKKLDNVIKKRKIEFVLSPLLKYFVNTLKSIHQQMKLAQTELVYKAIRTLRYCLRVIYPINSPTTVFIVPKTF---SESGNNGYKDIQDEIKWLLDEIKYYQCVLFTEKHYDFINCVLDFSFVVEGII--DSDSSTSRSNTDSLVVLDTDQFIESFAAFEG-MNLQYHADSEISCLKHFLKESWVQILQKAFRGLSTDGKGKRIVKEINNLLPELWGLKTFDEAVVDAAKCNYTEWTKIAQNNPTGWHESFSKVKFAGIVWLNTNQLSLNKAVEELQRCENMLRNEF 886          

HSP 2 Score: 116.316 bits (290), Expect = 3.668e-26
Identity = 71/176 (40.34%), Postives = 109/176 (61.93%), Query Frame = 3
Query:  198 ELIFNNSMCDIAFIVTHQPLMSKLDKLQNYFQSELKFSTYCTYIEDNESLKFYLRDLKTHDVSYALLLHDSFENRNFYDLYVLHK-DEVLPNITLEKVISLVRSDFDNMMSKVKILKNIPSKWPHSVKPEDLEYSKINDKLRYYFCLLSDSRTLSIEELNYVNDYLVTRKELLQIS 722
            ELIFN    D+A I+TH  L+S + +LQN+F  + KF+T+  YI D   LKF +RDLK H ++YA+++++    +   DLYVL+   E+   + L +V  LVR D  N   ++K L   PSK+PH   P++ E+  +N++ RY  CLLSD+R L ++EL  +N +L  RK  ++ S
Sbjct:   40 ELIFNKPTFDMALIITHTSLISDICELQNFFHKKHKFTTHVIYIPDVSKLKFCIRDLKLHRITYAIVINEYGLIQGKMDLYVLYPIIEIQKRMNLSEVDDLVRDDSYNTSIQIKSLMEKPSKYPH---PKN-EF-HVNNETRYQLCLLSDNRMLKMQELQNLNRFLCQRKAEMERS 210          
BLAST of SMED30031471 vs. Planmine SMEST
Match: SMESG000010804.1 (SMESG000010804.1)

HSP 1 Score: 60.4622 bits (145), Expect = 5.940e-9
Identity = 49/176 (27.84%), Postives = 79/176 (44.89%), Query Frame = 3
Query:  225 DIAFIVTHQPLMSKLDKLQNYFQSELKFSTYCTYIEDNESLKFYLRDLKTHDVSYALLL------HDSFENRNFYDLYVLHKDEVLPNITLEKVISLVRSDFDNMMSKVKILKNI-------PSKWPHSVKPEDLEYSKINDKLRYYFCLLSDSRTLSIEELNYVNDYLVTRKELL 713
            D A IV    L+S  + +++  Q ++  +T+   +++       + DL    V YA L+      H S   R  Y     H+     N+ L   ++ V  +F+     V+ LK I       PS+ P         +   +DK+ YY  LL+DSR L+IEELN V D++  R + L
Sbjct:  228 DAAIIVMSSELLSYAETIESRLQRQIALTTHIIVLKEESHANACVEDLNNKGVLYAFLVNSLNEQHFSCTLRILYGTPQEHR-----NMPLNNALTFVARNFERYQKHVRDLKTIAPKPTFDPSRMPPG-------FIAPDDKIIYYLHLLADSRMLTIEELNEVIDFVQKRMQAL 391          
The following BLAST results are available for this feature:
BLAST of SMED30031471 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031471 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031471 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031471 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031471 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031471 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031471 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031471 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031471 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031471 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031471 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031471 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031471 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031471 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050533.10.000e+099.81SMESG000050533.1[more]
SMESG000050535.10.000e+0100.00SMESG000050535.1[more]
SMESG000050537.12.293e-10336.08SMESG000050537.1[more]
SMESG000050537.12.534e-10235.76SMESG000050537.1[more]
SMESG000010804.15.940e-927.84SMESG000010804.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031471 ID=SMED30031471|Name=SMED30031471|organism=Schmidtea mediterranea sexual|type=transcript|length=3055bp
AAAACTTTTTCGCAAACTTAAAAATTGTTTATTAAAACGGTTTATCATTT
TAAGTCTTTTATCGGAATATTATCACATATAATTATTTCTACGATTTTTT
TTATCTAAAATATATTTTAATGATTATATGCAGTCCATCATTAGCAATTT
CGAACGATACATCTGGTGATTATCATACATTTATCCCTGATAAATATGAG
CTGATTTTTAATAATTCTATGTGTGATATTGCATTTATCGTAACTCATCA
GCCTCTTATGTCAAAACTTGATAAATTACAAAATTATTTTCAATCAGAAC
TTAAATTTTCAACCTATTGCACATACATTGAAGACAACGAGAGTCTTAAA
TTTTATTTAAGAGATCTTAAAACACATGATGTCTCGTACGCACTTCTATT
GCATGATAGCTTTGAAAATAGAAATTTTTATGATCTATATGTTTTGCACA
AGGACGAGGTTCTGCCTAACATAACATTGGAAAAAGTTATTTCTTTAGTA
AGAAGTGATTTTGATAATATGATGAGTAAAGTAAAAATATTGAAAAATAT
TCCGTCAAAATGGCCGCATTCAGTAAAGCCTGAGGATTTGGAGTATAGTA
AAATAAATGATAAGTTGCGTTACTATTTCTGCTTACTGTCGGATAGTCGA
ACATTATCCATAGAAGAATTAAATTATGTCAATGATTATTTAGTTACTCG
CAAAGAACTTCTTCAGATATCGAAGACTAAAAATATTTTTGAAAAAGATA
ATTTTATTCAGCCATCGAAATTCGTTTTCAAAGGACCGAACCGAACTGGC
ACTGTTATCAAACTCAGTCGTGCCGAAGATTACGATTCGGAACCATCGTT
AAAATATACGACTTTAGACGTTGGTTTTGCCGGCTCTCTCTCCCCGACTA
CATCACCAAGTATCCAGCCATTCCAAATCCAAAAGGCTAAATCGACATCC
GTTCAGAATGCGATCATACAAGGCACAGATGTATTCACTCCTAAAGGATC
CAAGAATCATCATTCCCATTCGACGAAAAAGTCTAAGAAATCCAAATCGG
ACAAATCAGAAAAGAAACAAAAGAAATTGAAACGGAAATCAGATAATCGA
GATTATATCTCTCCTATCCGGCCGATTTGTATTGCGGAAATCAAACGCAA
CAAATTCGTATCCAATCTCGAGAAAATCGATAAAGTTTTGGTGAAAACTG
CACAAATGTCAAAATTATCGATAAACTATCTGAAAGCGACTTTGTCGAAT
AATTTCTCACAAAAAGTTGATAGATCAGTTACAATTAAATATTTCAAGTC
CTCCTATTACAAGAATCGTATGAACTATGTCGCTCCCATGTTAGTTGTCC
GGCCTCTTGTTCCGCTCAATCAAAATAAAAAGCTAGTAGATTTAACAAGT
GCCAGTGACGGCGATAACCAGAATTCTGATAAAATGACAAATAAACGGAA
AGGTGAAATTATTACATCATCTCCAATCAAAATAACCAAGCTAGATTCCT
CATACAGCTTCGAGATTGTCAATAACCCTATTTTTACTCCTCATAAAAGT
TCTCCAGATGGATTAATTAATCTTTTTGCATTGGTTTTGAATTTGGTGCC
TCTTAAATTGCCCATTGACAACGGTGTCTGTACAATATTAACGAACTCGT
GTGTCACGATTCAAGAAGGAATTCAAGAGCCAGCATTAAGGAACATAAAA
ATCAACCACGAGAGCTGTAAAGCGAATGGAGTCAGTGAAATTATCGCTAA
CATTTACTCAATTTTCAATGAACCCGAAAAAGAAGTGTTAAATATTTCAT
TTATGAAGTTCATTTGGGTGAAATATTTTCCACAGGAATTGTCAAATTTC
AACCTGATGATTTTATTTTATCGATTCGTCAAATTGTTGATGCTATACAC
TATGTTCAATAAATCCTTGGTGACTAAAAAGTTAGTAATCGATGTTATTG
AAAAGATTGACGTCATAGTAAATTTTAATTTTAAATCTTCTGTGTCAACG
TTCAAGAAAAGACAGTTGTCTTGCTTTTCTCATAAATTTGATAAATATTT
CAAAGAACATGATCAATTGCATGTTTTATATTCCAAGCTATCCAATTCAA
AATCACTCGTGGTTAACAGTAAGAAACTGGATATTACAATAAAAAAAAAG
AAAATCGAATTCACTGTCGGCCCGCTATTGAATTATTTTATCTCTTCCAT
AAATTCGATTCACAACAAAATGGAACCGTTTCAAATCGAAGTTGTATACG
GAGCAATCAGAACGCTTAGATTTTGCTTAAGGAAAATTAATTTAAAACTC
GTTCAAACTTCGTTCACTAAACCGTATTTATTTGACTTTAAAACCAAAAA
TATGGATCATCACTGTACCGAAGTTAAAAAGGAAATAAATTGGTTATGTA
AAGAATTGAAATATTATCAATGTGTTCTTTTTACCGATAAGCATTACGAT
TTTATCAATTGTATATTGGATTTTTCTTGGAGGCTAGAATGCACAATAAA
GGTCAACTCGGATCCACTTCAACCGAAACCGATATGTGAACCTTTAGTCT
TTCATAATCCAATGCAATTCGTTCAAACATTCACAACATTTCAGTGTCCA
ATCTTCATCCAATATCATCCGGAATCAGAATTGGAATATTTGAATACTTG
TCTTAAAACTAAATGGATTGGTATTCTTCATGAGGCTTTTATTGGTTCTT
TGCCTGAACCATGTGGTGCTCGTATTATTAAGGAAATAAATGTTCTTTTA
CCTCCGACTTGGGGATTGTTCACATTTAATGAGGCGATTATAGAGTCATC
GAAAATGTATTATGAGCGATTTCAAAAGCTGGCCGAAACAGATCCGAGTG
GGTGGTACACGAAATTTTCTAAAACGAAACATTGTGCTATGAATTGGCTG
ATCCAGTATCAGTTGCCAGTTGATGGGCTCGAGGTTCTGCATGATTACCA
GTATGTGCTAGAGAGCAAATATAAATACTCATGAATGAATCCAATTTTAT
TTATTTATGTATTTCTGTACATTATAATAAATTGTGTTGACTTTTATTAA
AAAAA
back to top

protein sequence of SMED30031471-orf-1

>SMED30031471-orf-1 ID=SMED30031471-orf-1|Name=SMED30031471-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=955bp
MIICSPSLAISNDTSGDYHTFIPDKYELIFNNSMCDIAFIVTHQPLMSKL
DKLQNYFQSELKFSTYCTYIEDNESLKFYLRDLKTHDVSYALLLHDSFEN
RNFYDLYVLHKDEVLPNITLEKVISLVRSDFDNMMSKVKILKNIPSKWPH
SVKPEDLEYSKINDKLRYYFCLLSDSRTLSIEELNYVNDYLVTRKELLQI
SKTKNIFEKDNFIQPSKFVFKGPNRTGTVIKLSRAEDYDSEPSLKYTTLD
VGFAGSLSPTTSPSIQPFQIQKAKSTSVQNAIIQGTDVFTPKGSKNHHSH
STKKSKKSKSDKSEKKQKKLKRKSDNRDYISPIRPICIAEIKRNKFVSNL
EKIDKVLVKTAQMSKLSINYLKATLSNNFSQKVDRSVTIKYFKSSYYKNR
MNYVAPMLVVRPLVPLNQNKKLVDLTSASDGDNQNSDKMTNKRKGEIITS
SPIKITKLDSSYSFEIVNNPIFTPHKSSPDGLINLFALVLNLVPLKLPID
NGVCTILTNSCVTIQEGIQEPALRNIKINHESCKANGVSEIIANIYSIFN
EPEKEVLNISFMKFIWVKYFPQELSNFNLMILFYRFVKLLMLYTMFNKSL
VTKKLVIDVIEKIDVIVNFNFKSSVSTFKKRQLSCFSHKFDKYFKEHDQL
HVLYSKLSNSKSLVVNSKKLDITIKKKKIEFTVGPLLNYFISSINSIHNK
MEPFQIEVVYGAIRTLRFCLRKINLKLVQTSFTKPYLFDFKTKNMDHHCT
EVKKEINWLCKELKYYQCVLFTDKHYDFINCILDFSWRLECTIKVNSDPL
QPKPICEPLVFHNPMQFVQTFTTFQCPIFIQYHPESELEYLNTCLKTKWI
GILHEAFIGSLPEPCGARIIKEINVLLPPTWGLFTFNEAIIESSKMYYER
FQKLAETDPSGWYTKFSKTKHCAMNWLIQYQLPVDGLEVLHDYQYVLESK
YKYS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0003676nucleic acid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 62..81