FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30031470
Length (bp)1976
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30031470) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30031470) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30031470) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30031470) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031470

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30031470SMESG000016707.1 SmedASXL_008345SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30031470SMESG000016707.1 dd_Smed_v4_17431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031470SMESG000016707.1 dd_Smed_v4_17431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031470SMESG000016707.1 dd_Smed_v4_17431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031470SMESG000016707.1 dd_Smed_v4_17431_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031470SMESG000016707.1 dd_Smed_v6_17431_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1G (sodium channel epithelial 1 gamma subunit [Source:HGNC Symbol;Acc:HGNC:10602])

HSP 1 Score: 59.3066 bits (142), Expect = 1.866e-8
Identity = 66/286 (23.08%), Postives = 115/286 (40.21%), Query Frame = 1
Query:  676 FSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYD--YTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQIT-----KRYRSVNKYIDDISLAK---------------NNTETIEQLKSNYINEL 1467
            F H  + NC+T   +  +  L  S G  +   + +IL IN   ++             L    G +++IHR   YP ++  G  I+   +  +        + S P  +C +D    V +  IY+  Y+   CL +    ++VEKC C     P P  P+ +  YCN Y  +   +     C Y+    +    +     + C   C+F  +  T S+ +W PS++  + +       + R VNK ++   LAK               +   +IE L SN+  +L
Sbjct:  275 FHHPMHGNCYTFNNRENETILSTSMGG-SEYGLQVILYINEEEYNPF-----------LVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSD-VPIRNIYNAAYSLQICLHSCFQTKMVEKCGCAQYSQPLP--PAAN--YCN-YQQHPNWMY----CYYQ--LHRAFVQEELGCQSVCKEACSFKEWTLTTSLAQW-PSVVSEKWLLPVLTWDQGRQVNKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQL 535          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 58.9214 bits (141), Expect = 2.158e-8
Identity = 59/246 (23.98%), Postives = 100/246 (40.65%), Query Frame = 1
Query:  670 SQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQ--CLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLK-PIKAAAVG--TKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKY 1392
            S F H  Y NC+T   K+  N L  S     N  +SL+L    N F  L           L+   G R+++H       +D  G N++PG    ++ +     R      +C  +    V ++ +Y   + Q  C+ +   + ++++C C    +PRPQ    +V YC DY         R    +   + KL+    +  +G  TKC   C+  +Y  +   +RW PS+     + +     N Y
Sbjct:  295 SHFHHPMYGNCYTFNDKNNSN-LWMSSMPGINNGLSLMLRAEQNDFIPL-----------LSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGS-DVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQ----NVEYC-DY---------RKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRW-PSVTSQEWVFQMLSRQNNY 512          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 58.9214 bits (141), Expect = 2.253e-8
Identity = 59/246 (23.98%), Postives = 100/246 (40.65%), Query Frame = 1
Query:  670 SQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQ--CLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLK-PIKAAAVG--TKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKY 1392
            S F H  Y NC+T   K+  N L  S     N  +SL+L    N F  L           L+   G R+++H       +D  G N++PG    ++ +     R      +C  +    V ++ +Y   + Q  C+ +   + ++++C C    +PRPQ    +V YC DY         R    +   + KL+    +  +G  TKC   C+  +Y  +   +RW PS+     + +     N Y
Sbjct:  318 SHFHHPMYGNCYTFNDKNNSN-LWMSSMPGINNGLSLMLRAEQNDFIPL-----------LSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGS-DVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQ----NVEYC-DY---------RKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRW-PSVTSQEWVFQMLSRQNNY 535          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 58.9214 bits (141), Expect = 2.764e-8
Identity = 59/246 (23.98%), Postives = 100/246 (40.65%), Query Frame = 1
Query:  670 SQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQ--CLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLK-PIKAAAVG--TKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKY 1392
            S F H  Y NC+T   K+  N L  S     N  +SL+L    N F  L           L+   G R+++H       +D  G N++PG    ++ +     R      +C  +    V ++ +Y   + Q  C+ +   + ++++C C    +PRPQ    +V YC DY         R    +   + KL+    +  +G  TKC   C+  +Y  +   +RW PS+     + +     N Y
Sbjct:  354 SHFHHPMYGNCYTFNDKNNSN-LWMSSMPGINNGLSLMLRAEQNDFIPL-----------LSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGS-DVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQ----NVEYC-DY---------RKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRW-PSVTSQEWVFQMLSRQNNY 571          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: ASIC1 (acid sensing ion channel subunit 1 [Source:HGNC Symbol;Acc:HGNC:100])

HSP 1 Score: 57.7658 bits (138), Expect = 4.928e-8
Identity = 111/500 (22.20%), Postives = 178/500 (35.60%), Query Frame = 1
Query:  301 NYHTAWHVSTELDE----KTRFPAISICSHNPFS-KQASR--YWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLLDKA------------EEYYGNVDYPSSIKLGH-VRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCND------YSGNLTTIVKRTQ--CVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYID------DISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEEIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVY 1698
             Y+  +H  T+LDE    +  FPA+++C+ N F   Q S+   +  G++L     R  + + +M   K   +    L DKA             E+Y         + GH +R +L  C  +  G    AED        F V  F+ Y    C+T  +  +    +K+    T   + ++L I  + +  ++   +    ++     G+++ IH     P ID+ G  + PG    V  Q         P   CK       DLD    Y+   C      + LVE C C     P       D PYC            L  +V++ Q  CV                   C   C    Y   LS+ +  PS    + + K++    +YI       DI     N ETIEQ K+  I  L  EL   P         +   H     +L+       ++           +  +GG   L IG +    +E+ ++ Y
Sbjct:   66 QYYFHYHHVTKLDEVAASQLTFPAVTLCNLNEFRFSQVSKNDLYHAGELLALLNNRYEIPDTQMADEKQLEI----LQDKANFRSFKPKPFNMREFYD--------RAGHDIRDMLLSCHFR--GEVCSAED--------FKVV-FTRYG--KCYTFNSGRDGRPRLKTMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEA-----GIKVQIHSQDEPPFIDQLGFGVAPGFQTFVACQEQRLIYLPPPWGTCKAVTMD-SDLDFFDSYSITACRIDCETRYLVENCNCRMVHMP------GDAPYCTPEQYKECADPALDFLVEKDQEYCV-------------------CEMPCNLTRYGKELSMVKI-PSKASAKYLAKKFNKSEQYIGENILVLDIFFEVLNYETIEQKKAYEIAGLLGELLMTPVPFSCHGHGVAPYHPKAGCSLLSHEGPPPQRPFP----KPCCLGDIGGQMGLFIGASILTVLELFDYAY 504          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: asic-2 (Degenerin-like protein asic-2 [Source:UniProtKB/Swiss-Prot;Acc:Q22851])

HSP 1 Score: 57.7658 bits (138), Expect = 1.751e-8
Identity = 47/172 (27.33%), Postives = 72/172 (41.86%), Query Frame = 1
Query:  844 DSL--TRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAA-------VGTKCWPLCTFNTYDSTLSITRW 1332
            DSL  T+  G RI ++  GS P +D NGI+   G  + V+       R   P   C D +P   D  + + YT   C +    ++ + KCQC +   PR  L S D   C     +L            +  Q LK  + ++       V   C P C  +TY  T+S+ ++
Sbjct:  229 DSLPTTKLAGARIGVNSRGSSPGLDSNGIDAGVGYESAVSVSLTQNVRAKKPYGTCVDREPDSSDYYKDFIYTLETCFNGCKQRDTIAKCQCAN---PRLALGSTDTA-CQPIKADL------------DCLQTLKGNQTSSTPNIDLLVECNCNPPCDESTYTPTVSLAQF 384          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Match: asic2 (acid-sensing (proton-gated) ion channel 2 [Source:NCBI gene;Acc:407669])

HSP 1 Score: 56.225 bits (134), Expect = 7.998e-8
Identity = 71/312 (22.76%), Postives = 117/312 (37.50%), Query Frame = 1
Query:  562 KLGH-VRKILQYCVVQNDGFTIIAEDCLVEN-ETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCW--PLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKN------NTETIEQLKSNYINEL 1467
            ++GH +++++ YC  Q        ++C  ++ +T FT        Y  C+   A  E   L  +    T   + ++L I  + +  ++   E    ++     G+R+ IH     P + + G  + PG    V  Q    T    P  EC       +D      Y+ + C      + +VE C C     P       D PYC             T   Y++  +      +A  GT C     C    Y+  LS+ +  PS    R + K++    KYI D  L  +      N ETIEQ K+  +  L
Sbjct:  180 RVGHDLKEMMLYCRFQ-------GQECSHQDFKTVFT-------RYGKCYMFNAAEEGKTLRTTMKGGTGNGLEIMLDIQQDEYLPVWGETEETAFEA-----GVRVQIHSQAEPPFVHELGFGVAPGFQTFVATQEQRLTYLPPPWGECVSRA---LDSGLFQVYSVSACRIECETRYIVENCNCRMVYMP------GDSPYC-------------TPEQYKDCAEPALAALSAVEGTNCICRSPCNMTRYNKELSMVKI-PSKTSARYLEKKFNRSEKYITDNILVLDVFFEALNYETIEQKKAYEVAGL 449          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Match: asic2 (acid-sensing (proton-gated) ion channel 2 [Source:NCBI gene;Acc:407669])

HSP 1 Score: 56.225 bits (134), Expect = 7.998e-8
Identity = 71/312 (22.76%), Postives = 117/312 (37.50%), Query Frame = 1
Query:  562 KLGH-VRKILQYCVVQNDGFTIIAEDCLVEN-ETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCW--PLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKN------NTETIEQLKSNYINEL 1467
            ++GH +++++ YC  Q        ++C  ++ +T FT        Y  C+   A  E   L  +    T   + ++L I  + +  ++   E    ++     G+R+ IH     P + + G  + PG    V  Q    T    P  EC       +D      Y+ + C      + +VE C C     P       D PYC             T   Y++  +      +A  GT C     C    Y+  LS+ +  PS    R + K++    KYI D  L  +      N ETIEQ K+  +  L
Sbjct:  180 RVGHDLKEMMLYCRFQ-------GQECSHQDFKTVFT-------RYGKCYMFNAAEEGKTLRTTMKGGTGNGLEIMLDIQQDEYLPVWGETEETAFEA-----GVRVQIHSQAEPPFVHELGFGVAPGFQTFVATQEQRLTYLPPPWGECVSRA---LDSGLFQVYSVSACRIECETRYIVENCNCRMVYMP------GDSPYC-------------TPEQYKDCAEPALAALSAVEGTNCICRSPCNMTRYNKELSMVKI-PSKTSARYLEKKFNRSEKYITDNILVLDVFFEALNYETIEQKKAYEVAGL 449          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Match: asic1a (acid-sensing (proton-gated) ion channel 1a [Source:NCBI gene;Acc:791696])

HSP 1 Score: 54.299 bits (129), Expect = 3.578e-7
Identity = 55/208 (26.44%), Postives = 79/208 (37.98%), Query Frame = 1
Query:  865 GLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEV-FQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYID------DISLAKNNTETIEQLKSNYINEL 1467
            G+++ IH     P ID+ G  + PG    V+ Q        +P   CK   PP  D  R   Y+ + C      + LVE C C     P       D PYC        T V   +C +  + F     ++  +    C   C    Y   LS  +  PS   ++ + K+Y    KYI       D+     N ETIEQ K+  +  L
Sbjct:  248 GIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQEQRLVYLPAPWGSCK-STPPSSDYFRA--YSISACRTDCETRYLVENCNCRMVHMP------GDAPYC--------TPVLYKECAHPALDFL----VETDSDYCSCETPCNITRYSKELSFVKI-PSKASVKYLAKKYSKSEKYITENVMVLDVFFEALNYETIEQRKAYEVAGL 433          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Match: asic1b (acid-sensing (proton-gated) ion channel 1b [Source:NCBI gene;Acc:407672])

HSP 1 Score: 54.299 bits (129), Expect = 3.748e-7
Identity = 75/312 (24.04%), Postives = 109/312 (34.94%), Query Frame = 1
Query:  562 KLGH-VRKILQYCVVQNDGFTIIAEDCLVEN-ETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCND------YSGNLTTIVKRTQ--CVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYID------DISLAKNNTETIEQLKS 1449
            +LGH + ++L YC  Q        + C   N  T FT        Y  C+T  +  +   L+ +        + ++L I  + +  ++        D  T   G+++ IH     P ID+ G  + PG    V+ Q    T    P  +CK      +D D    Y+   C      + LVE C C     P       D PYC            L  +V+R    CV                   C   C    Y   LS  R  PS    + + K+Y    +YI       DI     N ETIEQ K+
Sbjct:  175 RLGHQLEEMLLYCRFQ-------GQLCGPRNFSTIFT-------RYGKCYTFNSGQDGRPLLITTKGGMGNGLEIMLDIQQDEYLPVWGET-----DETTFEAGIKVQIHTQDEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKATP---IDSDFFNTYSITACRIDCETRYLVENCNCRMVHMP------GDAPYCTPEQYKECADPALDFLVERDNDYCV-------------------CETPCNMTRYGKELSFVRI-PSKASAKYLAKKYNKTEQYISDNIMVLDIFFEALNYETIEQKKA 438          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Match: asic1b (acid-sensing (proton-gated) ion channel 1b [Source:NCBI gene;Acc:407672])

HSP 1 Score: 53.1434 bits (126), Expect = 8.124e-7
Identity = 86/393 (21.88%), Postives = 135/393 (34.35%), Query Frame = 1
Query:  304 YHTAWHVSTELDEKTR----FPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDC-LVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYID------DISLAKNNTETIEQLKS 1449
            Y+  +   T LDE+      FPAI++C++N F +    Y             + LF   +   +    PG  L             P   + G    + ++          +  +C     E G    +     Y  C+T  +  +   L+ +        + ++L I  + +  ++        D  T   G+++ IH     P ID+ G  + PG    V+ Q    T    P  +CK    PI D D    Y+   C      + LVE C C     P       D PYC        T  +  +C    +   ++      V   C   C    Y   LS  R  PS    + + K+Y    +YI       DI     N ETIEQ K+
Sbjct:  116 YYLQYDYVTLLDERNAKNMTFPAITLCNYNTFRRSQLSY------------SDLLFMGPLLGYEDNMAPGIPLA------------PEPDRQGSRFSLAEFFNRTRHRMDDMLLECNFAGKECGAEHWREIFTRYGKCYTFNSGQDGRPLLITTKGGMGNGLEIMLDIQQDEYLPVWGET-----DETTFEAGIKVQIHTQDEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCK--ATPI-DSDFFNTYSITACRIDCETRYLVENCNCRMVHMP------GDAPYC--------TPEQYKECADPALDFLVERDNDYCV---CETPCNMTRYGKELSFVRI-PSKASAKYLAKKYNKTEQYISDNIMVLDIFFEALNYETIEQKKA 458          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: copg2 (coatomer protein complex subunit gamma 2 [Source:Xenbase;Acc:XB-GENE-941264])

HSP 1 Score: 61.2326 bits (147), Expect = 3.802e-9
Identity = 58/248 (23.39%), Postives = 101/248 (40.73%), Query Frame = 1
Query:  673 QFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYD--YTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLL----KLRQITKRYRSVNKYID 1398
             F H  Y NCFTI    ++N     Y  +  +   L +++  +L  +         M  L++  G RI+IH     P ++  G +I+PG  N ++ +     R      +C  D   +  +  +Y+  YT   CL++    +++E C C    +P P      + YC     N         C Y ++++K+         T+C   C    Y  +    +W PS +    KL  + +RY S +K  D
Sbjct:  255 HFHHPIYGNCFTINNHWKENSW---YSSRPGKQYGLSIVVKTDLHDN---------MPLLSQAAGARIMIHNPNQPPLVEHQGFDIRPGTENSISVKQEEAIRLGGKYSQCTSDGSDL-GIKILYNTSYTMQACLNSCFQYKMIEVCGCGYYFYPLP----PGMEYC-----NYNKHPDWGYCFY-QLYEKMLD-HTLICFTQCPKQCKQTEYHLSAGTAKW-PSPVSKAKKLLSLQERYNSTSKRSD 477          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 60.077 bits (144), Expect = 1.049e-8
Identity = 75/360 (20.83%), Postives = 139/360 (38.61%), Query Frame = 1
Query:  634 DCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYD--YTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCN--DYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEEIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYL 1701
            D L  +   FT+  F H  Y NC+T  +    N L+ S G      + ++L I+ + ++             L+   G +I++H    YP I+  G  ++      +  Q    T+ S P  +C  D    V ++ +Y   YT   CL++   +E+V  C C     P P        YCN  +Y   +    K    +Y++  Q+    ++A     C   C+F  +  T S+ +W PSL                         N+E    ++S ++ +L            +     FN + +  +N+  ++ ++    E    +I   +S  GG   L +  +    +EI+E  ++
Sbjct:  266 DGLSCDARNFTL--FHHPLYGNCYTFNSAERGNLLVSSMGG-AEYGLKVVLYIDEDEYNPY-----------LSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSD-VSVENLYSKKYTLQICLNSCFQREMVRTCGCAHYDQPLP----NGAKYCNYEEYPSWIYCYFK----LYKQFVQEELGCQSA-----CRESCSFKEWTLTRSLAKW-PSL-------------------------NSE----VRSAWVLQL-----------FYVGHGFFNLNDLANLNIFYQDLNSRSISESPTYNIVTLLSNFGGQLGLWMSCSMICVLEIVEVFFI 556          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 59.6918 bits (143), Expect = 1.066e-8
Identity = 59/241 (24.48%), Postives = 100/241 (41.49%), Query Frame = 1
Query:  634 DCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYD--YTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCN--DYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSL 1344
            D L  +   FT+  F H  Y NC+T  +    N L+ S G      + ++L I+ + ++             L+   G +I++H    YP I+  G  ++      +  Q    T+ S P  +C  D    V ++ +Y   YT   CL++   +E+V  C C     P P        YCN  +Y   +    K    +Y++  Q+    ++A     C   C+F  +  T S+ +W PSL
Sbjct:  264 DGLSCDARNFTL--FHHPLYGNCYTFNSAERGNLLVSSMGG-AEYGLKVVLYIDEDEYNPY-----------LSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSD-VSVENLYSKKYTLQICLNSCFQREMVRTCGCAHYDQPLP----NGAKYCNYEEYPSWIYCYFK----LYKQFVQEELGCQSA-----CRESCSFKEWTLTRSLAKW-PSL 475          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 59.6918 bits (143), Expect = 1.256e-8
Identity = 59/241 (24.48%), Postives = 100/241 (41.49%), Query Frame = 1
Query:  634 DCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYD--YTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCN--DYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSL 1344
            D L  +   FT+  F H  Y NC+T  +    N L+ S G      + ++L I+ + ++             L+   G +I++H    YP I+  G  ++      +  Q    T+ S P  +C  D    V ++ +Y   YT   CL++   +E+V  C C     P P        YCN  +Y   +    K    +Y++  Q+    ++A     C   C+F  +  T S+ +W PSL
Sbjct:  264 DGLSCDARNFTL--FHHPLYGNCYTFNSAERGNLLVSSMGG-AEYGLKVVLYIDEDEYNPY-----------LSTAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSD-VSVENLYSKKYTLQICLNSCFQREMVRTCGCAHYDQPLP----NGAKYCNYEEYPSWIYCYFK----LYKQFVQEELGCQSA-----CRESCSFKEWTLTRSLAKW-PSL 475          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: copg2 (coatomer protein complex subunit gamma 2 [Source:Xenbase;Acc:XB-GENE-941264])

HSP 1 Score: 59.3066 bits (142), Expect = 1.416e-8
Identity = 41/168 (24.40%), Postives = 72/168 (42.86%), Query Frame = 1
Query:  673 QFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYD--YTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCN 1170
             F H  Y NCFTI    ++N     Y  +  +   L +++  +L  +         M  L++  G RI+IH     P ++  G +I+PG  N ++ +     R      +C  D   +  +  +Y+  YT   CL++    +++E C C    +P P      + YCN
Sbjct:  255 HFHHPIYGNCFTINNHWKENSW---YSSRPGKQYGLSIVVKTDLHDN---------MPLLSQAAGARIMIHNPNQPPLVEHQGFDIRPGTENSISVKQEEAIRLGGKYSQCTSDGSDL-GIKILYNTSYTMQACLNSCFQYKMIEVCGCGYYFYPLP----PGMEYCN 405          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 55.8398 bits (133), Expect = 1.334e-7
Identity = 65/278 (23.38%), Postives = 112/278 (40.29%), Query Frame = 1
Query:  670 SQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQ--CLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQ---CVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYK 1488
            SQF H  Y NC+T   K+  N L  S     N  +SL L    N F  L           L+   G R+++H       +D  G N++PG    ++ +            +C ++    V +  +Y   + Q  C+ +   + +++KC C    +P+P    K V +C DY       +K++    C Y+   Q    + +    +KC   C+   Y  +   +RW PS+          +S +   + +SL  N T   ++     +N   +EL YK
Sbjct:  297 SQFHHPMYGNCYTFNNKNNSN-LWMSSMPGVNNGLSLTLRTEQNDFIPL-----------LSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSD-VPVKNLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYPKP----KGVEFC-DY-------LKQSSWGYCYYK--LQAAFSLDSLGCFSKCRKPCSVTNYKLSAGYSRW-PSV----------KSQDWIFEMLSLQNNYTINNKRNGVAKLNIFFKELNYK 536          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 55.8398 bits (133), Expect = 1.334e-7
Identity = 65/278 (23.38%), Postives = 112/278 (40.29%), Query Frame = 1
Query:  670 SQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQ--CLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQ---CVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYK 1488
            SQF H  Y NC+T   K+  N L  S     N  +SL L    N F  L           L+   G R+++H       +D  G N++PG    ++ +            +C ++    V +  +Y   + Q  C+ +   + +++KC C    +P+P    K V +C DY       +K++    C Y+   Q    + +    +KC   C+   Y  +   +RW PS+          +S +   + +SL  N T   ++     +N   +EL YK
Sbjct:  297 SQFHHPMYGNCYTFNNKNNSN-LWMSSMPGVNNGLSLTLRTEQNDFIPL-----------LSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSD-VPVKNLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYPKP----KGVEFC-DY-------LKQSSWGYCYYK--LQAAFSLDSLGCFSKCRKPCSVTNYKLSAGYSRW-PSV----------KSQDWIFEMLSLQNNYTINNKRNGVAKLNIFFKELNYK 536          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 55.8398 bits (133), Expect = 1.382e-7
Identity = 65/278 (23.38%), Postives = 112/278 (40.29%), Query Frame = 1
Query:  670 SQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQ--CLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQ---CVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYK 1488
            SQF H  Y NC+T   K+  N L  S     N  +SL L    N F  L           L+   G R+++H       +D  G N++PG    ++ +            +C ++    V +  +Y   + Q  C+ +   + +++KC C    +P+P    K V +C DY       +K++    C Y+   Q    + +    +KC   C+   Y  +   +RW PS+          +S +   + +SL  N T   ++     +N   +EL YK
Sbjct:  216 SQFHHPMYGNCYTFNNKNNSN-LWMSSMPGVNNGLSLTLRTEQNDFIPL-----------LSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSD-VPVKNLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYPKP----KGVEFC-DY-------LKQSSWGYCYYK--LQAAFSLDSLGCFSKCRKPCSVTNYKLSAGYSRW-PSV----------KSQDWIFEMLSLQNNYTINNKRNGVAKLNIFFKELNYK 455          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 55.8398 bits (133), Expect = 1.397e-7
Identity = 65/278 (23.38%), Postives = 112/278 (40.29%), Query Frame = 1
Query:  670 SQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQ--CLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQ---CVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYK 1488
            SQF H  Y NC+T   K+  N L  S     N  +SL L    N F  L           L+   G R+++H       +D  G N++PG    ++ +            +C ++    V +  +Y   + Q  C+ +   + +++KC C    +P+P    K V +C DY       +K++    C Y+   Q    + +    +KC   C+   Y  +   +RW PS+          +S +   + +SL  N T   ++     +N   +EL YK
Sbjct:  216 SQFHHPMYGNCYTFNNKNNSN-LWMSSMPGVNNGLSLTLRTEQNDFIPL-----------LSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSD-VPVKNLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYPKP----KGVEFC-DY-------LKQSSWGYCYYK--LQAAFSLDSLGCFSKCRKPCSVTNYKLSAGYSRW-PSV----------KSQDWIFEMLSLQNNYTINNKRNGVAKLNIFFKELNYK 455          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 55.8398 bits (133), Expect = 1.454e-7
Identity = 65/278 (23.38%), Postives = 112/278 (40.29%), Query Frame = 1
Query:  670 SQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQ--CLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQ---CVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYK 1488
            SQF H  Y NC+T   K+  N L  S     N  +SL L    N F  L           L+   G R+++H       +D  G N++PG    ++ +            +C ++    V +  +Y   + Q  C+ +   + +++KC C    +P+P    K V +C DY       +K++    C Y+   Q    + +    +KC   C+   Y  +   +RW PS+          +S +   + +SL  N T   ++     +N   +EL YK
Sbjct:  323 SQFHHPMYGNCYTFNNKNNSN-LWMSSMPGVNNGLSLTLRTEQNDFIPL-----------LSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSD-VPVKNLYPSKYTQQVCIHSCFQENMIKKCGCAYIFYPKP----KGVEFC-DY-------LKQSSWGYCYYK--LQAAFSLDSLGCFSKCRKPCSVTNYKLSAGYSRW-PSV----------KSQDWIFEMLSLQNNYTINNKRNGVAKLNIFFKELNYK 562          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.051e-12
Identity = 103/483 (21.33%), Postives = 191/483 (39.54%), Query Frame = 1
Query:  346 TRFPAISICSHNPFSKQASR---YWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLLDKAEEYYGNVDYPSSIKLGH-VRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDS-LTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYC-----------------NDYSGNLTTIVKRTQCVYEEVFQK-LKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTL---SHHKSEEIFNEHQMNYI--NLVRKN--FDTTKKIEKLFIDIYI---FISRVGGLCSLCIGLTTAFFIEIIEFV 1695
             ++P++SIC+  P S +  R   +  E + L             +  I+       + ++    +Y N+   +  KL H +  +L +C           E C V N      S F   NYFNCFT  +       ++ +       +SLI  +  +    L      +  D+ +    G+R+V+H  GS P    +GI+I PG  + V  + I  TR   P   C +D   +++  + Y YTF  CL     + ++++C C S+    P++PS +  +C                 ++ S      +       EE  QK L   +   +   C+  C+  +Y  ++S++ W     +L  + +R+    +        K   E +E+L       L R   +   +   S+  SE+   +   + I  N++R N   +    +E   +  Y      + +GG   L +G++    +E+IE V
Sbjct:  109 VQYPSVSICNIEPISLRTIRRMYFNNESQNLI----------TWLRFIQKFRFEQDSFMNSIRAFYENLGQDAK-KLSHNLEDMLMHCRFNR-------ELCHVSN-----FSTFFDGNYFNCFTFNSGQR----LQMHATGPENGLSLIFSVEKD--DPLPGTYGVYNFDNNILHSAGVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTND---MLNGIKQYKYTFFACLQLCKQRLIIQRCGCKSSAL--PEVPSYNATFCGVIKDWQEINRNHSNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQPCSETSYLKSVSLSYWPLEFYQLSAV-ERFFKQERQAGQNHFMKTAYEYLEKLAHPSQKHLARNDSHMDDILSKSYSLSEKEMAKEASDLIRQNMLRLNIYLEDLSVVEYRQLPAYGLADLFADIGGTLGLWMGISVLTIMELIELV 556          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|O13263|SCNNH_XENLA (Amiloride-sensitive sodium channel subunit gamma-2 OS=Xenopus laevis OX=8355 GN=scnn1g-b PE=1 SV=1)

HSP 1 Score: 63.5438 bits (153), Expect = 4.595e-9
Identity = 60/241 (24.90%), Postives = 101/241 (41.91%), Query Frame = 1
Query:  634 DCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYD--YTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCN--DYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSL 1344
            D L  +   FT+  F H  Y NC+T  +    N L+ S G      + ++L I+ + ++             L+   G +I++H    YP I+  G  ++ G    +  Q    T+ S P  +C  D   I  ++ +Y+  YT   CL++   +E+V  C C     P P        YCN  +Y   +   VK    +Y++  Q     +     + C   C+F  +  T S+ +W PSL
Sbjct:  266 DGLSCDARNFTL--FHHPLYGNCYTFNSAERGNLLVSSMGG-AEYGLKVVLYIDEDEYNPY-----------LSTAAGAKILVHDQDEYPFIEDLGTELETGTETSIGMQLTESTKLSDPYSDCTIDGSDI-SVENLYNKKYTLQICLNSCFQREMVRSCGCAHYDQPLPN----GAKYCNYEEYPNWIYCYVK----LYKQFVQ-----EELGCQSTCRESCSFKEWTLTRSLAKW-PSL 477          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|H2QAR5|SCNNG_PANTR (Amiloride-sensitive sodium channel subunit gamma OS=Pan troglodytes OX=9598 GN=SCNN1G PE=3 SV=1)

HSP 1 Score: 62.003 bits (149), Expect = 1.279e-8
Identity = 93/419 (22.20%), Postives = 159/419 (37.95%), Query Frame = 1
Query:  343 KTRFPAISICSHNPFS-----------KQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLP-----------GQTLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYD--YTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITK-----RYRSVNKYIDDISLAK---------------NNTETIEQLKSNYINEL 1467
            K  FPA++IC+ NP+            +Q +R   +     PE  + R  E     I  G  P            Q    KA +++           G  RK+    + +      I    +V  +  FT+  F H  + NC+T   +  +  L  S G  +   + +IL IN   ++             L    G +++IHR   YP ++  G  I+   +  +        + S P  +C +D    V +  IY+  Y+   CL +    ++VEKC C     P P  P+ +  YCN Y  +   +     C Y+    +    +     + C   C+F  +  T S+ +W PS++  + +       + R VNK ++   LAK               +   +IE L SN+  +L
Sbjct:   91 KLDFPAVTICNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAE-SWSSISEGKQPRFSHRIPLLIFDQDEKGKARDFF----------TGRKRKVGGSIIHKASNVMHIESKQVVGFQLNFTL--FHHPMHGNCYTFNNRENETILSTSMGG-SEYGLQVILYINEEEYNPF-----------LVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSD-VPIRNIYNAAYSLQICLHSCFQTKMVEKCGCAQYSQPLP--PAAN--YCN-YQQHPNWMY----CYYQ--LHRAFVQEELGCQSVCKEACSFKEWTLTTSLAQW-PSVVSEKWLLPVLTWDQGRQVNKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQL 471          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|P51170|SCNNG_HUMAN (Amiloride-sensitive sodium channel subunit gamma OS=Homo sapiens OX=9606 GN=SCNN1G PE=1 SV=4)

HSP 1 Score: 59.3066 bits (142), Expect = 8.960e-8
Identity = 66/286 (23.08%), Postives = 115/286 (40.21%), Query Frame = 1
Query:  676 FSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYD--YTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQIT-----KRYRSVNKYIDDISLAK---------------NNTETIEQLKSNYINEL 1467
            F H  + NC+T   +  +  L  S G  +   + +IL IN   ++             L    G +++IHR   YP ++  G  I+   +  +        + S P  +C +D    V +  IY+  Y+   CL +    ++VEKC C     P P  P+ +  YCN Y  +   +     C Y+    +    +     + C   C+F  +  T S+ +W PS++  + +       + R VNK ++   LAK               +   +IE L SN+  +L
Sbjct:  275 FHHPMHGNCYTFNNRENETILSTSMGG-SEYGLQVILYINEEEYNPF-----------LVSSTGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSD-VPIRNIYNAAYSLQICLHSCFQTKMVEKCGCAQYSQPLP--PAAN--YCN-YQQHPNWMY----CYYQ--LHRAFVQEELGCQSVCKEACSFKEWTLTTSLAQW-PSVVSEKWLLPVLTWDQGRQVNKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQL 535          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|H2Q5A1|SCNNA_PANTR (Amiloride-sensitive sodium channel subunit alpha OS=Pan troglodytes OX=9598 GN=SCNN1A PE=3 SV=2)

HSP 1 Score: 58.9214 bits (141), Expect = 1.010e-7
Identity = 59/246 (23.98%), Postives = 100/246 (40.65%), Query Frame = 1
Query:  670 SQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQ--CLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLK-PIKAAAVG--TKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKY 1392
            S F H  Y NC+T   K+  N L  S     N  +SL+L    N F  L           L+   G R+++H       +D  G N++PG    ++ +     R      +C  +    V ++ +Y   + Q  C+ +   + ++++C C    +PRPQ    +V YC DY         R    +   + KL+    +  +G  TKC   C+  +Y  +   +RW PS+     + +     N Y
Sbjct:  318 SHFHHPMYGNCYTFNDKNNSN-LWMSSMPGINNGLSLMLRAEQNDFIPL-----------LSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGS-DVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPRPQ----NVEYC-DY---------RKHSSWGYCYYKLQVDFSSDHLGCFTKCRKPCSVTSYQLSAGYSRW-PSVTSQEWVFQMLSRQNNY 535          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3UEW8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 GN=MCOS_LOCUS5596 PE=3 SV=1)

HSP 1 Score: 366.696 bits (940), Expect = 3.414e-115
Identity = 188/483 (38.92%), Postives = 290/483 (60.04%), Query Frame = 1
Query:  295 FRNYHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGN--LPGQTLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLP---SKDVPYCNDY------SGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTK-CWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKS--NYINELKRELKYKPTLSHHKSEEIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYL 1701
            F ++ T+WH  T +D+KT FPAI+IC+HNPFS +A+R W E  IL P +F  +L  + +  I++GN    G  L D  + Y+ N+    S +LGH   +  +C+V  DG  I+AE+C++E +TGFT  +FSH  YFNC+TIE  + ++         T +TV L +L+++    ++ ++ ++F+MD+ +RGEG+++V+H+ G+YP+IDK+GIN+QPG+MNE++F    W R  +P   C DD PPI D+ R Y Y   QCLD+ +    + +C C+++ WPRP  P   +  +PYC+        S  L  I++R  C    +   LK IK +A+    C P C+F TY  + SIT W+P   KL+  T +++ V + +++          I+ LK   +   +L  ++  K +L   + E+  N+    YI+LVR  +DTT K E+L  DIYI ISRVGGLCS+ IGLT A  +E+IEFVY+
Sbjct:   57 FFSFTTSWHSRTLIDDKTDFPAITICAHNPFSLEANRIWAEASILTPTEFNRQLSAMTLAFIENGNPEYAGLLLQDSTDTYFANLRPEESQRLGHQTTMFPHCMVTADGVNIVAENCMIEGDTGFTKKRFSHPKYFNCWTIETAANQS---------TKDTVRLTVLLSLIPSKEINESRKNFIMDTFSRGEGVKLVVHQSGTYPEIDKHGINVQPGRMNELSFNTEWWVRLKTPTAPCLDDPPPITDMGRQYSYRMTQCLDSYLQNISINQCGCLNSEWPRPIHPDLVNSKIPYCSALPKNVSDSATLEGIIRRLNCT-SNLLHNLKKIKESAILNHICTPRCSFFTYPISASITSWQPIPEKLQHFTDKFKRVERLLNNYDDPLERERLIQYLKEVIDPQEKLSTQIISKSSL---RIEDFQNQGSYTYISLVRTTYDTTYKEERLIFDIYILISRVGGLCSIFIGLTAAIIVELIEFVYV 526          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3W907 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS6893 PE=3 SV=1)

HSP 1 Score: 360.918 bits (925), Expect = 5.471e-113
Identity = 188/481 (39.09%), Postives = 293/481 (60.91%), Query Frame = 1
Query:  295 FRNYHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLL--DKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLP---SKDVPYCNDYSGN------LTTIVKRTQCVYEEVFQKLKPIKAAAVGTK-CWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEEIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYL 1701
            F ++ T+WH  T +D+KT FPAI+IC+HNPF+ +A+  W +  IL P +F  +L  + +  I++GNL   +LL  D  + Y+ N+    S +LGH   +  +C+V  DG  I+AE+C +E +TGFT  +FSH  YFNC+TIE    K+         T +TV L LL+++    ++ ++ ++FVMD+ +RGEG+++V+H+ G+YP+IDK+GIN+QPG+MNE++F    W R  +P   C DD PPI D+ + Y Y   QCLD+ +    + +C C+++ WPRP  P   + +VPYC+    +      L +IVKR  C    +   LK IK +A+  + C P C+F TY  ++SI  W+P   KL   T +++ V + +++   A      ++ LK N I     +     ++S+ + E+  N+    YI+LVR +++TT K E+L  DIYI ISRVGGLCS+ IGLT A F+E+IEF+Y+
Sbjct:   56 FFSFSTSWHSRTLIDDKTDFPAITICAHNPFALEANHIWAKASILTPSEFNRQLSAITLAFIENGNLEYASLLLQDSTDTYFANLRPEESRRLGHQTTMFPHCMVTVDGVNIVAENCTIEGDTGFTKQRFSHPKYFNCWTIETADNKS---------TKDTVRLTLLLSLVSSKEINESRKNFVMDTFSRGEGVKLVVHQSGTYPEIDKHGINVQPGRMNELSFNTERWVRLQTPTAPCLDDPPPITDMGKQYSYRMTQCLDSFLQNISINQCGCLNSEWPRPIHPDLVNTNVPYCSALPKDARDPTTLESIVKRLNCT-TNLLHNLKHIKESAIRERICIPRCSFYTYPLSVSIASWEPIPEKLHHFTDKFKRVERLLNNHDDAVERERLVKYLK-NVIGLEADDTTQNSSMSNLRIEDFENQESYTYISLVRTSYETTYKEERLIFDIYILISRVGGLCSIFIGLTAAIFVELIEFIYV 525          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: U6JLL3 (FMRFamide activated amiloride sensitive sodium OS=Echinococcus granulosus OX=6210 GN=EGR_06322 PE=3 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 5.376e-111
Identity = 188/481 (39.09%), Postives = 289/481 (60.08%), Query Frame = 1
Query:  295 FRNYHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLL--DKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPR---PQLPSKDVPYCNDYSGN------LTTIVKRTQCVYEEVFQKLKPIKAAAVGTK-CWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEEIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYL 1701
            F ++ T+WH  T +D+KT FPAI+IC+HNPF+ +A+  W +  IL P +F  +L  + +  I++GN    +LL  D  + Y+ N+    S +LGH   +  +C+V  DG  I+AE+C +E +TGFT  +FSH  YFNC+TIE    K+         T +TV L LL+++    ++ ++ ++FVMD+ +RGEG+++V+H+ G+YP+IDK+GIN+QPG+MNE++F    W R  +P   C DD PPI D+ + Y Y   QCLD+ +    + +C C+++ WPR   P L +  VPYC+    +      L +IVKR  C    +   LK IK +A+  + C P C+F TY  + SI  W+P   KL+  T +++ V + +++          ++ LK N I           ++SH + E+  N++   YI+LVR +++TT K E+L  DIYI ISRVGGLCS+ IGLT A  +E+IEFVYL
Sbjct:   56 FLSFSTSWHSRTLIDDKTDFPAITICAHNPFALEANHIWAKASILTPSEFNRQLSAITLAFIENGNPEYASLLLQDSTDTYFANLRPEESRRLGHQTTMFPHCMVTVDGVNIVAENCRIEEDTGFTKQRFSHPKYFNCWTIETADNKS---------TKDTVRLTLLLSLVSSKEINESRKNFVMDTFSRGEGVKLVVHQSGTYPEIDKHGINVQPGRMNELSFNTERWVRLQTPTAPCLDDPPPITDMGKQYSYRMNQCLDSFLQNISINQCGCLNSEWPRSINPDLVNTKVPYCSALPKDARDPTILESIVKRLNCT-TNLLHNLKYIKESAIRKRICIPRCSFYTYPLSASIASWEPIPEKLQHFTDKFKRVERLLNNYDDPMERERLVKYLK-NVIGLEGNHTTQNSSMSHLRIEDFENQNSYTYISLVRTSYETTYKEERLIFDIYILISRVGGLCSIFIGLTAAIIVELIEFVYL 525          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A068YBZ2 (FMRFamide activated amiloride sensitive sodium OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000738300 PE=3 SV=1)

HSP 1 Score: 353.214 bits (905), Expect = 4.757e-110
Identity = 187/481 (38.88%), Postives = 288/481 (59.88%), Query Frame = 1
Query:  295 FRNYHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLL--DKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPR---PQLPSKDVPYCNDYSGN------LTTIVKRTQCVYEEVFQKLKPIKAAAVGTK-CWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEEIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYL 1701
            F ++ T+WH  T +D+KT FPAI+IC+HNPF+ +A+  W +  IL P +F  +L  + +  I++GN    +LL  D  + Y+ N+    S +LGH   +  +C+V  DG  I+AE+C +E +TGFT  +FSH  YFNC+TIE    K+         T +TV L LL+++    ++ ++ ++FVMD+ +RGEG+++V+H+ G+YP+IDK+GIN+QPG+MNE++F    W R  +P   C DD PPI D+   Y Y   QCLD+ +    + +C C+++ WPR   P L +  VPYC+    +      L +IV+R  C    +   LK IK +A+  + C P C+F TY  + SI  W+P   KL+  T +++ V + +++          ++ LK N I           ++SH + E+  N++   YI+LVR +++TT K E+L  DIYI ISRVGGLCS+ IGLT A  +E+IEFVYL
Sbjct:   56 FLSFSTSWHSRTLIDDKTDFPAITICAHNPFALEANDIWAKASILTPSEFNRQLSAITLAFIENGNPEYASLLLQDSTDTYFANLRPEESRRLGHQTTMFPHCMVTVDGVNIVAENCRIEEDTGFTKQRFSHPKYFNCWTIETADNKS---------TKDTVRLTLLLSLVSSKEINESRKNFVMDTFSRGEGVKLVVHQSGTYPEIDKHGINVQPGRMNELSFNTERWVRLQTPTAPCLDDPPPITDMGNQYSYRMNQCLDSFLQNISINQCGCLNSEWPRSINPDLVNTKVPYCSALPKDARDPTILESIVRRLNCT-TNLLHNLKYIKESAIRKRICIPRCSFYTYPLSASIASWEPIPEKLQHFTDKFKRVERLLNNYDDPMERERLVKYLK-NVIGLEGNHTTQNSSMSHLRIEDFENQNSYTYISLVRTSYETTYKEERLIFDIYILISRVGGLCSIFIGLTAAIIVELIEFVYL 525          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A183THX6 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS16074 PE=3 SV=1)

HSP 1 Score: 351.288 bits (900), Expect = 2.886e-109
Identity = 192/490 (39.18%), Postives = 279/490 (56.94%), Query Frame = 1
Query:  295 FRNYHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNL--PGQTLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPR---PQLPSKDVPYCNDYSGN------LTTIVKRTQCVYEEVFQKLKPIKAAAVGTK-CWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKP---------TLSHHKSEEIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYL 1701
            F +Y+TAWH  T + +K  FPAI++C+HNPFS +A+  WK+ +IL P  F +RL E+ +E IK   L      LLD  E YY N+    S  L H   +  +C+V  DG  I+AE+C VE +TGFT   FSH  YFNC+T+E  +  +         T ETV L LLI +    ++ +A  +F+MD+ +RGEG+++V+H  G+YP+IDK+GIN+QPG+MNE++FQ I W R  +P   C +D  PI D+   Y Y   QCLD+I+    +  C C+++ WPR     L +  +PYC+    +      L  +V+R  C   ++  ++K +K  A+  + C   C++ TY  + SIT WKP   KL   T++ + V       SL  N      Q K  +I  L+R L             +LS   ++   NE    YI+LVR ++DTT + E+L  D YI ISRVGGLCS+ +GLT AF +E+IEF+YL
Sbjct:   57 FLSYNTAWHARTIIGDKANFPAITVCAHNPFSLEANTIWKKNEILTPTGFNKRLSEITLEFIKHDKLEYASVMLLDSTENYYANLRPNESQTLSHQTDMFPHCMVTADGVRILAENCAVEADTGFTKRYFSHPRYFNCWTLETAANHS---------TRETVRLTLLIRLVPSVEIDEAKNNFIMDTFSRGEGVKLVVHESGTYPEIDKDGINVQPGRMNELSFQTIKWVRLQTPIAPCLEDPKPIFDMGSTYTYRLTQCLDSILQNISINSCGCLNSEWPRTVDSALVNTKIPYCSALPKDPKNPDSLKDMVERLTCA-GDLLHRVKELKEEAIRQRNCISACSYYTYPVSASITSWKPMPEKLNYFTEKCQRVE------SLQNN-----PQQKEKFIRYLERTLNSSSADINSSTITSLSSKFAKNFENEGLYTYISLVRTSYDTTLQEERLIFDFYILISRVGGLCSIFVGLTAAFLVELIEFIYL 525          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: ENSAMXT00000047165.1 (acid-sensing ion channel 1 [Source:NCBI gene;Acc:103026179])

HSP 1 Score: 53.5286 bits (127), Expect = 6.154e-7
Identity = 83/393 (21.12%), Postives = 136/393 (34.61%), Query Frame = 1
Query:  304 YHTAWHVSTELDEKTR----FPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVEN-ETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYID------DISLAKNNTETIEQLKS 1449
            Y+  +   T LDE+      FPAI+IC++N F +    Y             + LF   +   +    PG  L             P   + G    + ++          +  DC     E G    +     Y  C+T  +  +   L+ +        + L+L I  + +  ++   +    ++     G+++ IH     P ID+ G  + PG    V+ Q    T    P  +C+D     +D D    Y+   C      + LVE C C     P       D PYC        T  +  +C    +   ++      V   C   C    Y   LS  +  PS    + + K++    +YI       DI     N ETIEQ K+
Sbjct:  116 YYLQYDHITMLDERNADNMTFPAITICNYNTFRRSQLSY------------SDLLFMGPLLGYEDNMAPGIPLA------------PEPDRQGARFSLAEFFNRTRHRMEDMLLDCAFSGKECGPEHWREIFTRYGKCYTFNSGQDGRPLLVTMKGGMGNGLELMLDIQQDEYLPVWGETDETSFEA-----GIKVQIHTQDEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCRDAP---MDSDFFTTYSITACRIDCETRYLVENCNCRMVHMP------GDAPYC--------TPEQYKECADPALDFLVERDNDYCV---CETPCNMTRYGKELSFVKI-PSKASAKYLAKKFNKSEQYISDNILVLDIFFEALNYETIEQKKA 458          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: ENSAMXT00000038299.1 (acid-sensing ion channel 1 [Source:NCBI gene;Acc:103026179])

HSP 1 Score: 51.6026 bits (122), Expect = 1.867e-6
Identity = 60/267 (22.47%), Postives = 94/267 (35.21%), Query Frame = 1
Query:  691 YFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCND------YSGNLTTIVKRTQ--CVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYID------DISLAKNNTETIEQLKS 1449
            Y  C+T  +  +   L+ +        + L+L I  + +  ++   +    ++     G+++ IH     P ID+ G  + PG    V+ Q    T    P  +C+D     +D D    Y+   C      + LVE C C     P       D PYC            L  +V+R    CV                   C   C    Y   LS  +  PS    + + K++    +YI       DI     N ETIEQ K+
Sbjct:  198 YGKCYTFNSGQDGRPLLVTMKGGMGNGLELMLDIQQDEYLPVWGETDETSFEA-----GIKVQIHTQDEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCRDAP---MDSDFFTTYSITACRIDCETRYLVENCNCRMVHMP------GDAPYCTPEQYKECADPALDFLVERDNDYCV-------------------CETPCNMTRYGKELSFVKI-PSKASAKYLAKKFNKSEQYISDNILVLDIFFEALNYETIEQKKA 430          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Match: asic1c (acid-sensing ion channel 1C-like [Source:NCBI gene;Acc:103034544])

HSP 1 Score: 49.6766 bits (117), Expect = 8.144e-6
Identity = 84/408 (20.59%), Postives = 147/408 (36.03%), Query Frame = 1
Query:  301 NYHTAWHVSTELDEKTR----FPAISICSHNPFSK----QASRYWKEGKI-LPPEKFRERLFEVEMELIKSGNLPGQT--LLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPY--CNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYID------DISLAKNNTETIEQLKSNYINEL 1467
            +Y++  HV T LDE       FPAI++C++N F +    +   +W  G + +    F + +  +   +  S   P +T  +L+  +    ++D           ++L  C  +        +DC  EN T        +  Y  C+T  +  + N L+ +    T   + ++L I  + +  ++        D  +   G+++ IH     P ID+ G  + PG    V+ Q         P  +CK      +D +    Y+   C      + L+E C C     P          Y  C D + +         CV                   C   C    Y   LS+ +  PS    + + K++    +YI       DI     N E IEQ K+  +  L
Sbjct:   64 DYYSYPHV-TILDEMDSPLMYFPAITLCNYNSFRRSKMIRNDLFWMAGMLGVEQSDFDDFMAALGQPVDDSKFFPSKTFNMLEFVQRTSHSID-----------EMLLDCKYR-------GKDCGPENFTTI------YTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGDT-----DETSYEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQQQLLQYLPPPWGDCKSTP---IDSEFFSTYSITACRIDCETRYLLENCNCRMVHMPGTSTVCTPEQYKDCADPALDFLVEKDNDYCV-------------------CQTPCNMTRYGKELSMVKI-PSKASAKYLAKKFNKTEQYIGDNILVLDIFFEALNYEKIEQKKAYEVAGL 418          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: asic1b (acid-sensing (proton-gated) ion channel 1b [Source:NCBI gene;Acc:407672])

HSP 1 Score: 50.8322 bits (120), Expect = 6.575e-7
Identity = 62/271 (22.88%), Postives = 95/271 (35.06%), Query Frame = 1
Query:  688 NYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTK-----CWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYID------DISLAKNNTETIEQLKSNYINEL 1467
             Y  C+T  +      L+ +        + ++L I    +  ++  N+    ++     G+++ IH     P ID+ G  + PG    V+ Q         P  +CK    PI   D    Y+   C      + LVE C C     P       D PYC        T  + T+C         +P+    V        C   C    Y   LS+ +  PS    + + K+Y     YI       DI     N ETIEQ K+  +  L
Sbjct:  196 RYGKCYTFNSGKGGRPLLTTVKGGMGNGLEIMLDIQQEEYLPVWGENDETSFEA-----GIKVQIHSQDEPPLIDQLGFGVSPGFQTFVSCQEQRLIYLPPPWGDCKST--PISS-DFFETYSITACRIDCETRYLVENCNCRMVHMP------GDAPYC--------TPEQYTECA--------RPVLDVLVKRDNDFCLCETPCNMTRYGKELSMVK-IPSKASAKYLAKKYNKTEAYIAENVLVLDIFFEALNYETIEQKKAYEVAGL 435          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 48.9062 bits (115), Expect = 3.431e-6
Identity = 41/170 (24.12%), Postives = 72/170 (42.35%), Query Frame = 1
Query:  670 SQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQP--PIVDL-DRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCN 1170
            S+F H  Y NC+T  + +    L ++     +  +SLIL    N +           +  L+   G RI++H   S P +++ G +++PG    +  + +  TR   P   C +D    P+++L    Y     +C  +     LVE C C    +P P     +  YC+
Sbjct:  231 SRFHHPTYGNCYTFNSANSSK-LWQASKPGRDYGLSLILRTEQNDY-----------IPFLSTVAGARIMVHDQESPPFMEEGGFDMRPGFETSLGIRMLEATRMPDPYGNCTEDGSNVPVLNLYSSAYTVQVPEC--SCFQLALVEACGCGYYFYPLP----PNASYCS 382          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 59.3066 bits (142), Expect = 3.425e-9
Identity = 69/344 (20.06%), Postives = 131/344 (38.08%), Query Frame = 1
Query:  688 NYFNCFTIEAKSEKNG-LIKSYGDKT-NETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDY----TFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQIT--KRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEEIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFV 1695
            N+ NC+   +    NG  +  Y      E+  L L +N+       + NE   ++ +T   G+++ I   G  P   + GI I PG+   +    +   R    K    +    + D +  + Y    +   C  + +N   +E+C C  T +  P++  +++P CN  +  +   + +    +E+           +   +C P C+  ++D T+S  RW     ++ +     R R +NK     S    N+E I Q+   Y                          +++Y+ LV+         E L       +S +GG   + IG++     E+IE V
Sbjct:  198 NFGNCYMFNSVKTHNGEKVDLYSSSVPGESNGLTLQLNL-------EQNE--YLEGITEVAGMKVTISDQGVLPFPGQQGIRIMPGQSTGIQMTKLQTRRIDPFKNRSCESSNEMSDKNLFFGYNMTYSIMACKYSCLNARKIERCGC--TNYNTPEMQKRNIPLCNRLNSTIIDCLNKAYDTFED----------GSCDRECPPSCSEVSFDLTVSSARWPARSFEVTKYAYFLRVRVLNKIASSSSKYFVNSENIAQVHVYY-------------------------GELDYL-LVQ---------ETLAYTFMSLLSDIGGQMGMWIGISALTCAELIELV 485          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO34318 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPS2])

HSP 1 Score: 52.7582 bits (125), Expect = 3.065e-7
Identity = 60/256 (23.44%), Postives = 102/256 (39.84%), Query Frame = 1
Query:  628 AEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSS-PKRECKDDQPPIVDLDR------IYDYTFAQ--CLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITK 1368
              DC     TG    +F H  Y NCF        N LI   G K     +L    N  L  +L    + ++ D L+   G  I +  VG  P  ++ GI++ PG    +    +  +R  +   R C ++   I + DR       Y+ T+++  CL+  +     + C CM       + P ++   C+  +      ++R + +      K+K +   A   +C   C   TY +T S + W P+L    +I K
Sbjct:   40 GSDCRANATTGRYWGRFWHNKYGNCFVF------NPLIGWNGKKRRALTALRAGPNYGLTLELNVEQDEYI-DGLSTKAGAVIQVSPVGYMPFPEEEGIDVSPGFSTSIALTKVKISRVDAFGNRSCVNE---ITEKDRENLYHVKYNATYSKTACLNFCLAYNQRKTCNCMEY-----RFPVEEEAVCDTMNKTTVECLRRVREML-----KMKKLNCTA---ECSAPCNQETYKTTSSFSMW-PALNYKEKINK 271          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: ENSORLT00000031708.1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 55.8398 bits (133), Expect = 9.135e-8
Identity = 90/404 (22.28%), Postives = 144/404 (35.64%), Query Frame = 1
Query:  304 YHTAWHVSTELDEKTR----FPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLLDKAEEYYGN---VDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVEN-ETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCND------YSGNLTTIVKRTQ--CVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYID------DISLAKNNTETIEQLKS 1449
            Y+  +   T LDEK      FPAI+IC++N   K    Y             + +F   +   + G  PG  L  + +   G+   +D   +     + ++L  C  +         +C  EN +  FT        Y  C+T  +  +   L+ +    T   + L+L I  + +  ++   +    ++     G+++ IH     P ID+ G  + PG    V+ Q    T    P  +CK      +D D    Y+   C      + LVE C C     P       D PYC+           L  +V+R    CV                   C   C    Y   LS  +  PS    + + K++    +YI       DI     N ETIEQ K+
Sbjct:  114 YYRQYDRITLLDEKVANNMTFPAITICNYNLVRKTQMSY------------SDLIFMGPLLGFEDGMAPGFALAPEPDRPLGSRFSLDEFYTRTRHRIDEMLLDCSFR-------GLECGPENFKEIFT-------RYGKCYTFNSGKDGQPLMVTMKGGTGNGLELMLDIQQDEYLPVWGETDETSFEA-----GIKVQIHTQEEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKSTP---MDSDFFNSYSITACRIDCETRYLVENCNCRMVHMP------GDAPYCSPEQYKECADPALDFLVERDNDYCV-------------------CETPCNLTRYGKELSFVKI-PSKASAKYLAKKFNKTEQYIADNILVLDIFFEALNYETIEQKKA 457          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: ENSORLT00000008662.2 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 54.6842 bits (130), Expect = 2.259e-7
Identity = 74/312 (23.72%), Postives = 112/312 (35.90%), Query Frame = 1
Query:  562 KLGH-VRKILQYCVVQNDGFTIIAEDCLVEN-ETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCND------YSGNLTTIVKRTQ--CVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYID------DISLAKNNTETIEQLKS 1449
            +LGH + ++L YC  Q        E C   N  T FT        Y  C+T  +  +   L+ +    T   + L+L I  + +  ++   +    ++     G+++ IH     P ID+ G  + PG    V+ Q    T    P  +CK      +D D    Y+   C      + LVE C C     P       D PYC+           L  +V+R    CV                   C   C    Y   LS  +  PS    + + K++    +YI       DI     N ETIEQ K+
Sbjct:  177 RLGHQLEEMLLYCRYQ-------GELCGPRNFSTIFT-------RYGKCYTFNSGKDGQPLMVTMKGGTGNGLELMLDIQQDEYLPVWGETDETSFEA-----GIKVQIHTQEEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKSTP---MDSDFFNSYSITACRIDCETRYLVENCNCRMVHMP------GDAPYCSPEQYKECADPALDFLVERDNDYCV-------------------CETPCNLTRYGKELSFVKI-PSKASAKYLAKKFNKTEQYIADNILVLDIFFEALNYETIEQKKA 440          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: ENSORLT00000021936.2 (acid-sensing ion channel 1C [Source:NCBI gene;Acc:101174951])

HSP 1 Score: 52.7582 bits (125), Expect = 8.320e-7
Identity = 83/394 (21.07%), Postives = 136/394 (34.52%), Query Frame = 1
Query:  352 FPAISICSHNPFSKQA--------SRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLLDKAEEYYGNVDYPSSI-----KLGH-VRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPY--CNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYID------DISLAKNNTETIEQLKSNYINEL 1467
            FPA+++C+ N F   A        S YW +  ++ P      L    + ++K  + PG   L     Y    DY  +      +LGH +  +L  C  +        E C   N +        +  Y  C+T  +  + N L+ +    T   + ++L I  + +  ++        D  +   G+++ IH     P ID+ G  + PG    V+ Q         P  +CK      +D +    Y+   C      + L+E C C     P          Y  C D + +         CV                   C   C    Y   LS+ +  PS    + + K++    +YI       DI     N E IEQ K+  I  L
Sbjct:  105 FPAVTLCNKNVFRVSALTKDDLYHSGYWMD--LMNPN---HTLINRSLSILKESHRPGLLRLLDFRNYAPPPDYSVNTTEMMSRLGHQLEDMLLECKFR-------GETCTFRNFSTI------YTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGET-----DETSYEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQQQLLQYLPPPWGDCKSTP---IDSEFFSTYSITACRIDCETRYLLENCNCRMVHMPGTSTVCTPDQYKDCADPALDFLVEKDNNYCV-------------------CETPCNMTRYGKELSMVK-IPSKASAKYLAKKFNKTEQYIGDNILVLDIFFEALNYEKIEQKKAYEIAGL 452          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: ENSORLT00000035361.1 (acid-sensing ion channel 1C [Source:NCBI gene;Acc:101174951])

HSP 1 Score: 52.373 bits (124), Expect = 1.177e-6
Identity = 83/394 (21.07%), Postives = 136/394 (34.52%), Query Frame = 1
Query:  352 FPAISICSHNPFSKQA--------SRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLLDKAEEYYGNVDYPSSI-----KLGH-VRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPY--CNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYID------DISLAKNNTETIEQLKSNYINEL 1467
            FPA+++C+ N F   A        S YW +  ++ P      L    + ++K  + PG   L     Y    DY  +      +LGH +  +L  C  +        E C   N +        +  Y  C+T  +  + N L+ +    T   + ++L I  + +  ++        D  +   G+++ IH     P ID+ G  + PG    V+ Q         P  +CK      +D +    Y+   C      + L+E C C     P          Y  C D + +         CV                   C   C    Y   LS+ +  PS    + + K++    +YI       DI     N E IEQ K+  I  L
Sbjct:  105 FPAVTLCNKNVFRVSALTKDDLYHSGYWMD--LMNPN---HTLINRSLSILKESHRPGLLRLLDFRNYAPPPDYSVNTTEMMSRLGHQLEDMLLECKFR-------GETCTFRNFSTI------YTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGET-----DETSYEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQQQLLQYLPPPWGDCKSTP---IDSEFFSTYSITACRIDCETRYLLENCNCRMVHMPGTSTVCTPDQYKDCADPALDFLVEKDNNYCV-------------------CETPCNMTRYGKELSMVKI-PSKASAKYLAKKFNKTEQYIGDNILVLDIFFEALNYEKIEQKKAYEIAGL 452          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: ENSORLT00000031246.1 (acid sensing ion channel subunit 1 [Source:NCBI gene;Acc:101155423])

HSP 1 Score: 51.6026 bits (122), Expect = 1.973e-6
Identity = 61/267 (22.85%), Postives = 95/267 (35.58%), Query Frame = 1
Query:  691 YFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCND------YSGNLTTIVKRTQ--CVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYID------DISLAKNNTETIEQLKS 1449
            Y  C+T  +  +   L+ +    T   + L+L I  + +  ++   +    ++     G+++ IH     P ID+ G  + PG    V+ Q    T    P  +CK      +D D    Y+   C      + LVE C C     P       D PYC+           L  +V+R    CV                   C   C    Y   LS  +  PS    + + K++    +YI       DI     N ETIEQ K+
Sbjct:  191 YGKCYTFNSGKDGQPLMVTMKGGTGNGLELMLDIQQDEYLPVWGETDETSFEA-----GIKVQIHTQEEPPFIDQLGFGVAPGFQTFVSCQEQRLTYLPPPWGDCKSTP---MDSDFFNSYSITACRIDCETRYLVENCNCRMVHMP------GDAPYCSPEQYKECADPALDFLVERDNDYCV-------------------CETPCNLTRYGKELSFVKI-PSKASAKYLAKKFNKTEQYIADNILVLDIFFEALNYETIEQKKA 423          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000016707.1 (SMESG000016707.1)

HSP 1 Score: 1102.81 bits (2851), Expect = 0.000e+0
Identity = 545/546 (99.82%), Postives = 545/546 (99.82%), Query Frame = 1
Query:  295 FRNYHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEEIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYLCXXXXXXXXXXXXXXYTENPNADLNFYNFSPQHDALFKNKCETYFNEDKSYWQDLNPICQCQPITSSLYPSQINDSI 1932
            FRNYHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEEIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYLCSTSSSSNSAANNKNYTENPNADLNFYNFSPQHDALFKNKCETYFNEDKSYWQDLNPICQCQPITSSLY SQINDSI
Sbjct:  102 FRNYHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEEIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYLCSTSSSSNSAANNKNYTENPNADLNFYNFSPQHDALFKNKCETYFNEDKSYWQDLNPICQCQPITSSLYSSQINDSI 647          

HSP 2 Score: 203.371 bits (516), Expect = 1.439e-56
Identity = 98/98 (100.00%), Postives = 98/98 (100.00%), Query Frame = 2
Query:    2 NKKEEKNRPKLQNNYIGLNHSKMHSFLTEDCKQFLSHNHDPNLKTPISKFAIFCEASSVRGMQKIHKSKTPFLKALWIAFVFFMSILLIIISTNLVID 295
            NKKEEKNRPKLQNNYIGLNHSKMHSFLTEDCKQFLSHNHDPNLKTPISKFAIFCEASSVRGMQKIHKSKTPFLKALWIAFVFFMSILLIIISTNLVID
Sbjct:    4 NKKEEKNRPKLQNNYIGLNHSKMHSFLTEDCKQFLSHNHDPNLKTPISKFAIFCEASSVRGMQKIHKSKTPFLKALWIAFVFFMSILLIIISTNLVID 101          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000045131.1 (SMESG000045131.1)

HSP 1 Score: 426.017 bits (1094), Expect = 1.261e-141
Identity = 220/470 (46.81%), Postives = 308/470 (65.53%), Query Frame = 1
Query:  295 FRNYHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEEIF-NEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYL 1701
            F NY+TAWH ST  DEKT FPAISICSHNPFS+ A+R W+E  ++ P+KF E L  V + ++K+    G+ L D AE YYGN++Y SS+ L H  +IL+YCV+  D +  IAE C + +   + + +FS+  YFNCFTIE   EK     +    T E +S+I+LI +   SDL Q N SFVMD+LTRG G+++V+H VG+ P+I+  GIN+QPGKMNE++F+ IHW RY+SPKR C ++Q  I+DL   Y YT ++C++A + K  ++ C CM++ WPRP  PS+++PYC ++S +   I+KR +C      +     K   V TKC+ +C++ TYD+ +S+T WKPSL KL ++T+ Y+  N         +N TET E        E  ++LK KP  +  K+  +  +E +  YIN+VRKNFDT KK E+L ID  IF+SRVGGLCSL +GLTTA F E+IEF YL
Sbjct:  135 FFNYNTAWHTSTAFDEKTEFPAISICSHNPFSENANRMWQENLVMTPKKFEELLTNVSINMVKNNRGGGEILYDSAEYYYGNIEYESSVNLSHKEEILRYCVLTTDAYVYIAEQCDLASYVAYRLRKFSNSKYFNCFTIEEDPEKLKTHSADVVSTRELLSIIILIQITPESDLTQINSSFVMDTLTRGTGVKVVLHEVGTSPEIENYGINLQPGKMNEISFETIHWNRYNSPKRPCLNNQSNIIDLGNSYKYTMSKCVEAELQKSTIKNCGCMNSNWPRPVKPSQNIPYCTNFSCSTDEILKRYEC---SSIKDQGLTKQKLVDTKCFGVCSYFTYDTKVSVTNWKPSLYKLNRVTQIYKLAN---------ENYTETDEGK-----TERVKKLKEKPQDTISKNLNMLTDESRFTYINVVRKNFDTIKKTERLVIDASIFMSRVGGLCSLLVGLTTAVFAELIEFCYL 587          

HSP 2 Score: 53.9138 bits (128), Expect = 2.959e-7
Identity = 23/51 (45.10%), Postives = 33/51 (64.71%), Query Frame = 2
Query:  143 SKFAIFCEASSVRGMQKIHKSKTPFLKALWIAFVFFMSILLIIISTNLVID 295
            S   +FCEA S+RGMQKI ++   FL+++WI +V  M+ LL + S  L  D
Sbjct:   84 SPLTLFCEAISIRGMQKIARAPNNFLRSVWIGYVILMTTLLTVTSYFLFRD 134          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000064696.1 (SMESG000064696.1)

HSP 1 Score: 340.502 bits (872), Expect = 2.905e-108
Identity = 184/476 (38.66%), Postives = 291/476 (61.13%), Query Frame = 1
Query:  295 FRNYHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQTLL----DKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSG-NLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSE--EIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYL 1701
            + NY+TAWHV T+ D+ + FPAI++CSHNPFS +A+  WK+     PE FRERL +V ++ + +   P +  L    DK E YY N+DY  S+K+ H  ++L+YC + +DG  II  +C  E +       FSH  +FNC+TI+  S       +Y  +T    SLI+L+++   +D+ +   SF+MD L RGEGL++VIH   SYP+I++ GI++QPGKMN + ++ + W R+S+P ++CK+ Q PI DL R ++Y+F+ C++  +  +L+E C CM+ ++PRP +P++ + YC + +  N + I    +C  ++    +K +K     TKC   C + TY++ LSIT+W PS  KL +I         Y+      KN+ E   + K +YI+ ++  +    T S+  S   ++ NE++  YI+L RK  +T  K E+L +D+ I +SR+GGLCSL IGLT +FFIE++EF YL
Sbjct:   77 YLNYYTAWHVRTKFDDNSEFPAITLCSHNPFSLRANSLWKKPNAPNPEMFRERLKQVVIDEVNTTKDPNELTLMMFHDKIENYYMNIDYDFSLKISHGTEMLKYCAIFSDGLIIITYNCETEKDKVVEKIVFSHQKFFNCYTIQQTS-------NYSQQT--ITSLIILVSLTPAADIPELKNSFLMDILERGEGLKLVIHEPNSYPEIEEEGIDVQPGKMNNIKYEPVKWARHSTPPQKCKNGQSPIFDLKRQFNYSFSFCMNYNLQLKLIETCGCMNALFPRPFIPNEKIGYCMNLTHRNSSQIFTNLKCA-QDFTMNVKTLKKQWENTKCMQKCNYFTYNTELSITKWVPSYEKLFRIADLINKTEIYL------KNHRE--RESKEDYISYIQANI----TNSYINSSFLDLENENKFTYISLSRKTRNTVIKDEELVLDLAILMSRIGGLCSLFIGLTVSFFIELVEFGYL 530          

HSP 2 Score: 60.077 bits (144), Expect = 3.804e-9
Identity = 28/49 (57.14%), Postives = 36/49 (73.47%), Query Frame = 2
Query:  149 FAIFCEASSVRGMQKIHKSKTPFLKALWIAFVFFMSILLIIISTNLVID 295
            F +FCE SS+RGM KI K+ T FLK LWIAFVF M+ LL +++  L+ D
Sbjct:   28 FNLFCEISSIRGMHKITKAPTLFLKVLWIAFVFCMTSLLFLVTGLLIKD 76          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000081715.1 (SMESG000081715.1)

HSP 1 Score: 322.013 bits (824), Expect = 3.409e-101
Identity = 175/475 (36.84%), Postives = 271/475 (57.05%), Query Frame = 1
Query:  304 YHTAWHVSTELDEKTRFPAISICSHNPFSKQASRYWKEGKILPPEKFRERLFEVEMELIKSGNLPGQ---TLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSG--NLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEEI-----FNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVY 1698
            Y TAWH STELD  + FPAI++C+ NPFS  A+R W + KI+ P + ++ L  + +      NL G     L D    +Y N+ +  +IKLGH + +++YC++      IIAE C ++NE  F +  FSH  YFNC+TIE        ++ Y   T + + LILL+ +     + + + SF++D L RGEGL++ +H+  +YPDI+ +GIN+ P KMN + +    W R S+ K  C+D Q PI DL+R + Y F QC+ A + ++++++C CM +  PRP  P++ +PYC           I++R  CV E +  +   I+       C+  C F TY++T+S+TRW  + LKL+ +   YRS   Y  + S     +E I ++KS  +N L R    +  ++ ++   +     F+E+   YI+L+R+NFD   K EKL +D     SR+GGL S+CIGLT A F E IEF+Y
Sbjct:   56 YTTAWHTSTELDYPSPFPAITLCAQNPFSIDANRLWSKRKIMSPSELQDNLTIMSLNAFDDKNLDGLEYLRLYDLFSTFYMNLPFLDTIKLGHSKDMIRYCILIYKNDIIIAEKCDLKNE-KFNIKLFSHQEYFNCYTIEG-------LEQY---TTDVIGLILLVQIIPSEKIPELSNSFLVDILQRGEGLKVAVHQPQTYPDIENSGINMHPAKMNSLVYSPTKWIRMSTSKNPCRDKQKPINDLNRHFKYAFTQCVSAEIQRQIIKQCGCMLSNAPRPYPPNETIPYCIKLVSPTKAKLILERLSCV-ENIQSQSVEIRKTIQNDLCFLKCQFTTYETTMSLTRWTANELKLKNLENLYRSYFAYRHNSS-----SENIVKIKSILLNSLNRSHNLRHQINKNQFNNLINYSRFDENAFTYISLMRRNFDIQWKTEKLVLDSNTLFSRMGGLTSICIGLTAAVFAEFIEFLY 513          

HSP 2 Score: 50.447 bits (119), Expect = 4.258e-6
Identity = 23/57 (40.35%), Postives = 35/57 (61.40%), Query Frame = 2
Query:  140 ISKFAIFCEASSVRGMQKIHKSKTPFLKALWIAFVFFMSILLIIISTNLVIDSVIIT 310
            +SK  +FC+ SS+RG+ KIH +KT F + LW  FV  M+ +L +    L+ D +  T
Sbjct:    1 MSKTKLFCQISSIRGISKIHSAKTKFERFLWTGFVILMTCVLFVQMVFLIQDYLQYT 57          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000029017.1 (SMESG000029017.1)

HSP 1 Score: 298.13 bits (762), Expect = 7.216e-94
Identity = 154/380 (40.53%), Postives = 235/380 (61.84%), Query Frame = 1
Query:  565 LGHVRKILQYCVVQNDGFTIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNETVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKNGINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQCLDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCVYEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITKRYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELK-YKPTLSHHKSEEIFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTAFFIEIIEFVYL 1701
            + H+++  Q+CVV      +++ +C  +     +V  FSH NYFNC+T+E K   +G         ++  SLI++ ++   S + +  ++FVMD L RGEGL+IV+H  G+YPDIDK+G NIQPGK+NE+ ++ I W   S+P + C+DDQ  I+DLDR+++YTF QC+DA + K L+E+C C+S++WPR + P++  PYC +        +  T          +K  K +    KC+P C F TY +TLSIT+W PS+ KL +I +  + V        L +N T+  +  K N+ + L+ + + Y+ +L +    +  NE +  YI L+RKN +TT KIEKL +D+ I +SR+GGLCSL IGLT AFFIE+IEF+YL
Sbjct:    1 MSHLKEFFQFCVVDVQHQKLVSRNCTGDLSEYLSVRMFSHRNYFNCWTVEPKKTMSGTF-------HDISSLIVVASLIPSSLIPELKDAFVMDILERGEGLKIVLHETGTYPDIDKDGFNIQPGKLNEIAYEPIKWKFLSTPVKICRDDQKEIIDLDRVFNYTFTQCVDAALQKLLLEECNCLSSLWPRHKTPNEKFPYCFNVWRETVNEINETIICTSNFMNNMKARKLSVQMNKCFPRCNFFTYSTTLSITKWLPSIQKLDRIHRVQQEVEM------LVRNRTD--KTFKDNFSSFLENKYQNYRNSLDN----DSLNEDRFTYIKLIRKNKNTTIKIEKLILDVAILLSRIGGLCSLFIGLTVAFFIELIEFIYL 361          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCNN1G1.866e-823.08sodium channel epithelial 1 gamma subunit [Source:... [more]
SCNN1A2.158e-823.98sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A2.253e-823.98sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A2.764e-823.98sodium channel epithelial 1 alpha subunit [Source:... [more]
ASIC14.928e-822.20acid sensing ion channel subunit 1 [Source:HGNC Sy... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
asic-21.751e-827.33Degenerin-like protein asic-2 [Source:UniProtKB/S... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
asic27.998e-822.76acid-sensing (proton-gated) ion channel 2 [Source:... [more]
asic27.998e-822.76acid-sensing (proton-gated) ion channel 2 [Source:... [more]
asic1a3.578e-726.44acid-sensing (proton-gated) ion channel 1a [Source... [more]
asic1b3.748e-724.04acid-sensing (proton-gated) ion channel 1b [Source... [more]
asic1b8.124e-721.88acid-sensing (proton-gated) ion channel 1b [Source... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
copg23.802e-923.39coatomer protein complex subunit gamma 2 [Source:X... [more]
cdh121.049e-820.83cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh121.066e-824.48cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
cdh121.256e-824.48cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
copg21.416e-824.40coatomer protein complex subunit gamma 2 [Source:X... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scnn1a1.334e-723.38sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a1.334e-723.38sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a1.382e-723.38sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a1.397e-723.38sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a1.454e-723.38sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP1.051e-1221.33FMRFamide-activated amiloride-sensitive sodium cha... [more]
sp|O13263|SCNNH_XENLA4.595e-924.90Amiloride-sensitive sodium channel subunit gamma-2... [more]
sp|H2QAR5|SCNNG_PANTR1.279e-822.20Amiloride-sensitive sodium channel subunit gamma O... [more]
sp|P51170|SCNNG_HUMAN8.960e-823.08Amiloride-sensitive sodium channel subunit gamma O... [more]
sp|H2Q5A1|SCNNA_PANTR1.010e-723.98Amiloride-sensitive sodium channel subunit alpha O... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3UEW83.414e-11538.92Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A0R3W9075.471e-11339.09Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
U6JLL35.376e-11139.09FMRFamide activated amiloride sensitive sodium OS=... [more]
A0A068YBZ24.757e-11038.88FMRFamide activated amiloride sensitive sodium OS=... [more]
A0A183THX62.886e-10939.18Uncharacterized protein OS=Schistocephalus solidus... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSAMXT00000047165.16.154e-721.12acid-sensing ion channel 1 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000038299.11.867e-622.47acid-sensing ion channel 1 [Source:NCBI gene;Acc:1... [more]
asic1c8.144e-620.59acid-sensing ion channel 1C-like [Source:NCBI gene... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
asic1b6.575e-722.88acid-sensing (proton-gated) ion channel 1b [Source... [more]
SCNN1A3.431e-624.12sodium channel epithelial 1 alpha subunit [Source:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO421373.425e-920.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343183.065e-723.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000031708.19.135e-822.28acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
ENSORLT00000008662.22.259e-723.72acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
ENSORLT00000021936.28.320e-721.07acid-sensing ion channel 1C [Source:NCBI gene;Acc:... [more]
ENSORLT00000035361.11.177e-621.07acid-sensing ion channel 1C [Source:NCBI gene;Acc:... [more]
ENSORLT00000031246.11.973e-622.85acid sensing ion channel subunit 1 [Source:NCBI ge... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016707.11.439e-5699.82SMESG000016707.1[more]
SMESG000045131.11.261e-14146.81SMESG000045131.1[more]
SMESG000064696.12.905e-10838.66SMESG000064696.1[more]
SMESG000081715.13.409e-10136.84SMESG000081715.1[more]
SMESG000029017.17.216e-9440.53SMESG000029017.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031470 ID=SMED30031470|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1976bp
TAACAAAAAAGAAGAGAAAAATCGGCCAAAACTCCAAAATAATTACATTG
GTCTCAACCATTCTAAAATGCACTCATTTCTCACTGAGGATTGCAAACAA
TTCCTCTCTCATAATCATGATCCAAACCTCAAAACCCCTATCAGTAAGTT
TGCGATATTCTGTGAAGCATCTTCCGTAAGGGGAATGCAAAAGATCCACA
AATCTAAAACTCCATTTCTCAAAGCACTTTGGATTGCTTTTGTGTTTTTC
ATGTCGATTCTATTGATAATAATTTCCACAAATTTAGTCATTGATTCCGT
AATTATCACACGGCTTGGCACGTAAGCACGGAACTTGATGAAAAGACGAG
ATTCCCGGCAATAAGCATCTGTTCTCACAATCCATTCTCAAAACAAGCCA
GTAGATATTGGAAGGAAGGAAAAATTCTTCCACCCGAAAAGTTTCGTGAA
AGACTATTTGAAGTAGAAATGGAGCTAATCAAGTCAGGCAATCTTCCAGG
TCAAACTTTGCTGGACAAAGCTGAAGAATACTACGGAAACGTTGATTATC
CCAGTTCCATTAAACTTGGACATGTGAGAAAGATTTTACAGTATTGTGTG
GTACAGAACGATGGGTTTACTATAATCGCAGAAGACTGTTTGGTGGAAAA
CGAAACCGGATTTACGGTGTCGCAATTTTCGCATTATAACTATTTCAATT
GTTTTACAATCGAAGCGAAATCGGAGAAAAACGGCTTAATAAAATCTTAC
GGAGATAAAACGAATGAAACGGTGTCGTTGATTCTTCTAATAAATGTCAA
CCTATTTTCTGACTTATTTCAAGCCAATGAAAGCTTTGTGATGGATAGCT
TGACGCGAGGAGAAGGCTTACGGATAGTGATCCACCGGGTCGGATCCTAT
CCCGACATTGATAAAAACGGAATCAACATTCAACCAGGTAAAATGAATGA
GGTAAATTTCCAAAATATCCATTGGACCCGATATAGTTCTCCAAAACGAG
AATGTAAGGATGACCAACCTCCGATTGTTGATTTGGATAGGATTTACGAT
TACACATTTGCTCAGTGTCTTGATGCTATAGTTAATAAAGAATTAGTGGA
AAAATGTCAATGCATGTCAACGATTTGGCCACGACCTCAGTTACCAAGCA
AAGACGTTCCTTACTGCAATGATTATTCGGGAAATCTCACAACTATTGTA
AAGAGAACCCAATGCGTATATGAAGAAGTGTTTCAAAAACTAAAGCCGAT
CAAAGCTGCCGCAGTCGGGACGAAATGTTGGCCACTTTGCACATTCAACA
CTTACGACAGTACGCTTTCTATAACTCGATGGAAACCTTCTTTGCTTAAA
CTACGTCAAATTACGAAGCGCTATCGAAGCGTAAACAAATACATTGACGA
TATTTCGTTAGCGAAAAACAATACAGAAACCATTGAGCAATTGAAATCTA
ATTATATCAATGAACTGAAACGAGAACTGAAATACAAACCGACCCTAAGC
CATCATAAATCCGAAGAGATATTCAACGAACATCAAATGAACTACATTAA
TTTGGTAAGGAAAAACTTTGATACGACAAAGAAAATAGAGAAATTATTCA
TAGATATCTATATCTTTATTTCCAGAGTCGGTGGACTGTGTTCTCTCTGT
ATTGGACTCACCACCGCATTTTTCATTGAGATAATCGAATTTGTATATTT
ATGTTCCACTTCATCCTCTTCAAATAGCGCTGCAAACAACAAAAACTACA
CAGAAAATCCAAACGCAGATTTGAACTTTTACAACTTCAGTCCCCAACAT
GATGCTCTCTTTAAAAACAAATGTGAAACCTATTTTAACGAAGACAAATC
CTACTGGCAAGACCTGAATCCGATCTGTCAATGTCAGCCCATTACATCAT
CACTATATCCTTCTCAAATTAATGACTCTATTTGAACATAAATTAATATG
ATTAAGATTTATCATTTTTTCAGCAT
back to top

protein sequence of SMED30031470-orf-1

>SMED30031470-orf-1 ID=SMED30031470-orf-1|Name=SMED30031470-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=108bp
NKKEEKNRPKLQNNYIGLNHSKMHSFLTEDCKQFLSHNHDPNLKTPISKF
AIFCEASSVRGMQKIHKSKTPFLKALWIAFVFFMSILLIIISTNLVIDSV
IITRLGT*
back to top

protein sequence of SMED30031470-orf-2

>SMED30031470-orf-2 ID=SMED30031470-orf-2|Name=SMED30031470-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=489bp
MELIKSGNLPGQTLLDKAEEYYGNVDYPSSIKLGHVRKILQYCVVQNDGF
TIIAEDCLVENETGFTVSQFSHYNYFNCFTIEAKSEKNGLIKSYGDKTNE
TVSLILLINVNLFSDLFQANESFVMDSLTRGEGLRIVIHRVGSYPDIDKN
GINIQPGKMNEVNFQNIHWTRYSSPKRECKDDQPPIVDLDRIYDYTFAQC
LDAIVNKELVEKCQCMSTIWPRPQLPSKDVPYCNDYSGNLTTIVKRTQCV
YEEVFQKLKPIKAAAVGTKCWPLCTFNTYDSTLSITRWKPSLLKLRQITK
RYRSVNKYIDDISLAKNNTETIEQLKSNYINELKRELKYKPTLSHHKSEE
IFNEHQMNYINLVRKNFDTTKKIEKLFIDIYIFISRVGGLCSLCIGLTTA
FFIEIIEFVYLCSTSSSSNSAANNKNYTENPNADLNFYNFSPQHDALFKN
KCETYFNEDKSYWQDLNPICQCQPITSSLYPSQINDSI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 53..107
e-value: 3.0E-7
score: 29.8
NoneNo IPR availableTMHMMTMhelixcoord: 75..97