Propionyl-CoA carboxylase alpha chain, mitochondrial

Overview
NamePropionyl-CoA carboxylase alpha chain, mitochondrial
Smed IDSMED30031468
Length (bp)2582
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Propionyl-CoA carboxylase alpha chain, mitochondrial (SMED30031468) t-SNE clustered cells

Violin plots show distribution of expression levels for Propionyl-CoA carboxylase alpha chain, mitochondrial (SMED30031468) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Propionyl-CoA carboxylase alpha chain, mitochondrial (SMED30031468) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Propionyl-CoA carboxylase alpha chain, mitochondrial (SMED30031468) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031468

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 14

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031468SMESG000034830.1 dd_Smed_v4_1247_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031468SMESG000034830.1 dd_Smed_v4_1247_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031468SMESG000034830.1 dd_Smed_v4_1247_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031468SMESG000034830.1 dd_Smed_v4_1247_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031468SMESG000034830.1 dd_Smed_v4_1247_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031468SMESG000034830.1 dd_Smed_v4_1247_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031468SMESG000034830.1 dd_Smed_v4_1247_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031468SMESG000034830.1 dd_Smed_v4_1247_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031468SMESG000076084.1 SMESG000043241.1 SMESG000034830.1 Contig48882uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031468SMESG000076084.1 SMESG000043241.1 SMESG000034830.1 Contig48882newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031468SMESG000034830.1 Contig35210uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031468SMESG000034830.1 Contig35210newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30031468SMESG000034830.1 dd_Smed_v6_1247_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pharynx progenitor cellSMED30031468SMESG000034830.1 dd_Smed_v6_1247_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Human
Match: PCCA (propionyl-CoA carboxylase subunit alpha [Source:HGNC Symbol;Acc:HGNC:8653])

HSP 1 Score: 840.491 bits (2170), Expect = 0.000e+0
Identity = 407/690 (58.99%), Postives = 532/690 (77.10%), Query Frame = 1
Query:  166 HDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            +DP E  F KIL+ANRGEIACR+I +CK+ GIK VA+HSDVDA S  V+MADEA+C+GPA TS SYLNM+ I++A+K+T A+AVHPGYGFLSEN  FA+ L   +VVF+GP++ AI +MGDKIESK +A  A+V+ IPG+DG + D +EA++IA +IGYPVMIKASAGGGGKGMRIAW+D+E  +G++LS  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPS F++ ETR+AMGEQAV +A+AV Y SAGTVEFLVD K+NFYFLEMNTRLQVEHP++E ITG+D+V +M RV KG+PL  KQ+DI +NGWAVECRVYAEDPYKSFGLPS+GRL+ Y+EPLHLP VR DSGIQ GS+ISIYYDPMI KL+TYG DR++AL  M  ALD+YVIRGVTHNI LLR+++   RFV G+I+T +L +VYPDGFKG  LT  E   L A+++ +FV  ++R + F +  R  +I       + D+++   W LS+    +  DK   V  S   + S F+V  + G+   + + ++LA  +++ ++D  +  +Q +SR   G ++ Q++GT YK+ + + +  +L+KFML K   DTSSV+ +PMPG+V  VSVK G  V++GQE+CV+EAMKMQNSM A K G +K+VH Q G TV +GD+++ELE
Sbjct:   56 YDPNEKTFDKILVANRGEIACRVIRTCKKMGIKTVAIHSDVDASSVHVKMADEAVCVGPAPTSKSYLNMDAIMEAIKKTRAQAVHPGYGFLSENKEFARCLAAEDVVFIGPDTHAIQAMGDKIESKLLAKKAEVNTIPGFDGVVKDAEEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRLSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVVEEAPSIFLDAETRRAMGEQAVALARAVKYSSAGTVEFLVDSKKNFYFLEMNTRLQVEHPVTECITGLDLVQEMIRVAKGYPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPLHLPGVRVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNYVIRGVTHNIALLREVIINSRFVKGDISTKFLSDVYPDGFKGHMLTKSEKNQLLAIASSLFVAFQLRAQHFQENSRMPVI-------KPDIAN---WELSV----KLHDKVHTVVAS--NNGSVFSVEVD-GSKLNVTSTWNLASPLLSVSVDGTQRTVQCLSREAGGNMSIQFLGTVYKVNILTRLAAELNKFMLEKVTEDTSSVLRSPMPGVVVAVSVKPGDAVAEGQEICVIEAMKMQNSMTAGKTGTVKSVHCQAGDTVGEGDLLVELE 728          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Human
Match: PCCA (propionyl-CoA carboxylase subunit alpha [Source:HGNC Symbol;Acc:HGNC:8653])

HSP 1 Score: 833.943 bits (2153), Expect = 0.000e+0
Identity = 404/683 (59.15%), Postives = 528/683 (77.31%), Query Frame = 1
Query:  187 FKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            F KIL+ANRGEIACR+I +CK+ GIK VA+HSDVDA S  V+MADEA+C+GPA TS SYLNM+ I++A+K+T A+AVHPGYGFLSEN  FA+ L   +VVF+GP++ AI +MGDKIESK +A  A+V+ IPG+DG + D +EA++IA +IGYPVMIKASAGGGGKGMRIAW+D+E  +G++LS  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPS F++ ETR+AMGEQAV +A+AV Y SAGTVEFLVD K+NFYFLEMNTRLQVEHP++E ITG+D+V +M RV KG+PL  KQ+DI +NGWAVECRVYAEDPYKSFGLPS+GRL+ Y+EPLHLP VR DSGIQ GS+ISIYYDPMI KL+TYG DR++AL  M  ALD+YVIRGVTHNI LLR+++   RFV G+I+T +L +VYPDGFKG  LT  E   L A+++ +FV  ++R + F +  R  +I       + D+++   W LS+    +  DK   V  S   + S F+V  + G+   + + ++LA  +++ ++D  +  +Q +SR   G ++ Q++GT YK+ + + +  +L+KFML K   DTSSV+ +PMPG+V  VSVK G  V++GQE+CV+EAMKMQNSM A K G +K+VH Q G TV +GD+++ELE
Sbjct:   37 FDKILVANRGEIACRVIRTCKKMGIKTVAIHSDVDASSVHVKMADEAVCVGPAPTSKSYLNMDAIMEAIKKTRAQAVHPGYGFLSENKEFARCLAAEDVVFIGPDTHAIQAMGDKIESKLLAKKAEVNTIPGFDGVVKDAEEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRLSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVVEEAPSIFLDAETRRAMGEQAVALARAVKYSSAGTVEFLVDSKKNFYFLEMNTRLQVEHPVTECITGLDLVQEMIRVAKGYPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPLHLPGVRVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNYVIRGVTHNIALLREVIINSRFVKGDISTKFLSDVYPDGFKGHMLTKSEKNQLLAIASSLFVAFQLRAQHFQENSRMPVI-------KPDIAN---WELSV----KLHDKVHTVVAS--NNGSVFSVEVD-GSKLNVTSTWNLASPLLSVSVDGTQRTVQCLSREAGGNMSIQFLGTVYKVNILTRLAAELNKFMLEKVTEDTSSVLRSPMPGVVVAVSVKPGDAVAEGQEICVIEAMKMQNSMTAGKTGTVKSVHCQAGDTVGEGDLLVELE 702          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Human
Match: PCCA (propionyl-CoA carboxylase subunit alpha [Source:HGNC Symbol;Acc:HGNC:8653])

HSP 1 Score: 776.163 bits (2003), Expect = 0.000e+0
Identity = 384/690 (55.65%), Postives = 500/690 (72.46%), Query Frame = 1
Query:  166 HDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            +DP E  F KIL+ANRGEIACR+I +CK+ GIK VA+HSDVDA S  V+MADEA+C+GPA TS SYLNM+ I++A+K+T A+AVHPGYGFLSEN  FA+ L   +VVF+GP++ AI +MGDKIESK +A  A+V+ IPG+DG + D +EA++IA +IGYPVMIKASAGGGGKGMRIAW+D+E  +G++LS  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPS F++ ETR+AMGEQAV +A+AV Y SAGTVEFLVD K+NFYFLEMNTRLQVEHP++E ITG+D+V +M RV KG+PL  KQ+DI +NGWAVECRVYAEDPYKSFGLPS+GRL+ Y+EPLHLP VR DSGIQ GS+ISIYYDPMI KL+TYG DR++AL  M  ALD+YVIRGVTHNI LLR+++   RFV G+I+T +L +VYPDGFKG  LT  E   L A+++ +FV  ++R + F +  R  +I       + D+++   W LS+    +  DK   V  S   + S F+V  + G+   + + ++LA  +++ ++D  +  +Q +SR   G ++ Q++GT                                                V++GQE+CV+EAMKMQNSM A K G +K+VH Q G TV +GD+++ELE
Sbjct:   56 YDPNEKTFDKILVANRGEIACRVIRTCKKMGIKTVAIHSDVDASSVHVKMADEAVCVGPAPTSKSYLNMDAIMEAIKKTRAQAVHPGYGFLSENKEFARCLAAEDVVFIGPDTHAIQAMGDKIESKLLAKKAEVNTIPGFDGVVKDAEEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRLSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVVEEAPSIFLDAETRRAMGEQAVALARAVKYSSAGTVEFLVDSKKNFYFLEMNTRLQVEHPVTECITGLDLVQEMIRVAKGYPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPLHLPGVRVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNYVIRGVTHNIALLREVIINSRFVKGDISTKFLSDVYPDGFKGHMLTKSEKNQLLAIASSLFVAFQLRAQHFQENSRMPVI-------KPDIAN---WELSV----KLHDKVHTVVAS--NNGSVFSVEVD-GSKLNVTSTWNLASPLLSVSVDGTQRTVQCLSREAGGNMSIQFLGTV-----------------------------------------------VAEGQEICVIEAMKMQNSMTAGKTGTVKSVHCQAGDTVGEGDLLVELE 681          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Human
Match: PCCA (propionyl-CoA carboxylase subunit alpha [Source:HGNC Symbol;Acc:HGNC:8653])

HSP 1 Score: 561.222 bits (1445), Expect = 0.000e+0
Identity = 262/372 (70.43%), Postives = 321/372 (86.29%), Query Frame = 1
Query:  166 HDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLP 1281
            +DP E  F KIL+ANRGEIACR+I +CK+ GIK VA+HSDVDA S  V+MADEA+C+GPA TS SYLNM+ I++A+K+T A+AVHPGYGFLSEN  FA+ L   +VVF+GP++ AI +MGDKIESK +A  A+V+ IPG+DG + D +EA++IA +IGYPVMIKASAGGGGKGMRIAW+D+E  +G++LS  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPS F++ ETR+AMGEQAV +A+AV Y SAGTVEFLVD K+NFYFLEMNTRLQVEHP++E ITG+D+V +M RV KG+PL  KQ+DI +NGWAVECRVYAEDPYKSFGLPS+GRL+ Y+EPLHLP
Sbjct:   16 YDPNEKTFDKILVANRGEIACRVIRTCKKMGIKTVAIHSDVDASSVHVKMADEAVCVGPAPTSKSYLNMDAIMEAIKKTRAQAVHPGYGFLSENKEFARCLAAEDVVFIGPDTHAIQAMGDKIESKLLAKKAEVNTIPGFDGVVKDAEEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRLSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVVEEAPSIFLDAETRRAMGEQAVALARAVKYSSAGTVEFLVDSKKNFYFLEMNTRLQVEHPVTECITGLDLVQEMIRVAKGYPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPLHLP 387          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Human
Match: MCCC1 (methylcrotonoyl-CoA carboxylase 1 [Source:HGNC Symbol;Acc:HGNC:6936])

HSP 1 Score: 483.797 bits (1244), Expect = 2.984e-159
Identity = 279/697 (40.03%), Postives = 403/697 (57.82%), Query Frame = 1
Query:  193 KILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKI-ANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKV---ESIIGHKLSK-------FMLPKKVVDTSSV-----IIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            K+LIANRGEIACR++ + K+ G++ VAV+S+ D  S  V MADEA  IGPA +  SYL+MEKI+   K + A+A+HPG GFLSEN  FA+  +   ++F+GP   AI  MG K  SK I  AA V  + GY GE + +D+ +K  A +IGYPVMIKA  GGGGKGMRI  +++E  E  + +R EAK SF DD MLIEK+++ PRH+E+Q+  D HGNA+YL ER+CS+QRR+QK+IEEAP+  I  E RK +GE AV+ AKAV Y  AGTVEF++D K NF F+EMNTRLQVEHP++E+ITG D+V    R+  G  + L Q +I++ G A E R+YAEDP  +F +P  G L     P   P+ R ++G+++G E+S++YDPMI KLV +  DR  AL  +  +L  Y I G+  NI  L ++   P F +GN+ T+++P+ +      ++   KE+    A+   + +K +    TF  +         S S R         ++S +  +  +D   NV ++V       T N +   S +I       DK         +++  L S     Y+     G   K K+   E+ I +  SK         +PK +   SS       +APM G ++ V VK G +V  G  L V+ AMKM++++ + K G +K V ++ G   +    ++E E
Sbjct:   51 KVLIANRGEIACRVMRTAKKLGVQTVAVYSEADRNSMHVDMADEAYSIGPAPSQQSYLSMEKIIQVAKTSAAQAIHPGCGFLSENMEFAELCKQEGIIFIGPPPSAIRDMGIKSTSKSIMAAAGVPVVEGYHGE-DQSDQCLKEHARRIGYPVMIKAVRGGGGKGMRIVRSEQEFQEQLESARREAKKSFNDDAMLIEKFVDTPRHVEVQVFGDHHGNAVYLFERDCSVQRRHQKIIEEAPAPGIKSEVRKKLGEAAVRAAKAVNYVGAGTVEFIMDSKHNFCFMEMNTRLQVEHPVTEMITGTDLVEWQLRIAAGEKIPLSQEEITLQGHAFEARIYAEDPSNNF-MPVAGPLVHLSTPRADPSTRIETGVRQGDEVSVHYDPMIAKLVVWAADRQAALTKLRYSLRQYNIVGLHTNIDFLLNLSGHPEFEAGNVHTDFIPQHHKQLLLSRKAAAKESLCQAALG--LILKEKAMTDTFTLQAHDQFSPFSSSSGR-------RLNISYTRNMTLKDGKNNVAIAV-------TYNHDGSYSMQIE------DKTF-------QVLGNLYSEGDCTYLKCSVNGVASKAKLIILENTI-YLFSKEGSIEIDIPVPKYLSSVSSQETQGGPLAPMTGTIEKVFVKAGDKVKAGDSLMVMIAMKMEHTIKSPKDGTVKKVFYREGAQANRHTPLVEFE 715          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Celegans
Match: pcca-1 (Propionyl-CoA carboxylase alpha chain, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q19842])

HSP 1 Score: 820.076 bits (2117), Expect = 0.000e+0
Identity = 412/702 (58.69%), Postives = 520/702 (74.07%), Query Frame = 1
Query:  139 ARNIYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFL--KKDRSLLIAEKSESFRGDLSHP-EEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
             + IY     D  E KF KILIANRGEIACR+I + +  GIK VAVHSDVD+ S  V+MADEA+C+G A T+ SYL  ++IL AV+ TGA+AVHPGYGFLSENT FA +LE     F+GPNSKAI  MGDKI SK+IA AA+V  IPGYDGEI D D  +K++  IGYPVMIKASAGGGGKGMR+AWNDK+A EGY+LS+ EA SSFGDDRML+EK+I+ PRHIE+Q++CDKHGNAL+LNERECSIQRRNQKVIEEAPS+F+ PE R+ MGEQAVQ+AKAVGYDSAGTVEFLVD +RNFYFLEMNTRLQVEHPI+E ITG+DIV QM RV  GHPL + Q  + +NGWA E RVYAEDPYK FGLPSVGRL+ Y EP H+  VRCDSGI+EGSEISIYYDP+ICKLVT+G++R +AL  M +ALD+YVIRGVTHNIPLLRDIV E RF +G+ITT YLPEVYP+GF+G  L+PKE  ++ A ++ +  +   R   FL   K RS  +A  S++++   S P +E      H +E +       V    +++   +    G +  I+ + +L+  + +  +D + I  Q++ +  +G IT  Y GT +K+KV      K  ++M  K  VD S+V+++PMPG +K V+VK G  VS+GQEL V+EAMKMQNS+ A K G +KAV+ + G TV +G++++ELE
Sbjct:   33 GKEIYTTVGIDYNEPKFDKILIANRGEIACRVIKTARAMGIKTVAVHSDVDSNSLHVKMADEAVCVGEAPTAKSYLRADRILQAVEDTGAQAVHPGYGFLSENTKFAAELEKAGAKFIGPNSKAILDMGDKIHSKKIATAARVSMIPGYDGEIADEDMCVKVSRDIGYPVMIKASAGGGGKGMRVAWNDKQAREGYRLSKQEAASSFGDDRMLVEKFIDNPRHIEMQVLCDKHGNALWLNERECSIQRRNQKVIEEAPSSFVPPEMRRKMGEQAVQLAKAVGYDSAGTVEFLVDSQRNFYFLEMNTRLQVEHPITECITGIDIVQQMLRVSYGHPLPITQEQVPLNGWAFESRVYAEDPYKGFGLPSVGRLSRYVEPKHVDGVRCDSGIREGSEISIYYDPLICKLVTHGDNREQALNRMQEALDNYVIRGVTHNIPLLRDIVQEKRFRTGDITTKYLPEVYPEGFQGTSLSPKEQDVVIAFASALNARKLARANQFLNQNKQRSTHVASFSKTYKFVSSLPVKEGERPTEHAVEVE------FVEGSANKAQVRIG---GKTVTISGDLNLSHPVNSIEVDGEHITTQIVGKR-AGEITVLYKGTPFKVKVLPEQAVKYLQYMKEKAKVDLSTVVLSPMPGAIKNVNVKPGDMVSEGQELVVMEAMKMQNSLHAGKTGRVKAVNVKVGATVDEGEVLVELE 724          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Celegans
Match: pcca-1 (Propionyl-CoA carboxylase alpha chain, mitochondrial [Source:UniProtKB/Swiss-Prot;Acc:Q19842])

HSP 1 Score: 820.076 bits (2117), Expect = 0.000e+0
Identity = 412/702 (58.69%), Postives = 520/702 (74.07%), Query Frame = 1
Query:  139 ARNIYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFL--KKDRSLLIAEKSESFRGDLSHP-EEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
             + IY     D  E KF KILIANRGEIACR+I + +  GIK VAVHSDVD+ S  V+MADEA+C+G A T+ SYL  ++IL AV+ TGA+AVHPGYGFLSENT FA +LE     F+GPNSKAI  MGDKI SK+IA AA+V  IPGYDGEI D D  +K++  IGYPVMIKASAGGGGKGMR+AWNDK+A EGY+LS+ EA SSFGDDRML+EK+I+ PRHIE+Q++CDKHGNAL+LNERECSIQRRNQKVIEEAPS+F+ PE R+ MGEQAVQ+AKAVGYDSAGTVEFLVD +RNFYFLEMNTRLQVEHPI+E ITG+DIV QM RV  GHPL + Q  + +NGWA E RVYAEDPYK FGLPSVGRL+ Y EP H+  VRCDSGI+EGSEISIYYDP+ICKLVT+G++R +AL  M +ALD+YVIRGVTHNIPLLRDIV E RF +G+ITT YLPEVYP+GF+G  L+PKE  ++ A ++ +  +   R   FL   K RS  +A  S++++   S P +E      H +E +       V    +++   +    G +  I+ + +L+  + +  +D + I  Q++ +  +G IT  Y GT +K+KV      K  ++M  K  VD S+V+++PMPG +K V+VK G  VS+GQEL V+EAMKMQNS+ A K G +KAV+ + G TV +G++++ELE
Sbjct:   33 GKEIYTTVGIDYNEPKFDKILIANRGEIACRVIKTARAMGIKTVAVHSDVDSNSLHVKMADEAVCVGEAPTAKSYLRADRILQAVEDTGAQAVHPGYGFLSENTKFAAELEKAGAKFIGPNSKAILDMGDKIHSKKIATAARVSMIPGYDGEIADEDMCVKVSRDIGYPVMIKASAGGGGKGMRVAWNDKQAREGYRLSKQEAASSFGDDRMLVEKFIDNPRHIEMQVLCDKHGNALWLNERECSIQRRNQKVIEEAPSSFVPPEMRRKMGEQAVQLAKAVGYDSAGTVEFLVDSQRNFYFLEMNTRLQVEHPITECITGIDIVQQMLRVSYGHPLPITQEQVPLNGWAFESRVYAEDPYKGFGLPSVGRLSRYVEPKHVDGVRCDSGIREGSEISIYYDPLICKLVTHGDNREQALNRMQEALDNYVIRGVTHNIPLLRDIVQEKRFRTGDITTKYLPEVYPEGFQGTSLSPKEQDVVIAFASALNARKLARANQFLNQNKQRSTHVASFSKTYKFVSSLPVKEGERPTEHAVEVE------FVEGSANKAQVRIG---GKTVTISGDLNLSHPVNSIEVDGEHITTQIVGKR-AGEITVLYKGTPFKVKVLPEQAVKYLQYMKEKAKVDLSTVVLSPMPGAIKNVNVKPGDMVSEGQELVVMEAMKMQNSLHAGKTGRVKAVNVKVGATVDEGEVLVELE 724          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Celegans
Match: mccc-1 (MethylCrotonoyl-Coenzyme A Carboxylase (Alpha) [Source:UniProtKB/TrEMBL;Acc:O45430])

HSP 1 Score: 477.248 bits (1227), Expect = 9.253e-158
Identity = 276/690 (40.00%), Postives = 412/690 (59.71%), Query Frame = 1
Query:  190 KKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDR-SHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPK--KVVDT------SSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIEL 2232
            +++L+ANRGEIA R+ N+ ++ GI+ VAV SD D  S FV+ AD+A  IGP   + SYLNM+KI+++  ++GA+A+HPGYGFLSEN  FA+K     +VF+GP ++AI  MG K  SK+I   AKV  + G+ GE        K + +IGYPVM+KA  GGGGKGMRIAWN+ E  E    +R EAK SFG+D ML+EK++ KPRH+E+Q+  D HGN ++L ER+CS+QRR+QK+IEEAP+  +  +TR  +GE AV+ A AVGY  AGTVEF++D +  FYF+EMNTRLQVEHP+SE ITG D+V    RV +G  L LKQS+I +NG A ECRVYAED  K   +P+ GRL     P    + R D+G+  G E+SI+YDPMI K+V +G+DR+ A A +  AL    I G+  NI  +R ++  P F +GN+ T+++P+   + F   + TP E          ++V++ + +     +     + +    FR +LS    +            K     VS+ FD  S  TV+++ GNS+       L + I +    + +  L+   R +S  +  + +G    +      G   +++  P+  +  D+      S   +APMPG+++ + VK G++V+ GQ L V+ AMKM+  + A +   ++ +  Q G+ V    ++++ 
Sbjct:   20 QRVLVANRGEIAIRVQNTARKMGIETVAVFSDADRNSLFVKKADKAYHIGPPLAAESYLNMDKIINSALRSGAQAIHPGYGFLSENAGFAEKCAQAGLVFIGPPAQAIRDMGAKNVSKQIMEDAKVPVVKGFHGEDQSDANLKKKSAEIGYPVMLKAVYGGGGKGMRIAWNEAEFEEKLASARNEAKKSFGNDEMLVEKFVEKPRHVEVQVFGDHHGNYVHLWERDCSVQRRHQKIIEEAPAPNMEHDTRVKLGESAVRAAAAVGYVGAGTVEFIMDPRGEFYFMEMNTRLQVEHPVSEAITGTDLVEWQLRVAQGEKLPLKQSEIPLNGHAFECRVYAEDTRKGAFMPTAGRLNYVDFP---EDARIDTGVVSGDEVSIHYDPMIAKVVVWGQDRAVAAAKLESALARTRISGLPTNIDFVRRVLAHPEFAAGNVYTDFIPDHQKELFAESE-TPAE----------IYVESAVAHALAALQKSDAGVFQNLSFFRMNLSPKYIF------------KIDGKDVSIRFDSDSRLTVSYD-GNSYET-----LLNDIESTTDGSFKFTLEANGRRWSTVV--KNLGNSLMVN-----GVGQNEYETPQIHETFDSLSGGAASHSAVAPMPGIIEKILVKPGEQVTTGQALVVMTAMKMEYIIRAPEDSTVEHIKCQAGKNVPKNAVLVQF 670          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Celegans
Match: mccc-1 (MethylCrotonoyl-Coenzyme A Carboxylase (Alpha) [Source:UniProtKB/TrEMBL;Acc:O45430])

HSP 1 Score: 477.248 bits (1227), Expect = 9.253e-158
Identity = 276/690 (40.00%), Postives = 412/690 (59.71%), Query Frame = 1
Query:  190 KKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDR-SHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPK--KVVDT------SSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIEL 2232
            +++L+ANRGEIA R+ N+ ++ GI+ VAV SD D  S FV+ AD+A  IGP   + SYLNM+KI+++  ++GA+A+HPGYGFLSEN  FA+K     +VF+GP ++AI  MG K  SK+I   AKV  + G+ GE        K + +IGYPVM+KA  GGGGKGMRIAWN+ E  E    +R EAK SFG+D ML+EK++ KPRH+E+Q+  D HGN ++L ER+CS+QRR+QK+IEEAP+  +  +TR  +GE AV+ A AVGY  AGTVEF++D +  FYF+EMNTRLQVEHP+SE ITG D+V    RV +G  L LKQS+I +NG A ECRVYAED  K   +P+ GRL     P    + R D+G+  G E+SI+YDPMI K+V +G+DR+ A A +  AL    I G+  NI  +R ++  P F +GN+ T+++P+   + F   + TP E          ++V++ + +     +     + +    FR +LS    +            K     VS+ FD  S  TV+++ GNS+       L + I +    + +  L+   R +S  +  + +G    +      G   +++  P+  +  D+      S   +APMPG+++ + VK G++V+ GQ L V+ AMKM+  + A +   ++ +  Q G+ V    ++++ 
Sbjct:   20 QRVLVANRGEIAIRVQNTARKMGIETVAVFSDADRNSLFVKKADKAYHIGPPLAAESYLNMDKIINSALRSGAQAIHPGYGFLSENAGFAEKCAQAGLVFIGPPAQAIRDMGAKNVSKQIMEDAKVPVVKGFHGEDQSDANLKKKSAEIGYPVMLKAVYGGGGKGMRIAWNEAEFEEKLASARNEAKKSFGNDEMLVEKFVEKPRHVEVQVFGDHHGNYVHLWERDCSVQRRHQKIIEEAPAPNMEHDTRVKLGESAVRAAAAVGYVGAGTVEFIMDPRGEFYFMEMNTRLQVEHPVSEAITGTDLVEWQLRVAQGEKLPLKQSEIPLNGHAFECRVYAEDTRKGAFMPTAGRLNYVDFP---EDARIDTGVVSGDEVSIHYDPMIAKVVVWGQDRAVAAAKLESALARTRISGLPTNIDFVRRVLAHPEFAAGNVYTDFIPDHQKELFAESE-TPAE----------IYVESAVAHALAALQKSDAGVFQNLSFFRMNLSPKYIF------------KIDGKDVSIRFDSDSRLTVSYD-GNSYET-----LLNDIESTTDGSFKFTLEANGRRWSTVV--KNLGNSLMVN-----GVGQNEYETPQIHETFDSLSGGAASHSAVAPMPGIIEKILVKPGEQVTTGQALVVMTAMKMEYIIRAPEDSTVEHIKCQAGKNVPKNAVLVQF 670          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Celegans
Match: pyc-1 (Pyruvate carboxylase 1 [Source:UniProtKB/Swiss-Prot;Acc:O17732])

HSP 1 Score: 346.28 bits (887), Expect = 3.191e-103
Identity = 188/486 (38.68%), Postives = 298/486 (61.32%), Query Frame = 1
Query:  151 YWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLS-YLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHP---LLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQ-EGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAV 1593
            Y N    P+E  F K+++ANRGEIA R+  +       +VA++++ D  S     ADEA  +G     ++ YL +++I++   +   +A+HPGYGFLSE + FA   ++  +VF+GP+   +  MGDK+ +++ A  A V  +PG  G I   DEA++ A Q G P+++KA+ GGGG+G+R     +E  E ++ S +EA+++FGD  + +EK++ +PRHIE+Q++ D HGN ++L ER+CS+QRR+QKV+E AP+  +    R+ +   A+++A+ VGY +AGTVEFLVD K N+YF+E+N RLQVEH ++E ITGVD+V    R+ +G     L L Q  I   G A++CRV  EDP K F  P  GR+  ++    +  +R DS     GS IS +YD ++ K++    +   A A M++AL  + IRGV  NIP L +++ +P F+  ++ T ++ E +P+ F+ K    +   LL  +  V
Sbjct:   22 YANGVIKPRE--FNKVMVANRGEIAIRVFRALTELNKTSVAIYAEQDKNSMHRLKADEAYLVGKGLPPVAAYLTIDQIIETALKHNIDAIHPGYGFLSERSDFAAACQNAGIVFIGPSPDVMARMGDKVAARQAAIEAGVQVVPGTPGPITTADEAVEFAKQYGTPIILKAAYGGGGRGIRRVDKLEEVEEAFRRSYSEAQAAFGDGSLFVEKFVERPRHIEVQLLGDHHGNIVHLYERDCSVQRRHQKVVEIAPAPALPEGVREKILADALRLARHVGYQNAGTVEFLVDQKGNYYFIEVNARLQVEHTVTEEITGVDLVQAQIRIAEGKSLDDLKLSQETIQTTGSAIQCRVTTEDPAKGFQ-PDSGRIEVFRSGEGM-GIRLDSASAFAGSVISPHYDSLMVKVIASARNHPNAAAKMIRALKKFRIRGVKTNIPFLLNVLRQPSFLDASVDTYFIDE-HPELFQFKPSQNRAQKLLNYLGEV 502          

HSP 2 Score: 57.3806 bits (137), Expect = 4.974e-8
Identity = 30/77 (38.96%), Postives = 45/77 (58.44%), Query Frame = 1
Query: 2005 PKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            P+ +      I APMPG V  + +K G +V+  Q L VL AMKM+  + +  AG +KA+H   G   S GD+++E+E
Sbjct: 1098 PRALPGVRGHIGAPMPGDVLELKIKEGDKVTKKQPLFVLSAMKMEMVIDSPIAGTVKAIHAPQGTKCSAGDLVVEVE 1174          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Fly
Match: Mccc1 (gene:FBgn0039877 transcript:FBtr0307551)

HSP 1 Score: 491.886 bits (1265), Expect = 4.799e-163
Identity = 281/702 (40.03%), Postives = 415/702 (59.12%), Query Frame = 1
Query:  172 PKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAI-KIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVD-DKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEI----RNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVN-----------FESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIII 2226
            PK     KILI+NRGEIACR+I + ++ G++ VAV SD D  S   Q+ADE+  +G A +S SYL  E+ILD  K++GA+A+HPGYGFLSE+  FA+  +   ++F+GP S AI  MG K  SK I  AA V  I GY G+ + +DE + + A++IG+P+MIKA  GGGGKGMRIA    + +     +R E++ SFGD  +L+E+Y+  PRH+E+Q+  D++G+A+YL ER+CS+QRR+QK+IEEAP+  ++ + R+ +GE AV+ AKAVGY  AGTVEF++D +  +F+F+EMNTRLQVEHPI+E+ITG D+V    R+  G PL LKQS+I+  G A E R+YAE+P   F LP  G L     P    NVR ++G++EG E+S++YDPMI KLV +GE+R++AL ++V  L  Y I G+  NI  L D+ + P F   N+ T ++ E +   F    ++P++     + +A+  V NE+    RN     KD+   +A  +            + L   + L++ +K  +V V  D +     V+            + G+  +I  N +    + T N   D   + L S   SG + F+    K+     S  G +L             S I+APMPG+++ V VK G +V  G+ L VL AMKM++ + A K   IK++    G  V+ G  +I
Sbjct:   22 PKVRPISKILISNRGEIACRVIRTARKLGVRTVAVFSDPDEKSMHTQLADESYRVGEAASSASYLRGERILDIAKRSGAQAIHPGYGFLSESVEFAELCQREGIIFMGPPSSAIRDMGIKSTSKAIMAAAGVPIINGYHGD-DQSDECLQREADKIGFPLMIKAVRGGGGKGMRIAEKPDDFLTALNSARTESEKSFGDSSVLLERYVRSPRHVEVQVFADQYGDAVYLWERDCSVQRRHQKIIEEAPAPGLSEDLRRELGEAAVRAAKAVGYVGAGTVEFILDKEDLSFHFMEMNTRLQVEHPITEMITGTDLVEWQIRIAAGEPLPLKQSEITRRGHAFEARIYAENPRGGF-LPGAGPLRYLSTPQPSNNVRVETGVREGDEVSVHYDPMIAKLVVWGENRTQALNSLVARLGEYHISGLDTNINFLIDLASHPEFQLANVHTGFIDEQFDTLFPPIIISPQQV----SQAALALVLNELQAAFRNGN---KDQDPFVATPNARL--------NYSLVRRYDLKANEKVYSVAVKFDGEDMQIQVDNGDWQDAKVERVQDGSRLKIRANIN--SNVTTYNASIDGTSVSLFSE--SGKVDFEVGQPKFL----SAQGDQLGA---------VGSRIVAPMPGILEKVLVKPGDKVKKGENLAVLIAMKMEHILKAPKDATIKSIGGAAGDNVAKGAAVI 689          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Fly
Match: Mccc1 (gene:FBgn0039877 transcript:FBtr0085856)

HSP 1 Score: 491.886 bits (1265), Expect = 4.799e-163
Identity = 281/702 (40.03%), Postives = 415/702 (59.12%), Query Frame = 1
Query:  172 PKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAI-KIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVD-DKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEI----RNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVN-----------FESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIII 2226
            PK     KILI+NRGEIACR+I + ++ G++ VAV SD D  S   Q+ADE+  +G A +S SYL  E+ILD  K++GA+A+HPGYGFLSE+  FA+  +   ++F+GP S AI  MG K  SK I  AA V  I GY G+ + +DE + + A++IG+P+MIKA  GGGGKGMRIA    + +     +R E++ SFGD  +L+E+Y+  PRH+E+Q+  D++G+A+YL ER+CS+QRR+QK+IEEAP+  ++ + R+ +GE AV+ AKAVGY  AGTVEF++D +  +F+F+EMNTRLQVEHPI+E+ITG D+V    R+  G PL LKQS+I+  G A E R+YAE+P   F LP  G L     P    NVR ++G++EG E+S++YDPMI KLV +GE+R++AL ++V  L  Y I G+  NI  L D+ + P F   N+ T ++ E +   F    ++P++     + +A+  V NE+    RN     KD+   +A  +            + L   + L++ +K  +V V  D +     V+            + G+  +I  N +    + T N   D   + L S   SG + F+    K+     S  G +L             S I+APMPG+++ V VK G +V  G+ L VL AMKM++ + A K   IK++    G  V+ G  +I
Sbjct:   22 PKVRPISKILISNRGEIACRVIRTARKLGVRTVAVFSDPDEKSMHTQLADESYRVGEAASSASYLRGERILDIAKRSGAQAIHPGYGFLSESVEFAELCQREGIIFMGPPSSAIRDMGIKSTSKAIMAAAGVPIINGYHGD-DQSDECLQREADKIGFPLMIKAVRGGGGKGMRIAEKPDDFLTALNSARTESEKSFGDSSVLLERYVRSPRHVEVQVFADQYGDAVYLWERDCSVQRRHQKIIEEAPAPGLSEDLRRELGEAAVRAAKAVGYVGAGTVEFILDKEDLSFHFMEMNTRLQVEHPITEMITGTDLVEWQIRIAAGEPLPLKQSEITRRGHAFEARIYAENPRGGF-LPGAGPLRYLSTPQPSNNVRVETGVREGDEVSVHYDPMIAKLVVWGENRTQALNSLVARLGEYHISGLDTNINFLIDLASHPEFQLANVHTGFIDEQFDTLFPPIIISPQQV----SQAALALVLNELQAAFRNGN---KDQDPFVATPNARL--------NYSLVRRYDLKANEKVYSVAVKFDGEDMQIQVDNGDWQDAKVERVQDGSRLKIRANIN--SNVTTYNASIDGTSVSLFSE--SGKVDFEVGQPKFL----SAQGDQLGA---------VGSRIVAPMPGILEKVLVKPGDKVKKGENLAVLIAMKMEHILKAPKDATIKSIGGAAGDNVAKGAAVI 689          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Fly
Match: Mccc1 (gene:FBgn0039877 transcript:FBtr0307552)

HSP 1 Score: 445.662 bits (1145), Expect = 6.209e-146
Identity = 258/657 (39.27%), Postives = 385/657 (58.60%), Query Frame = 1
Query:  307 VQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAI-KIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVD-DKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEI----RNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVN-----------FESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIII 2226
             Q+ADE+  +G A +S SYL  E+ILD  K++GA+A+HPGYGFLSE+  FA+  +   ++F+GP S AI  MG K  SK I  AA V  I GY G+ + +DE + + A++IG+P+MIKA  GGGGKGMRIA    + +     +R E++ SFGD  +L+E+Y+  PRH+E+Q+  D++G+A+YL ER+CS+QRR+QK+IEEAP+  ++ + R+ +GE AV+ AKAVGY  AGTVEF++D +  +F+F+EMNTRLQVEHPI+E+ITG D+V    R+  G PL LKQS+I+  G A E R+YAE+P   F LP  G L     P    NVR ++G++EG E+S++YDPMI KLV +GE+R++AL ++V  L  Y I G+  NI  L D+ + P F   N+ T ++ E +   F    ++P++     + +A+  V NE+    RN     KD+   +A  +            + L   + L++ +K  +V V  D +     V+            + G+  +I  N +    + T N   D   + L S   SG + F+    K+     S  G +L             S I+APMPG+++ V VK G +V  G+ L VL AMKM++ + A K   IK++    G  V+ G  +I
Sbjct:    3 TQLADESYRVGEAASSASYLRGERILDIAKRSGAQAIHPGYGFLSESVEFAELCQREGIIFMGPPSSAIRDMGIKSTSKAIMAAAGVPIINGYHGD-DQSDECLQREADKIGFPLMIKAVRGGGGKGMRIAEKPDDFLTALNSARTESEKSFGDSSVLLERYVRSPRHVEVQVFADQYGDAVYLWERDCSVQRRHQKIIEEAPAPGLSEDLRRELGEAAVRAAKAVGYVGAGTVEFILDKEDLSFHFMEMNTRLQVEHPITEMITGTDLVEWQIRIAAGEPLPLKQSEITRRGHAFEARIYAENPRGGF-LPGAGPLRYLSTPQPSNNVRVETGVREGDEVSVHYDPMIAKLVVWGENRTQALNSLVARLGEYHISGLDTNINFLIDLASHPEFQLANVHTGFIDEQFDTLFPPIIISPQQV----SQAALALVLNELQAAFRNGN---KDQDPFVATPNARLN--------YSLVRRYDLKANEKVYSVAVKFDGEDMQIQVDNGDWQDAKVERVQDGSRLKIRANIN--SNVTTYNASIDGTSVSLFSE--SGKVDFEVGQPKFL----SAQGDQLGA---------VGSRIVAPMPGILEKVLVKPGDKVKKGENLAVLIAMKMEHILKAPKDATIKSIGGAAGDNVAKGAAVI 625          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Fly
Match: Mccc1 (gene:FBgn0039877 transcript:FBtr0085855)

HSP 1 Score: 445.662 bits (1145), Expect = 6.209e-146
Identity = 258/657 (39.27%), Postives = 385/657 (58.60%), Query Frame = 1
Query:  307 VQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAI-KIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVD-DKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEI----RNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVN-----------FESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIII 2226
             Q+ADE+  +G A +S SYL  E+ILD  K++GA+A+HPGYGFLSE+  FA+  +   ++F+GP S AI  MG K  SK I  AA V  I GY G+ + +DE + + A++IG+P+MIKA  GGGGKGMRIA    + +     +R E++ SFGD  +L+E+Y+  PRH+E+Q+  D++G+A+YL ER+CS+QRR+QK+IEEAP+  ++ + R+ +GE AV+ AKAVGY  AGTVEF++D +  +F+F+EMNTRLQVEHPI+E+ITG D+V    R+  G PL LKQS+I+  G A E R+YAE+P   F LP  G L     P    NVR ++G++EG E+S++YDPMI KLV +GE+R++AL ++V  L  Y I G+  NI  L D+ + P F   N+ T ++ E +   F    ++P++     + +A+  V NE+    RN     KD+   +A  +            + L   + L++ +K  +V V  D +     V+            + G+  +I  N +    + T N   D   + L S   SG + F+    K+     S  G +L             S I+APMPG+++ V VK G +V  G+ L VL AMKM++ + A K   IK++    G  V+ G  +I
Sbjct:    3 TQLADESYRVGEAASSASYLRGERILDIAKRSGAQAIHPGYGFLSESVEFAELCQREGIIFMGPPSSAIRDMGIKSTSKAIMAAAGVPIINGYHGD-DQSDECLQREADKIGFPLMIKAVRGGGGKGMRIAEKPDDFLTALNSARTESEKSFGDSSVLLERYVRSPRHVEVQVFADQYGDAVYLWERDCSVQRRHQKIIEEAPAPGLSEDLRRELGEAAVRAAKAVGYVGAGTVEFILDKEDLSFHFMEMNTRLQVEHPITEMITGTDLVEWQIRIAAGEPLPLKQSEITRRGHAFEARIYAENPRGGF-LPGAGPLRYLSTPQPSNNVRVETGVREGDEVSVHYDPMIAKLVVWGENRTQALNSLVARLGEYHISGLDTNINFLIDLASHPEFQLANVHTGFIDEQFDTLFPPIIISPQQV----SQAALALVLNELQAAFRNGN---KDQDPFVATPNARLN--------YSLVRRYDLKANEKVYSVAVKFDGEDMQIQVDNGDWQDAKVERVQDGSRLKIRANIN--SNVTTYNASIDGTSVSLFSE--SGKVDFEVGQPKFL----SAQGDQLGA---------VGSRIVAPMPGILEKVLVKPGDKVKKGENLAVLIAMKMEHILKAPKDATIKSIGGAAGDNVAKGAAVI 625          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Fly
Match: PCB (gene:FBgn0027580 transcript:FBtr0088455)

HSP 1 Score: 354.369 bits (908), Expect = 6.009e-106
Identity = 193/474 (40.72%), Postives = 298/474 (62.87%), Query Frame = 1
Query:  190 KKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSL-SYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLL---LKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSG-IQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVV 1596
            + +L+ANRGEIA R+  +C   GIK+VAV+S+ D +    Q ADE+  +G     + +YLN+ +++   K+   +AVHPGYGFLSE + FA+ + D  + F+GP+ + +  MGDK+ ++  A  A V  +PG DG +   +EA++   + G PV+ KA+ GGGG+GMR+    ++  E ++ + +EAK++FG+  M IEK+I +PRHIE+Q++ DK GN ++L ER+CS+QRR+QKV+E AP+  +  E R  M E AV++A+ VGY++AGTVEFL D+  NFYF+E+N RLQVEH ++E ITG+D+V    RV +G  L      Q  I   G+A++CRV  EDP   F  P+ GRL  ++    +  +R DS     G+ IS YYD ++ K++++  D   + + M +AL  + IRGV  NIP L +++   +F+ G + T ++ E +P  FK K    +   LL  M  V+
Sbjct:   40 RSVLVANRGEIAIRVFRACTELGIKSVAVYSEQDKMHMHRQKADESYIVGKGLPPVEAYLNIPELIRVCKENDVDAVHPGYGFLSERSDFAQAVIDAGLRFIGPSPEVVQKMGDKVAARVAAIEAGVPIVPGTDGPVTTKEEALEFCKKHGLPVIFKAAYGGGGRGMRVVRKMEDVEESFQRASSEAKAAFGNGAMFIEKFIERPRHIEVQLLGDKAGNVVHLYERDCSVQRRHQKVVEIAPAPRLPIEIRDKMTEAAVRLARHVGYENAGTVEFLCDESGNFYFIEVNARLQVEHTVTEEITGIDLVQSQIRVAEGMTLPELGYTQDKIVPRGYAIQCRVTTEDPANDFQ-PNTGRLEVFRSGEGM-GIRLDSASAYAGAIISPYYDSLLVKVISHASDLQSSASKMNRALREFRIRGVKTNIPFLLNVLENQKFLHGVLDTYFIDE-HPQLFKFKPSLNRAQKLLNYMGEVL 510          

HSP 2 Score: 55.0694 bits (131), Expect = 3.148e-7
Identity = 31/77 (40.26%), Postives = 43/77 (55.84%), Query Frame = 1
Query: 2005 PKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            PK      S + APMPG V  + VKVG +V  GQ L VL AMKM+  + +  AGV+K +    G  +   D+I+ +E
Sbjct: 1105 PKANKSNKSEVGAPMPGTVIDIRVKVGDKVEKGQPLVVLSAMKMEMVVQSPLAGVVKKLEIANGTKLEGEDLIMIIE 1181          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Zebrafish
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:ZFIN;Acc:ZDB-GENE-040718-246])

HSP 1 Score: 830.091 bits (2143), Expect = 0.000e+0
Identity = 418/691 (60.49%), Postives = 527/691 (76.27%), Query Frame = 1
Query:  169 DPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDR-SLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVH-VSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            +P +  F KILIANRGEIACR+I +C++ GIK VAVHSDVD+ +  V+MADEA+C+GPA TS SYLNM+ I++A+K TGA+AVHPGYGFLSEN  FAK+L    V F+GP++ AI +MGDKIESK IA AAKV+ IPG+DG + D +EA+KIA +IGYPVMIKASAGGGGKGMRIAWND+E  EG++ S  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPSTF++P+TR+ MGEQAV +AKAV Y SAGTVEFLVD K+NFYFLEMNTRLQVEHPI+E ITG+D+V QM R+ KG+ L  KQSDI +NGWA+E RVYAEDPYKSFGLPS+GRL+ Y+EPL L NVR DSGIQEGS+ISIYYDPMI KLVTYG+ R +AL  M +ALD+YV+RGVTHNIPLLR+I+  PRFVSG+I+T +LPEVYPDGFKG  LT  E   L A +A ++   ++R++ FL   R S + AE S           +W L +   LE     ++VH + V    + +TV  + G   +++  ++LA  +++  I+     LQ +SR  +G I  QY+GT +KL+V S +   LSK M  K   DTSS++ +PMPG V  VSVK G  V++GQE+CV+EAMKMQNSM AAK   +K+VH + G TV +GD+++ELE
Sbjct:   50 EPNDKTFDKILIANRGEIACRVIKTCRKMGIKTVAVHSDVDSSAVHVKMADEAVCVGPAPTSKSYLNMDAIMNAIKLTGAQAVHPGYGFLSENKEFAKRLAAEGVTFIGPDTHAIQAMGDKIESKLIAKAAKVNTIPGFDGVVKDAEEAVKIAGEIGYPVMIKASAGGGGKGMRIAWNDEETREGFRFSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPDTRRKMGEQAVSLAKAVKYSSAGTVEFLVDSKKNFYFLEMNTRLQVEHPITECITGLDLVEQMIRIAKGNKLQHKQSDIPINGWAIESRVYAEDPYKSFGLPSIGRLSQYQEPLDLDNVRVDSGIQEGSDISIYYDPMISKLVTYGKTREEALKKMEEALDNYVVRGVTHNIPLLREIIVHPRFVSGDISTKFLPEVYPDGFKGHMLTAGERQELLATAAALYTAAQLRSQRFLGDLRVSCVPAESS-----------DWELCVE--LE-----KSVHMLGVSRSGNKYTVEID-GEKVQVSGEWNLASALLSVTINGKHRTLQCLSRTAAGEIILQYLGTSFKLRVLSKLAASLSKHMPEKVPEDTSSILRSPMPGSVVAVSVKPGDTVAEGQEICVIEAMKMQNSMTAAKTAKVKSVHCKAGDTVGEGDLLVELE 721          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Zebrafish
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:ZFIN;Acc:ZDB-GENE-040718-246])

HSP 1 Score: 800.816 bits (2067), Expect = 0.000e+0
Identity = 412/702 (58.69%), Postives = 520/702 (74.07%), Query Frame = 1
Query:  166 HDPKETKFKKILIANRGEIACR----------IINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDR-SLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVH-VSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            HD K   FK+      G I CR          +I +C++ GIK VAVHSDVD+ +  V+MADEA+C+GPA TS SYLNM+ I++A+K TGA+AVHPGYGFLSEN  FAK+L    V F+GP++ AI +MGDKIESK IA AAKV+ IPG+DG + D +EA+KIA +IGYPVMIKASAGGGGKGMRIAWND+E  EG++ S  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPSTF++P+TR+ MGEQAV +AKAV Y SAGTVEFLVD K+NFYFLEMNTRLQVEHPI+E ITG+D+V QM R+ KG+ L  KQSDI +NGWA+E RVYAEDPYKSFGLPS+GRL+ Y+EPL L NVR DSGIQEGS+ISIYYDPMI KLVTYG+ R +AL  M +ALD+YV+RGVTHNIPLLR+I+  PRFVSG+I+T +LPEVYPDGFKG  LT  E   L A +A ++   ++R++ FL   R S + AE S           +W L +   LE     ++VH + V    + +TV  + G   +++  ++LA  +++  I+     LQ +SR  +G I  QY+GT +KL+V S +   LSK M  K   DTSS++ +PMPG V  VSVK G  V++GQE+CV+EAMKMQNSM AAK   +K+VH + G TV +GD+++ELE
Sbjct:   15 HDVKHVCFKQ----RCGVIICRYSTVIEPNDKVIKTCRKMGIKTVAVHSDVDSSAVHVKMADEAVCVGPAPTSKSYLNMDAIMNAIKLTGAQAVHPGYGFLSENKEFAKRLAAEGVTFIGPDTHAIQAMGDKIESKLIAKAAKVNTIPGFDGVVKDAEEAVKIAGEIGYPVMIKASAGGGGKGMRIAWNDEETREGFRFSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPDTRRKMGEQAVSLAKAVKYSSAGTVEFLVDSKKNFYFLEMNTRLQVEHPITECITGLDLVEQMIRIAKGNKLQHKQSDIPINGWAIESRVYAEDPYKSFGLPSIGRLSQYQEPLDLDNVRVDSGIQEGSDISIYYDPMISKLVTYGKTREEALKKMEEALDNYVVRGVTHNIPLLREIIVHPRFVSGDISTKFLPEVYPDGFKGHMLTAGERQELLATAAALYTAAQLRSQRFLGDLRVSCVPAESS-----------DWELCVE--LE-----KSVHMLGVSRSGNKYTVEID-GEKVQVSGEWNLASALLSVTINGKHRTLQCLSRTAAGEIILQYLGTSFKLRVLSKLAASLSKHMPEKVPEDTSSILRSPMPGSVVAVSVKPGDTVAEGQEICVIEAMKMQNSMTAAKTAKVKSVHCKAGDTVGEGDLLVELE 693          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Zebrafish
Match: mccc1 (methylcrotonoyl-CoA carboxylase 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-050208-450])

HSP 1 Score: 496.893 bits (1278), Expect = 1.298e-164
Identity = 278/685 (40.58%), Postives = 403/685 (58.83%), Query Frame = 1
Query:  184 KFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNS-FRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            + +K++IANRGEIACR++ + ++ G+++VAV+SD D  S  V MADEA  IGPA +  SYL M+KILD  K++ A+AVHPGYGFLSENT FA++ +   ++F+GP S AI  MG K  SK I +AA V  I GY G+          A +IGYPVMIKA  GGGGKGMRIA ++ E  E  + +R EA+ SF DD MLIEK++  PRH+E+Q+  D++G+A+YL ER+CS+QRR+QK+IEEAP   I+PE R+ +GE AV+ AKAV Y  AGTVEF++D + NFYF+EMNTRLQVEHP+SE+ITG D+V    RV  G  L L Q  I + G + E R+YAEDP  +F LP  G L     P    N R ++G++EG E+S +YDPMI KLV +GEDRS AL  +   L  Y I G+  NI  L  +   P F +GN+ T+++P+ Y   F   Q     +G +   +A+  +  E +     ++  S + +  + S    L+  +  ++S+  G         V VS+ ++    T + E+G   F ++    L   +       + ++      +    +        + ++  + +   + KF+            +APM G ++ V VK G  V  G  L V+ AMKM++++ A KAGVIK V F+ G   S    ++E++
Sbjct:   35 RIEKVVIANRGEIACRVMRTARKMGVRSVAVYSDADRHSMHVAMADEAYHIGPAASQQSYLCMDKILDVAKKSSAQAVHPGYGFLSENTEFAEQCKQEGIIFIGPPSSAIRDMGIKSTSKHIMSAAGVPIIEGYHGDDQSDARLQSEAARIGYPVMIKAVRGGGGKGMRIAQSEAEFHEQLESARREARKSFNDDVMLIEKFVENPRHVEVQVFGDQYGDAVYLFERDCSVQRRHQKIIEEAPGPGISPEVRRKLGEAAVRAAKAVNYVGAGTVEFIMDAQHNFYFMEMNTRLQVEHPVSEMITGTDLVEWQLRVAAGEKLPLSQEQIELRGHSFEARIYAEDPNNNF-LPGAGPLLHLSTPPGDHNTRIETGVREGDEVSAHYDPMIAKLVVWGEDRSAALKKLRYCLRQYNIVGLNTNIDFLLSLSGHPEFEAGNVHTSFIPQHYDHLFPPAQ---SPSGEVICQAALGLLLREKQQTQKYREQTSDVFSPFASSNGRRLNVLQCRNMSLQLG------DNKVAVSITYNPDG-TYSMETGGRVFAVSGELQLEGDVTYLCCSVNGVL------SRPKLVILDNTVHLFSMEGSAQVDVPVPKFLAGVSGSSAQGGAVAPMTGTIEKVLVKAGDSVQKGDPLMVMIAMKMEHTIRAPKAGVIKKVFFKEGSQASRHAALVEMQ 702          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Zebrafish
Match: mccc1 (methylcrotonoyl-CoA carboxylase 1 (alpha) [Source:ZFIN;Acc:ZDB-GENE-050208-450])

HSP 1 Score: 494.582 bits (1272), Expect = 9.060e-164
Identity = 277/685 (40.44%), Postives = 402/685 (58.69%), Query Frame = 1
Query:  184 KFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNS-FRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            + +K++IANRGEIACR++ + ++ G+++VAV+SD D  S  V MADEA  IGPA +  SYL M+KILD  K++ A+AVHPGYGFLSENT FA++ +   ++F+GP S AI  MG K  SK I +AA V  I GY G+          A +IGYPVMIKA  GGGGKGMRIA ++ E  E  + +R EA+ SF DD MLIEK++  PRH+E+Q+  D++G+A+YL ER+CS+QRR+QK+IEEAP   I+PE R+ +GE AV+ AKAV Y  AGTVEF++D + NFYF+EMNTRLQVEHP+SE+ITG D+V    RV  G  L L Q  I + G + E R+YAEDP  +F LP  G L     P    N R ++G++EG E+S +YDPMI KLV +GEDRS AL  +   L  Y I G+  NI  L  +   P F +GN+ T+++P+ Y   F   Q     +G +   +A+  +  E +     ++  S + +  + S    L+  +  ++S+  G         V VS+ ++    T + E+G   F ++    L   +       + ++      +    +        + ++  + +   +  F+            +APM G ++ V VK G  V  G  L V+ AMKM++++ A KAGVIK V F+ G   S    ++E++
Sbjct:   35 RIEKVVIANRGEIACRVMRTARKMGVRSVAVYSDADRHSMHVAMADEAYHIGPAASQQSYLCMDKILDVAKKSSAQAVHPGYGFLSENTEFAEQCKQEGIIFIGPPSSAIRDMGIKSTSKHIMSAAGVPIIEGYHGDDQSDARLQSEAARIGYPVMIKAVRGGGGKGMRIAQSEAEFHEQLESARREARKSFNDDVMLIEKFVENPRHVEVQVFGDQYGDAVYLFERDCSVQRRHQKIIEEAPGPGISPEVRRKLGEAAVRAAKAVNYVGAGTVEFIMDAQHNFYFMEMNTRLQVEHPVSEMITGTDLVEWQLRVAAGEKLPLSQEQIELRGHSFEARIYAEDPNNNF-LPGAGPLLHLSTPPGDHNTRIETGVREGDEVSAHYDPMIAKLVVWGEDRSAALKKLRYCLRQYNIVGLNTNIDFLLSLSGHPEFEAGNVHTSFIPQHYDHLFPPAQ---SPSGEVICQAALGLLLREKQQTQKYREQTSDVFSPFASSNGRRLNVLQCRNMSLQLG------DNKVAVSITYNPDG-TYSMETGGRVFAVSGELQLEGDVTYLCCSVNGVL------SRPKLVILDNTVHLFSMEGSAQVDVPVPMFLAGVSGSSAQGGAVAPMTGTIEKVLVKAGDSVQKGDPLMVMIAMKMEHTIRAPKAGVIKKVFFKEGSQASRHAALVEMQ 702          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Zebrafish
Match: pcxa (pyruvate carboxylase a [Source:ZFIN;Acc:ZDB-GENE-090908-3])

HSP 1 Score: 363.229 bits (931), Expect = 3.657e-109
Identity = 192/448 (42.86%), Postives = 290/448 (64.73%), Query Frame = 1
Query:  190 KKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLS-YLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLL---LKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQ-EGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPE 1518
            KK+++ANRGEIA R+  +C   GI+ VAV+S+ D      Q ADEA  IG     ++ YL++  I+   K    +A+HPGYGFLSE   FA+   D  V F+GP    +  MGDK++++ IA +A V  +PG D  I+   EA + +N  G+P++ KA+ GGGG+GMR+    +E  E Y+ + +EA ++FG+  + +EK+I KPRHIE+QI+ DK+GN ++L ER+CSIQRR+QKV+E AP+T ++P  R  +   +V +A+ VGY++AGTVEFLVD     YF+E+N+RLQVEH ++E IT VD+VH   RV +G  L    LKQ  I +NG+A++CRV  EDP + F  P  GRL  ++    +  +R DS    +G+ IS +YD ++ K++  G+D   A A M +AL  + +RGV  NIP L+++++  +F++G + T ++ E
Sbjct:   40 KKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGKGLPPVAAYLHIPDIIKVAKANDVDAIHPGYGFLSERADFAQACVDAGVRFIGPTPDVVRKMGDKVQARAIAISAGVPVVPGTDAPISCLQEAQEFSNSYGFPIIFKAAYGGGGRGMRVVREYEELEENYQRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDKYGNVIHLYERDCSIQRRHQKVVEIAPATQLDPHLRDRLTADSVNLARQVGYENAGTVEFLVDKHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQLRVCEGRSLPELGLKQDKIRINGYAIQCRVTTEDPARGFQ-PDTGRLEVFRSGEGM-GIRLDSASAFQGAVISPHYDSLLVKVIASGKDLPAASAKMSRALAEFRVRGVKTNIPFLQNVLSNNQFLNGTVDTQFIDE 485          

HSP 2 Score: 61.6178 bits (148), Expect = 3.869e-9
Identity = 36/103 (34.95%), Postives = 54/103 (52.43%), Query Frame = 1
Query: 1924 ITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIEL 2232
            + F+  G    + V+  +  K   F  PK + D    I APMPG V  V VK GQ+V  GQ LCVL AMKM+  + +  +G +  ++     T+   D+I+E+
Sbjct: 1078 VFFELNGQLRSVLVKDTVAMKEMHFH-PKALKDVRGQIGAPMPGKVVEVKVKQGQQVEKGQPLCVLSAMKMETVVNSPISGTVAKIYVTADSTLEGDDLILEI 1179          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Xenopus
Match: PCCA (propionyl-CoA carboxylase subunit alpha [Source:NCBI gene;Acc:100493552])

HSP 1 Score: 838.951 bits (2166), Expect = 0.000e+0
Identity = 413/696 (59.34%), Postives = 534/696 (76.72%), Query Frame = 1
Query:  148 IYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            + ++  HDP E  F KILIANRGEIACR+I +C++ GIK VAVHSDVD+ S  V+MADEA+C+GPA TS SYLNM+ I+DA+K TGA+AVHPGYGFLSEN  FA++L   +V F+GP++ AI +MGDKIESK +A  AKV+ IPG+DG + D DEA++IA +IGYPVMIKASAGGGGKGMRIAW+D+E  EG++ S  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPSTF++PETR+AMGEQAV +AKAV Y SAGTVEFLVD K+NF+FLEMNTRLQVEHPI+E ITG+D+V +M RV KG+ L  KQ+DIS+NGWA+ECRVYAEDPYKSFGLPS+GRL+ Y+EP  LP VR DSGIQEGS+ISI+YDPMI KLVT+G DR++AL  M  ALD+YVIRGVTHNIPLL +I+T P FV G+ITT +LPEVYPDGFKG  L+ +E   L   +A ++V  + R+  FL   R  +      S          W LS+    +   K+ +V VS   D   F+V  + G +  +++ ++L+  +++ +  + +  +Q +SR+ +G ++ Q+MGT YKL+V +    +LSK+M  K   DTSS++ +PMPG V TVSVK G  VS+GQE+CV+EAMKMQNSM AAK   +K++H +PG+TV +GD++++LE
Sbjct:   45 VQYSTAHDPNEKTFDKILIANRGEIACRVIKTCRKMGIKTVAVHSDVDSASVHVKMADEAVCVGPAPTSKSYLNMDAIMDAIKHTGAQAVHPGYGFLSENKEFARRLAAESVTFIGPDTHAIQAMGDKIESKLLAKNAKVNTIPGFDGVVKDADEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETREGFRFSAQEAASSFGDDRLLIEKFIDNPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPETRRAMGEQAVALAKAVKYSSAGTVEFLVDSKKNFFFLEMNTRLQVEHPITECITGLDLVQEMIRVAKGYSLKHKQADISINGWAIECRVYAEDPYKSFGLPSIGRLSQYQEPHLLPGVRVDSGIQEGSDISIFYDPMISKLVTHGRDRTEALKRMEDALDNYVIRGVTHNIPLLHEIITHPLFVKGDITTKFLPEVYPDGFKGHTLSQEEQNELIGTAASIYVALQRRSHRFLSNTRVPIAKNDVNS----------WDLSV----QLDGKSYSVQVSRINDT--FSVEID-GTTLNVSSEWNLSSSLLSVSFGDAQKTIQCLSRDAAGNLSIQFMGTVYKLQVLTSHAAELSKYMPEKVEEDTSSILRSPMPGTVVTVSVKPGDMVSEGQEICVIEAMKMQNSMTAAKTAKVKSLHVKPGETVGEGDLLVQLE 723          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Xenopus
Match: PCCA (propionyl-CoA carboxylase subunit alpha [Source:NCBI gene;Acc:100493552])

HSP 1 Score: 838.565 bits (2165), Expect = 0.000e+0
Identity = 413/696 (59.34%), Postives = 534/696 (76.72%), Query Frame = 1
Query:  148 IYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            + ++  HDP E  F KILIANRGEIACR+I +C++ GIK VAVHSDVD+ S  V+MADEA+C+GPA TS SYLNM+ I+DA+K TGA+AVHPGYGFLSEN  FA++L   +V F+GP++ AI +MGDKIESK +A  AKV+ IPG+DG + D DEA++IA +IGYPVMIKASAGGGGKGMRIAW+D+E  EG++ S  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPSTF++PETR+AMGEQAV +AKAV Y SAGTVEFLVD K+NF+FLEMNTRLQVEHPI+E ITG+D+V +M RV KG+ L  KQ+DIS+NGWA+ECRVYAEDPYKSFGLPS+GRL+ Y+EP  LP VR DSGIQEGS+ISI+YDPMI KLVT+G DR++AL  M  ALD+YVIRGVTHNIPLL +I+T P FV G+ITT +LPEVYPDGFKG  L+ +E   L   +A ++V  + R+  FL   R  +      S          W LS+    +   K+ +V VS   D   F+V  + G +  +++ ++L+  +++ +  + +  +Q +SR+ +G ++ Q+MGT YKL+V +    +LSK+M  K   DTSS++ +PMPG V TVSVK G  VS+GQE+CV+EAMKMQNSM AAK   +K++H +PG+TV +GD++++LE
Sbjct:   32 VQYSTAHDPNEKTFDKILIANRGEIACRVIKTCRKMGIKTVAVHSDVDSASVHVKMADEAVCVGPAPTSKSYLNMDAIMDAIKHTGAQAVHPGYGFLSENKEFARRLAAESVTFIGPDTHAIQAMGDKIESKLLAKNAKVNTIPGFDGVVKDADEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETREGFRFSAQEAASSFGDDRLLIEKFIDNPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPETRRAMGEQAVALAKAVKYSSAGTVEFLVDSKKNFFFLEMNTRLQVEHPITECITGLDLVQEMIRVAKGYSLKHKQADISINGWAIECRVYAEDPYKSFGLPSIGRLSQYQEPHLLPGVRVDSGIQEGSDISIFYDPMISKLVTHGRDRTEALKRMEDALDNYVIRGVTHNIPLLHEIITHPLFVKGDITTKFLPEVYPDGFKGHTLSQEEQNELIGTAASIYVALQRRSHRFLSNTRVPIAKNDVNS----------WDLSV----QLDGKSYSVQVSRINDT--FSVEID-GTTLNVSSEWNLSSSLLSVSFGDAQKTIQCLSRDAAGNLSIQFMGTVYKLQVLTSHAAELSKYMPEKVEEDTSSILRSPMPGTVVTVSVKPGDMVSEGQEICVIEAMKMQNSMTAAKTAKVKSLHVKPGETVGEGDLLVQLE 710          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Xenopus
Match: PCCA (propionyl-CoA carboxylase subunit alpha [Source:NCBI gene;Acc:100493552])

HSP 1 Score: 684.485 bits (1765), Expect = 0.000e+0
Identity = 321/471 (68.15%), Postives = 392/471 (83.23%), Query Frame = 1
Query:  232 IINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDR 1644
            +I +C++ GIK VAVHSDVD+ S  V+MADEA+C+GPA TS SYLNM+ I+DA+K TGA+AVHPGYGFLSEN  FA++L   +V F+GP++ AI +MGDKIESK +A  AKV+ IPG+DG + D DEA++IA +IGYPVMIKASAGGGGKGMRIAW+D+E  EG++ S  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPSTF++PETR+AMGEQAV +AKAV Y SAGTVEFLVD K+NF+FLEMNTRLQVEHPI+E ITG+D+V +M RV KG+ L  KQ+DIS+NGWA+ECRVYAEDPYKSFGLPS+GRL+ Y+EP  LP VR DSGIQEGS+ISI+YDPMI KLVT+G DR++AL  M  ALD+YVIRGVTHNIPLL +I+T P FV G+ITT +LPEVYPDGFKG  L+ +E   L   +A ++V  + R+  FL   R
Sbjct:   35 VIKTCRKMGIKTVAVHSDVDSASVHVKMADEAVCVGPAPTSKSYLNMDAIMDAIKHTGAQAVHPGYGFLSENKEFARRLAAESVTFIGPDTHAIQAMGDKIESKLLAKNAKVNTIPGFDGVVKDADEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETREGFRFSAQEAASSFGDDRLLIEKFIDNPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPETRRAMGEQAVALAKAVKYSSAGTVEFLVDSKKNFFFLEMNTRLQVEHPITECITGLDLVQEMIRVAKGYSLKHKQADISINGWAIECRVYAEDPYKSFGLPSIGRLSQYQEPHLLPGVRVDSGIQEGSDISIFYDPMISKLVTHGRDRTEALKRMEDALDNYVIRGVTHNIPLLHEIITHPLFVKGDITTKFLPEVYPDGFKGHTLSQEEQNELIGTAASIYVALQRRSHRFLSNTR 505          

HSP 2 Score: 79.7221 bits (195), Expect = 9.038e-15
Identity = 43/76 (56.58%), Postives = 54/76 (71.05%), Query Frame = 1
Query: 1945 TKY--KLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAG 2166
            T+Y   LK+ +    +LSK+M  K   DTSS++ +PMPG V TVSVK G  VS+GQE+CV+EAMKMQNSM AAK  
Sbjct:  504 TRYVPSLKILTSHAAELSKYMPEKVEEDTSSILRSPMPGTVVTVSVKPGDMVSEGQEICVIEAMKMQNSMTAAKTA 579          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Xenopus
Match: PCCA (propionyl-CoA carboxylase subunit alpha [Source:NCBI gene;Acc:100493552])

HSP 1 Score: 668.692 bits (1724), Expect = 0.000e+0
Identity = 312/438 (71.23%), Postives = 377/438 (86.07%), Query Frame = 1
Query:  229 RIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKG 1542
            ++I +C++ GIK VAVHSDVD+ S  V+MADEA+C+GPA TS SYLNM+ I+DA+K TGA+AVHPGYGFLSEN  FA++L   +V F+GP++ AI +MGDKIESK +A  AKV+ IPG+DG + D DEA++IA +IGYPVMIKASAGGGGKGMRIAW+D+E  EG++ S  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPSTF++PETR+AMGEQAV +AKAV Y SAGTVEFLVD K+NF+FLEMNTRLQVEHPI+E ITG+D+V +M RV KG+ L  KQ+DIS+NGWA+ECRVYAEDPYKSFGLPS+GRL+ Y+EP  LP VR DSGIQEGS+ISI+YDPMI KLVT+G DR++AL  M  ALD+YVIRGVTHNIPLL +I+T P FV G+ITT +LPEVYPDGFKG
Sbjct:   42 QVIKTCRKMGIKTVAVHSDVDSASVHVKMADEAVCVGPAPTSKSYLNMDAIMDAIKHTGAQAVHPGYGFLSENKEFARRLAAESVTFIGPDTHAIQAMGDKIESKLLAKNAKVNTIPGFDGVVKDADEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETREGFRFSAQEAASSFGDDRLLIEKFIDNPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPETRRAMGEQAVALAKAVKYSSAGTVEFLVDSKKNFFFLEMNTRLQVEHPITECITGLDLVQEMIRVAKGYSLKHKQADISINGWAIECRVYAEDPYKSFGLPSIGRLSQYQEPHLLPGVRVDSGIQEGSDISIFYDPMISKLVTHGRDRTEALKRMEDALDNYVIRGVTHNIPLLHEIITHPLFVKGDITTKFLPEVYPDGFKG 479          

HSP 2 Score: 78.5666 bits (192), Expect = 2.380e-14
Identity = 49/119 (41.18%), Postives = 65/119 (54.62%), Query Frame = 1
Query: 1825 IANNFHLADKIITQNI-----DNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAG 2166
            + +N  L  +IIT  +        + + ++    + G   F Y   K     E      LSK+M  K   DTSS++ +PMPG V TVSVK G  VS+GQE+CV+EAMKMQNSM AAK  
Sbjct:  443 VTHNIPLLHEIITHPLFVKGDITTKFLPEVYPDGFKGLSFFIYFSIKRNHAAE------LSKYMPEKVEEDTSSILRSPMPGTVVTVSVKPGDMVSEGQEICVIEAMKMQNSMTAAKTA 555          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Xenopus
Match: PCCA (propionyl-CoA carboxylase subunit alpha [Source:NCBI gene;Acc:100493552])

HSP 1 Score: 645.58 bits (1664), Expect = 0.000e+0
Identity = 305/438 (69.63%), Postives = 371/438 (84.70%), Query Frame = 1
Query:  229 RIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKG 1542
            ++I +C++ GIK VAVHSDVD+ S  V+MADEA+C+GPA TS SYLNM+ I+DA+K TGA+AVHPGYGFLSEN  FA++L   +V F+GP++ AI +MGDKIESK +A  AKV+ IPG+DG +  ++     +  +GYPVMIKASAGGGGKGMRIAW+D+E  EG++ S  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPSTF++PETR+AMGEQAV +AKAV Y SAGTVEFLVD K+NF+FLEMNTRLQVEHPI+E ITG+D+V +M RV KG+ L  KQ+DIS+NGWA+ECRVYAEDPYKSFGLPS+GRL+ Y+EP  LP VR DSGIQEGS+ISI+YDPMI KLVT+G DR++AL  M  ALD+YVIRGVTHNIPLL +I+T P FV G+ITT +LPEVYPDGFKG
Sbjct:   42 QVIKTCRKMGIKTVAVHSDVDSASVHVKMADEAVCVGPAPTSKSYLNMDAIMDAIKHTGAQAVHPGYGFLSENKEFARRLAAESVTFIGPDTHAIQAMGDKIESKLLAKNAKVNTIPGFDGVVK-SELLSNCSLLLGYPVMIKASAGGGGKGMRIAWDDEETREGFRFSAQEAASSFGDDRLLIEKFIDNPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPETRRAMGEQAVALAKAVKYSSAGTVEFLVDSKKNFFFLEMNTRLQVEHPITECITGLDLVQEMIRVAKGYSLKHKQADISINGWAIECRVYAEDPYKSFGLPSIGRLSQYQEPHLLPGVRVDSGIQEGSDISIFYDPMISKLVTHGRDRTEALKRMEDALDNYVIRGVTHNIPLLHEIITHPLFVKGDITTKFLPEVYPDGFKG 478          

HSP 2 Score: 83.1889 bits (204), Expect = 9.391e-16
Identity = 45/86 (52.33%), Postives = 59/86 (68.60%), Query Frame = 1
Query: 1951 YKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVS 2208
            YKL+V +    +LSK+M  K   DTSS++ +PMPG V TVSVK G  VS+GQE+CV+EAMKMQNSM AAK   +    + PG + +
Sbjct:  539 YKLQVLTSHAAELSKYMPEKVEEDTSSILRSPMPGTVVTVSVKPGDMVSEGQEICVIEAMKMQNSMTAAKTAKL----YHPGGSAA 620          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Mouse
Match: Pcca (propionyl-Coenzyme A carboxylase, alpha polypeptide [Source:MGI Symbol;Acc:MGI:97499])

HSP 1 Score: 842.803 bits (2176), Expect = 0.000e+0
Identity = 410/691 (59.33%), Postives = 531/691 (76.85%), Query Frame = 1
Query:  163 KHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            +++PKE  F KILIANRGEIACR+I +CK+ GIK VA+HSDVDA S  V+MADEA+C+GPA TS SYLNM+ I++A+K+T A+AVHPGYGFLSEN  FAK+L   +V F+GP++ AI +MGDKIESK +A  AKV+ IPG+DG + D DEA++IA +IGYPVMIKASAGGGGKGMRIAW+D+E  +G++ S  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPS F++PETR+AMGEQAV +AKAV Y SAGTVEFLVD ++NFYFLEMNTRLQVEHP++E ITG+D+V +M  V KG+PL  KQ DI ++GWAVECRVYAEDPYKSFGLPS+GRL+ Y+EP+HLP VR DSGIQ GS+ISIYYDPMI KLVTYG DR++AL  M  ALD+YVIRGVTHNIPLLR+++   RFV G+I+T +L +VYPDGFKG  LT  E   L A+++ VFV +++R + F +  R  +I       R D++   +W LS+   L  +D T    V    +   FTV  + G+   + + ++LA  +++ N+D  +  +Q +SR   G ++ Q++GT YK+ + + +  +L+KFML K   DTSS + +PMPG+V  VSVK G  V++GQE+CV+EAMKMQNSM A K G +K VH + G TV +GD+++ELE
Sbjct:   51 EYEPKEKTFDKILIANRGEIACRVIKTCKKMGIKTVAIHSDVDASSVHVKMADEAVCVGPAPTSKSYLNMDAIMEAIKKTRAQAVHPGYGFLSENKEFAKRLAAEDVTFIGPDTHAIQAMGDKIESKLLAKRAKVNTIPGFDGVVKDADEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRFSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVVEEAPSIFLDPETRQAMGEQAVALAKAVKYSSAGTVEFLVDSQKNFYFLEMNTRLQVEHPVTECITGLDLVQEMILVAKGYPLRHKQEDIPISGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPIHLPGVRVDSGIQPGSDISIYYDPMISKLVTYGSDRAEALKRMEDALDNYVIRGVTHNIPLLREVIINTRFVKGDISTKFLSDVYPDGFKGHTLTLSERNQLLAIASSVFVASQLRAQRFQEHSRVPVI-------RPDVA---KWELSVK--LHDEDHT----VVASNNGPAFTVEVD-GSKLNVTSTWNLASPLLSVNVDGTQRTVQCLSREAGGNMSIQFLGTVYKVHILTKLAAELNKFMLEKVPKDTSSTLCSPMPGVVVAVSVKPGDMVAEGQEICVIEAMKMQNSMTAGKMGKVKLVHCKAGDTVGEGDLLVELE 724          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Mouse
Match: Mccc1 (methylcrotonoyl-Coenzyme A carboxylase 1 (alpha) [Source:MGI Symbol;Acc:MGI:1919289])

HSP 1 Score: 481.871 bits (1239), Expect = 9.032e-159
Identity = 272/684 (39.77%), Postives = 402/684 (58.77%), Query Frame = 1
Query:  193 KILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIK-IANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLAD--KIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            K+LIANRGEIACR+I + K+ G+++VAV+S+ D  S  V MADEA  IGPA +  SYL MEKI+   K + A+A+HPGYGFLSEN  FA+  +   ++F+GP S AI  MG K  SK I  AA V  + GY G+ + +D+ ++  A +IGYPVMIKA  GGGGKGMRI  +++E  E  + +R EAK SF DD MLIEK+++ PRH+E+Q+  D HGNA+YL ER+CS+QRR+QK+IEEAP+  INPE R+ +GE AV+ AKAV Y  AGTVEF++D + NFYF+EMNTRLQVEHP++E+ITG D+V    R+  G  + L Q +I + G A E R+YAEDP  +F +P  G L     P    + R ++G+++G E+S++YDPMI KLV +  DR  AL+ +   L  Y I G+  N+  L  +   P F +GN+ T+++P+ + D         KE+ + +A   ++  + E+ +         L   ++   F    S     ++S +  +  +    ++ ++V ++R           SFR+  +    D    +  +I+        ++R  S +I        + ++    +G  + K++ P          IAPM G ++ V VK G RV  G  L V+ AMKM++++ A K G IK V F  G   +    ++E E
Sbjct:   47 KVLIANRGEIACRVIRTAKKMGVQSVAVYSEADRNSMHVDMADEAYSIGPAPSQQSYLAMEKIIQVAKSSAAQAIHPGYGFLSENMEFAELCKQEGIIFIGPPSSAIRDMGIKSTSKSIMAAAGVPVVEGYHGK-DQSDQCLREHAGKIGYPVMIKAVRGGGGKGMRIVRSEREFQEQLESARREAKKSFNDDAMLIEKFVDTPRHVEVQVFGDHHGNAVYLFERDCSVQRRHQKIIEEAPAPGINPEVRRKLGEAAVRAAKAVKYVGAGTVEFIMDSRHNFYFMEMNTRLQVEHPVTEMITGTDLVEWQLRIAAGEKIPLSQEEIPLQGHAFEARIYAEDPDNNF-MPGAGPLVHLSTPSADMSTRIETGVRQGDEVSVHYDPMIAKLVVWASDRQSALSKLRYCLHQYNIVGLRSNVDFLLRLSGHPEFEAGNVHTDFIPQHHKDLLPSHSTIAKES-VCQAALGLILKEKEMTSAF------KLHTQDQFSPF--SFSSGRRLNISYTRNMTLRSGKSDIVIAVTYNRDGSYDMQIDNKSFRVLGDLSSEDGCTYLKSSING-------VARK-SKFILLDNTVHLFSMEGSIEVGIPVPKYLSPVSAEGAQGGTIAPMTGTIEKVFVKAGDRVKAGDSLMVMIAMKMEHTIKAPKDGRIKKVFFSEGAQANRHAPLVEFE 711          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Mouse
Match: Pcx (pyruvate carboxylase [Source:MGI Symbol;Acc:MGI:97520])

HSP 1 Score: 379.793 bits (974), Expect = 3.599e-115
Identity = 200/466 (42.92%), Postives = 304/466 (65.24%), Query Frame = 1
Query:  190 KKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIG----PAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLL---LKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQ-EGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKE 1563
            KK+++ANRGEIA R+  +C   GI+ VAV+S+ D      Q ADEA  IG    P Q   +YL++  I+   K+ G +AVHPGYGFLSE   FA+  +D  V F+GP+ + +  MGDK+E++ IA AA V  +PG D  I+   EA + +N  G+P++ KA+ GGGG+GMR+  + +E  E Y  + +EA ++FG+  + +EK+I KPRHIE+QI+ D++GN L+L ER+CSIQRR+QKV+E AP+T ++P+ R  +   +V++AK VGY++AGTVEFLVD     YF+E+N+RLQVEH ++E IT VD+VH    V +G  L    L+Q +I +NG A++CRV  EDP +SF  P  GR+  ++    +  +R D+    +G+ IS +YD ++ K++ +G+D   A   M +AL  + +RGV  NIP L++++   +F++G + T ++ E  P+ F   QL P +
Sbjct:   38 KKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQ---AYLHIPDIIKVAKENGVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDSPISSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPATHLDPQLRSRLTSDSVKLAKQVGYENAGTVEFLVDKHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVSEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQ-PDTGRIEVFRSGEGM-GIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGTVDTQFIDE-NPELF---QLRPAQ 494          

HSP 2 Score: 65.0846 bits (157), Expect = 3.395e-10
Identity = 32/77 (41.56%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 2005 PKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            PK + D    I APMPG V  + V  G +V+ GQ LCVL AMKM+  + +   G I+ VH     T+   D+I+E+E
Sbjct: 1102 PKALKDVKGQIGAPMPGKVIDIKVAAGDKVAKGQPLCVLSAMKMETVVTSPMEGTIRKVHVTKDMTLEGDDLILEIE 1178          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Mouse
Match: Pcx (pyruvate carboxylase [Source:MGI Symbol;Acc:MGI:97520])

HSP 1 Score: 379.793 bits (974), Expect = 3.599e-115
Identity = 200/466 (42.92%), Postives = 304/466 (65.24%), Query Frame = 1
Query:  190 KKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIG----PAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLL---LKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQ-EGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKE 1563
            KK+++ANRGEIA R+  +C   GI+ VAV+S+ D      Q ADEA  IG    P Q   +YL++  I+   K+ G +AVHPGYGFLSE   FA+  +D  V F+GP+ + +  MGDK+E++ IA AA V  +PG D  I+   EA + +N  G+P++ KA+ GGGG+GMR+  + +E  E Y  + +EA ++FG+  + +EK+I KPRHIE+QI+ D++GN L+L ER+CSIQRR+QKV+E AP+T ++P+ R  +   +V++AK VGY++AGTVEFLVD     YF+E+N+RLQVEH ++E IT VD+VH    V +G  L    L+Q +I +NG A++CRV  EDP +SF  P  GR+  ++    +  +R D+    +G+ IS +YD ++ K++ +G+D   A   M +AL  + +RGV  NIP L++++   +F++G + T ++ E  P+ F   QL P +
Sbjct:   38 KKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQ---AYLHIPDIIKVAKENGVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDSPISSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPATHLDPQLRSRLTSDSVKLAKQVGYENAGTVEFLVDKHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVSEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQ-PDTGRIEVFRSGEGM-GIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGTVDTQFIDE-NPELF---QLRPAQ 494          

HSP 2 Score: 65.0846 bits (157), Expect = 3.395e-10
Identity = 32/77 (41.56%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 2005 PKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            PK + D    I APMPG V  + V  G +V+ GQ LCVL AMKM+  + +   G I+ VH     T+   D+I+E+E
Sbjct: 1102 PKALKDVKGQIGAPMPGKVIDIKVAAGDKVAKGQPLCVLSAMKMETVVTSPMEGTIRKVHVTKDMTLEGDDLILEIE 1178          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Mouse
Match: Pcx (pyruvate carboxylase [Source:MGI Symbol;Acc:MGI:97520])

HSP 1 Score: 379.407 bits (973), Expect = 4.725e-115
Identity = 200/466 (42.92%), Postives = 304/466 (65.24%), Query Frame = 1
Query:  190 KKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIG----PAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLL---LKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQ-EGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKE 1563
            KK+++ANRGEIA R+  +C   GI+ VAV+S+ D      Q ADEA  IG    P Q   +YL++  I+   K+ G +AVHPGYGFLSE   FA+  +D  V F+GP+ + +  MGDK+E++ IA AA V  +PG D  I+   EA + +N  G+P++ KA+ GGGG+GMR+  + +E  E Y  + +EA ++FG+  + +EK+I KPRHIE+QI+ D++GN L+L ER+CSIQRR+QKV+E AP+T ++P+ R  +   +V++AK VGY++AGTVEFLVD     YF+E+N+RLQVEH ++E IT VD+VH    V +G  L    L+Q +I +NG A++CRV  EDP +SF  P  GR+  ++    +  +R D+    +G+ IS +YD ++ K++ +G+D   A   M +AL  + +RGV  NIP L++++   +F++G + T ++ E  P+ F   QL P +
Sbjct:   39 KKVMVANRGEIAIRVFRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLAPVQ---AYLHIPDIIKVAKENGVDAVHPGYGFLSERADFAQACQDAGVRFIGPSPEVVRKMGDKVEARAIAIAAGVPVVPGTDSPISSLHEAHEFSNTYGFPIIFKAAYGGGGRGMRVVHSYEELEENYTRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDQYGNILHLYERDCSIQRRHQKVVEIAPATHLDPQLRSRLTSDSVKLAKQVGYENAGTVEFLVDKHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQIHVSEGRSLPDLGLRQENIRINGCAIQCRVTTEDPARSFQ-PDTGRIEVFRSGEGM-GIRLDNASAFQGAVISPHYDSLLVKVIAHGKDHPTAATKMSRALAEFRVRGVKTNIPFLQNVLNNQQFLAGTVDTQFIDE-NPELF---QLRPAQ 495          

HSP 2 Score: 65.0846 bits (157), Expect = 3.544e-10
Identity = 32/77 (41.56%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 2005 PKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            PK + D    I APMPG V  + V  G +V+ GQ LCVL AMKM+  + +   G I+ VH     T+   D+I+E+E
Sbjct: 1103 PKALKDVKGQIGAPMPGKVIDIKVAAGDKVAKGQPLCVLSAMKMETVVTSPMEGTIRKVHVTKDMTLEGDDLILEIE 1179          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. UniProt/SwissProt
Match: sp|Q91ZA3|PCCA_MOUSE (Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Mus musculus OX=10090 GN=Pcca PE=1 SV=2)

HSP 1 Score: 842.803 bits (2176), Expect = 0.000e+0
Identity = 410/691 (59.33%), Postives = 531/691 (76.85%), Query Frame = 1
Query:  163 KHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            +++PKE  F KILIANRGEIACR+I +CK+ GIK VA+HSDVDA S  V+MADEA+C+GPA TS SYLNM+ I++A+K+T A+AVHPGYGFLSEN  FAK+L   +V F+GP++ AI +MGDKIESK +A  AKV+ IPG+DG + D DEA++IA +IGYPVMIKASAGGGGKGMRIAW+D+E  +G++ S  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPS F++PETR+AMGEQAV +AKAV Y SAGTVEFLVD ++NFYFLEMNTRLQVEHP++E ITG+D+V +M  V KG+PL  KQ DI ++GWAVECRVYAEDPYKSFGLPS+GRL+ Y+EP+HLP VR DSGIQ GS+ISIYYDPMI KLVTYG DR++AL  M  ALD+YVIRGVTHNIPLLR+++   RFV G+I+T +L +VYPDGFKG  LT  E   L A+++ VFV +++R + F +  R  +I       R D++   +W LS+   L  +D T    V    +   FTV  + G+   + + ++LA  +++ N+D  +  +Q +SR   G ++ Q++GT YK+ + + +  +L+KFML K   DTSS + +PMPG+V  VSVK G  V++GQE+CV+EAMKMQNSM A K G +K VH + G TV +GD+++ELE
Sbjct:   51 EYEPKEKTFDKILIANRGEIACRVIKTCKKMGIKTVAIHSDVDASSVHVKMADEAVCVGPAPTSKSYLNMDAIMEAIKKTRAQAVHPGYGFLSENKEFAKRLAAEDVTFIGPDTHAIQAMGDKIESKLLAKRAKVNTIPGFDGVVKDADEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRFSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVVEEAPSIFLDPETRQAMGEQAVALAKAVKYSSAGTVEFLVDSQKNFYFLEMNTRLQVEHPVTECITGLDLVQEMILVAKGYPLRHKQEDIPISGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPIHLPGVRVDSGIQPGSDISIYYDPMISKLVTYGSDRAEALKRMEDALDNYVIRGVTHNIPLLREVIINTRFVKGDISTKFLSDVYPDGFKGHTLTLSERNQLLAIASSVFVASQLRAQRFQEHSRVPVI-------RPDVA---KWELSVK--LHDEDHT----VVASNNGPAFTVEVD-GSKLNVTSTWNLASPLLSVNVDGTQRTVQCLSREAGGNMSIQFLGTVYKVHILTKLAAELNKFMLEKVPKDTSSTLCSPMPGVVVAVSVKPGDMVAEGQEICVIEAMKMQNSMTAGKMGKVKLVHCKAGDTVGEGDLLVELE 724          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. UniProt/SwissProt
Match: sp|P05165|PCCA_HUMAN (Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA PE=1 SV=4)

HSP 1 Score: 840.491 bits (2170), Expect = 0.000e+0
Identity = 407/690 (58.99%), Postives = 532/690 (77.10%), Query Frame = 1
Query:  166 HDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            +DP E  F KIL+ANRGEIACR+I +CK+ GIK VA+HSDVDA S  V+MADEA+C+GPA TS SYLNM+ I++A+K+T A+AVHPGYGFLSEN  FA+ L   +VVF+GP++ AI +MGDKIESK +A  A+V+ IPG+DG + D +EA++IA +IGYPVMIKASAGGGGKGMRIAW+D+E  +G++LS  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPS F++ ETR+AMGEQAV +A+AV Y SAGTVEFLVD K+NFYFLEMNTRLQVEHP++E ITG+D+V +M RV KG+PL  KQ+DI +NGWAVECRVYAEDPYKSFGLPS+GRL+ Y+EPLHLP VR DSGIQ GS+ISIYYDPMI KL+TYG DR++AL  M  ALD+YVIRGVTHNI LLR+++   RFV G+I+T +L +VYPDGFKG  LT  E   L A+++ +FV  ++R + F +  R  +I       + D+++   W LS+    +  DK   V  S   + S F+V  + G+   + + ++LA  +++ ++D  +  +Q +SR   G ++ Q++GT YK+ + + +  +L+KFML K   DTSSV+ +PMPG+V  VSVK G  V++GQE+CV+EAMKMQNSM A K G +K+VH Q G TV +GD+++ELE
Sbjct:   56 YDPNEKTFDKILVANRGEIACRVIRTCKKMGIKTVAIHSDVDASSVHVKMADEAVCVGPAPTSKSYLNMDAIMEAIKKTRAQAVHPGYGFLSENKEFARCLAAEDVVFIGPDTHAIQAMGDKIESKLLAKKAEVNTIPGFDGVVKDAEEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRLSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVVEEAPSIFLDAETRRAMGEQAVALARAVKYSSAGTVEFLVDSKKNFYFLEMNTRLQVEHPVTECITGLDLVQEMIRVAKGYPLRHKQADIRINGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPLHLPGVRVDSGIQPGSDISIYYDPMISKLITYGSDRTEALKRMADALDNYVIRGVTHNIALLREVIINSRFVKGDISTKFLSDVYPDGFKGHMLTKSEKNQLLAIASSLFVAFQLRAQHFQENSRMPVI-------KPDIAN---WELSV----KLHDKVHTVVAS--NNGSVFSVEVD-GSKLNVTSTWNLASPLLSVSVDGTQRTVQCLSREAGGNMSIQFLGTVYKVNILTRLAAELNKFMLEKVTEDTSSVLRSPMPGVVVAVSVKPGDAVAEGQEICVIEAMKMQNSMTAGKTGTVKSVHCQAGDTVGEGDLLVELE 728          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. UniProt/SwissProt
Match: sp|P14882|PCCA_RAT (Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Rattus norvegicus OX=10116 GN=Pcca PE=1 SV=3)

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 405/691 (58.61%), Postives = 528/691 (76.41%), Query Frame = 1
Query:  163 KHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            +++PKE  F KILIANRGEIACR+I +C++ GI+ VA+HSDVDA S  V+MADEA+C+GPA TS SYLNM+ I++A+K+TGA+AVHPGYGFLSEN  FAK L   +V F+GP++ AI +MGDKIESK +A  AKV+ IPG+DG + D DEA++IA +IGYPVMIKASAGGGGKGMRI W+D+E  +G++ S  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPS F++PETR+AMGEQAV   KAV Y SAGTVEFLVD ++NFYFLEMNTRLQVEHP++E ITG+D+V +M  V KG+PL  KQ DI ++GWAVECRVYAEDPYKSFGLPS+GRL+ Y+EP+HLP VR DSGIQ GS+ISIY+DPMI KLVTYG DR++AL  M  ALDSYVIRGVTHNIPLLR+++   RFV G+I+T +L +VYPDGFKG  LTP E   L A+++ +FV +++R + F +  R  +I       R D++   +W LS+   L  +D T    V    +   F V  + G+   + + ++LA  +++ N+D  +  +Q +S +  G ++ Q++GT YK+ + + +  +L+KFML K   DTSSV+ +P PG+V  VSVK G  V++GQE+CV+EAMKMQNSM A K G +K VH + G TV +GD+++ELE
Sbjct:   64 EYEPKEKTFDKILIANRGEIACRVIKTCRKMGIRTVAIHSDVDASSVHVKMADEAVCVGPAPTSKSYLNMDAIMEAIKKTGAQAVHPGYGFLSENKEFAKCLAAEDVTFIGPDTHAIQAMGDKIESKLLAKRAKVNTIPGFDGVLKDADEAVRIAREIGYPVMIKASAGGGGKGMRIPWDDEETRDGFRFSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVVEEAPSIFLDPETRRAMGEQAVAWPKAVKYSSAGTVEFLVDSQKNFYFLEMNTRLQVEHPVTECITGLDLVQEMILVAKGYPLRHKQEDIPISGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPIHLPGVRVDSGIQPGSDISIYHDPMISKLVTYGSDRAEALKRMEDALDSYVIRGVTHNIPLLREVIINTRFVKGDISTKFLSDVYPDGFKGHMLTPSERDQLLAIASSLFVASQLRAQRFQEHSRVPVI-------RPDVA---KWELSVK--LHDEDHT----VVASNNGPTFNVEVD-GSKLNVTSTWNLASPLLSVNVDGTQRTVQCLSPDAGGNMSIQFLGTVYKVHILTKLAAELNKFMLEKVPKDTSSVLRSPKPGVVVAVSVKPGDMVAEGQEICVIEAMKMQNSMTAGKMGKVKLVHCKAGDTVGEGDLLVELE 737          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. UniProt/SwissProt
Match: sp|P0DTA4|PCCA_PIG (Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Sus scrofa OX=9823 GN=PCCA PE=1 SV=1)

HSP 1 Score: 828.935 bits (2140), Expect = 0.000e+0
Identity = 404/697 (57.96%), Postives = 523/697 (75.04%), Query Frame = 1
Query:  166 HDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPE--EWHLSIS-----HGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            +D  E  F KILIANRGEIACR+I +CK+ GIK VAVHSDVDA S  V MADEA+C+GPA TS SYLNM+ I++AV+ T A+AVHPGYGFLSEN  FAK L    V+F+GP++ AI +MGDKIESK +A  AKV+ IPG+DG + D DEA++IA +IGYPVMIKASAGGGGKGMRIAW+D+E  +G++ S  EA SSFGDDR+LIEK+I+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPS F++ ETR+AMGEQAV +AKAV Y SAGTVEFLVD K+NFYFLEMNTRLQVEHP++E ITG+D+V +M RV KG+PL  +Q+DI +NGWAVECRVYAEDPYKSFGLPS+GRL+ Y+EP+HLP VR DSGIQ GS+ISIYYDPMI KL+TYG +R +AL  M  ALD+YVIRGVTHNI LLR+++   RFV G+I T +L +VYPDGFKG +LT  E   L A+++ +FV +++R + F          ++ E+ R  +  P+   W LSI      H + + +      V VD            G+   + + ++LA  +++ +ID  +  +Q +SR+  G ++ Q++GT YK+ + + +  +L+KFML K   DTSS++ +PMPG+V  VSVK G  V++GQE+CV+EAMKMQNSM A K G +K+VH + G TV +GD+++ELE
Sbjct:   56 YDSNEKTFDKILIANRGEIACRVIKTCKKMGIKTVAVHSDVDASSVHVTMADEAVCVGPAPTSKSYLNMDAIMEAVRTTRAQAVHPGYGFLSENKEFAKCLAAEGVIFIGPDTHAIQAMGDKIESKLLAKKAKVNTIPGFDGVVKDADEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRFSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLGDKHGNALWLNERECSIQRRNQKVVEEAPSIFLDSETRRAMGEQAVALAKAVNYSSAGTVEFLVDSKKNFYFLEMNTRLQVEHPVTECITGLDLVQEMIRVAKGYPLRHRQADIPINGWAVECRVYAEDPYKSFGLPSIGRLSQYQEPIHLPGVRVDSGIQPGSDISIYYDPMISKLITYGSNRMEALKRMENALDNYVIRGVTHNIALLREVIINSRFVEGDINTKFLSDVYPDGFKGHKLTEDERNQLLAIASSLFVASQLRAQRF----------QEPENSRVPIIKPQVANWELSIRLHDEVHTVTASNSGPTFSVEVD------------GSKLNVTSTWNLASPLLSVSIDGTQRTIQCLSRDAGGNMSIQFLGTVYKVHILTKLAAELNKFMLEKAAEDTSSILHSPMPGVVVAVSVKPGDLVAEGQEICVIEAMKMQNSMTAGKTGKVKSVHCKAGDTVGEGDLLVELE 730          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. UniProt/SwissProt
Match: sp|Q19842|PCCA_CAEEL (Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=pcca-1 PE=1 SV=1)

HSP 1 Score: 820.076 bits (2117), Expect = 0.000e+0
Identity = 412/702 (58.69%), Postives = 520/702 (74.07%), Query Frame = 1
Query:  139 ARNIYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFL--KKDRSLLIAEKSESFRGDLSHP-EEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
             + IY     D  E KF KILIANRGEIACR+I + +  GIK VAVHSDVD+ S  V+MADEA+C+G A T+ SYL  ++IL AV+ TGA+AVHPGYGFLSENT FA +LE     F+GPNSKAI  MGDKI SK+IA AA+V  IPGYDGEI D D  +K++  IGYPVMIKASAGGGGKGMR+AWNDK+A EGY+LS+ EA SSFGDDRML+EK+I+ PRHIE+Q++CDKHGNAL+LNERECSIQRRNQKVIEEAPS+F+ PE R+ MGEQAVQ+AKAVGYDSAGTVEFLVD +RNFYFLEMNTRLQVEHPI+E ITG+DIV QM RV  GHPL + Q  + +NGWA E RVYAEDPYK FGLPSVGRL+ Y EP H+  VRCDSGI+EGSEISIYYDP+ICKLVT+G++R +AL  M +ALD+YVIRGVTHNIPLLRDIV E RF +G+ITT YLPEVYP+GF+G  L+PKE  ++ A ++ +  +   R   FL   K RS  +A  S++++   S P +E      H +E +       V    +++   +    G +  I+ + +L+  + +  +D + I  Q++ +  +G IT  Y GT +K+KV      K  ++M  K  VD S+V+++PMPG +K V+VK G  VS+GQEL V+EAMKMQNS+ A K G +KAV+ + G TV +G++++ELE
Sbjct:   33 GKEIYTTVGIDYNEPKFDKILIANRGEIACRVIKTARAMGIKTVAVHSDVDSNSLHVKMADEAVCVGEAPTAKSYLRADRILQAVEDTGAQAVHPGYGFLSENTKFAAELEKAGAKFIGPNSKAILDMGDKIHSKKIATAARVSMIPGYDGEIADEDMCVKVSRDIGYPVMIKASAGGGGKGMRVAWNDKQAREGYRLSKQEAASSFGDDRMLVEKFIDNPRHIEMQVLCDKHGNALWLNERECSIQRRNQKVIEEAPSSFVPPEMRRKMGEQAVQLAKAVGYDSAGTVEFLVDSQRNFYFLEMNTRLQVEHPITECITGIDIVQQMLRVSYGHPLPITQEQVPLNGWAFESRVYAEDPYKGFGLPSVGRLSRYVEPKHVDGVRCDSGIREGSEISIYYDPLICKLVTHGDNREQALNRMQEALDNYVIRGVTHNIPLLRDIVQEKRFRTGDITTKYLPEVYPEGFQGTSLSPKEQDVVIAFASALNARKLARANQFLNQNKQRSTHVASFSKTYKFVSSLPVKEGERPTEHAVEVE------FVEGSANKAQVRIG---GKTVTISGDLNLSHPVNSIEVDGEHITTQIVGKR-AGEITVLYKGTPFKVKVLPEQAVKYLQYMKEKAKVDLSTVVLSPMPGAIKNVNVKPGDMVSEGQELVVMEAMKMQNSLHAGKTGRVKAVNVKVGATVDEGEVLVELE 724          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. TrEMBL
Match: A0A1I8GL11 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1039.25 bits (2686), Expect = 0.000e+0
Identity = 501/705 (71.06%), Postives = 587/705 (83.26%), Query Frame = 1
Query:  133 SAARN---IYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIA-EKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            SAAR    IYWNDKHD  E++F+KILIANRGEIACR+INSCKR GIK+VAVHS++DA S+FVQ+ADEA+CIGPA TS SYLNME IL AVKQTGA+AVHPGYGFLSENTVFAK+LED++VVFLGPNSKAI +MGDKIESKRIAN AKV+CIPG+DGE+ D DEA+KIAN IGYPVMIKASAGGGGKGMRIAWNDK+A EGY+LS+ EAKSSFGDDRMLIEK+I+KPRHIE+Q++CD+HGNALYLNERECSIQRRNQKVIEEAPS +I+P+TRKAMG QA  +AKAVGYDSAGTVEFLVD K+NFYFLEMNTRLQVEHPI+E ITGVDIVHQM RVGKGHPLLL Q DI V GWAVECRVYAEDPYK+FGLPS+GRLT+Y EP  L NVRCDSGIQEGSEISIYYDPMICKLVTYG+DR  AL TMV ALD+YVIRGVTHNIPLLRDIVTE RFVSG+ITTNYLPEVYPDGF+GKQ + ++   + A+SAVVF KN++RNKT+LKKDRS ++A E  +SF        +W +  S  L+ +D    +   V +    FTV FE   + +I +NF LA+K+I   I+ D + +Q+MSR++   +T QYMGTK    V +   + LSKFM  +   DTS+ I APMPGLVK+V V VGQ V++GQE+CVLEAMKMQNS+  A AG +KAVHF+ G+TV++ D+I+ELE
Sbjct: 1448 SAARQADAIYWNDKHDSNESRFEKILIANRGEIACRVINSCKRLGIKSVAVHSEIDASSKFVQLADEAVCIGPAPTSKSYLNMEAILQAVKQTGAQAVHPGYGFLSENTVFAKRLEDLDVVFLGPNSKAIRAMGDKIESKRIANKAKVNCIPGFDGEVKDADEAVKIANDIGYPVMIKASAGGGGKGMRIAWNDKQAREGYRLSQEEAKSSFGDDRMLIEKFIDKPRHIEVQVLCDRHGNALYLNERECSIQRRNQKVIEEAPSVYIDPDTRKAMGAQATALAKAVGYDSAGTVEFLVDSKKNFYFLEMNTRLQVEHPITECITGVDIVHQMIRVGKGHPLLLTQKDIGVKGWAVECRVYAEDPYKAFGLPSIGRLTTYSEPTALENVRCDSGIQEGSEISIYYDPMICKLVTYGKDRQSALNTMVNALDNYVIRGVTHNIPLLRDIVTENRFVSGDITTNYLPEVYPDGFRGKQFSDRDRLNIAAVSAVVFAKNDLRNKTYLKKDRSNIVAGEAKKSF--------DWDIVAS--LDGKD----LLCRVSYKEGGFTVAFEGSETLQIKDNFSLANKVIPAVINGDSVCMQMMSRSFDERVTLQYMGTKCTTIVRTARAYDLSKFMPVRSDKDTSTTIKAPMPGLVKSVGVTVGQTVAEGQEICVLEAMKMQNSLSCAIAGKVKAVHFKAGETVNEEDVIVELE 2138          

HSP 2 Score: 85.5001 bits (210), Expect = 5.124e-13
Identity = 43/75 (57.33%), Postives = 51/75 (68.00%), Query Frame = 1
Query:  133 SAARN---IYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHS-----------DVDALSRFVQM 315
            SAAR    IYWNDKHD  E++F+KILIANRGEIACR+INSCKR GIK+VAV +           DV   S+  Q+
Sbjct:  900 SAARQADAIYWNDKHDSNESRFEKILIANRGEIACRVINSCKRLGIKSVAVFTLKRMTDFLNQFDVSCRSKIAQL 974          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. TrEMBL
Match: A0A267H633 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032858g2 PE=4 SV=1)

HSP 1 Score: 1035.02 bits (2675), Expect = 0.000e+0
Identity = 501/705 (71.06%), Postives = 588/705 (83.40%), Query Frame = 1
Query:  133 SAARN---IYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIA-EKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            SAAR    IYWNDKHD  E++F+KILIANRGEIACR+INSCKR GIK+VAVHS++DA S+FVQ+ADEA+CIGPA TS SYLNME IL AVKQTGA+AVHPGYGFLSENTVFAK+LED++VVFLGPNSKAI +MGDKIESKRIAN AKV+CIPG+DGE+ D DEA+KIAN+IGYPVMIKASAGGGGKGMRIAWNDK+A EGY+LS+ EAKSSFGDDRMLIEK+I+KPRHIE+Q++CD+HGNALYLNERECSIQRRNQKVIEEAPS +I+P+TRKAMG QA  +AKAVGYDSAGTVEFLVD K+NFYFLEMNTRLQVEHPI+E ITGVDIVHQM RVGKGHPLLL Q DI V GWAVECRVYAEDPYK+FGLPS+GRLT+Y EP  L NVRCDSGIQEGSEISIYYDPMICKLVTYG+DR  AL TMV ALD+YVIRGVTHNIPLLRDIVTE RFVSGNITTNYLPEVYPDGF+GKQ + ++   + A+SAVVF KN++RNKT+LKKDRS ++A E  +SF        +W +  S  L+ +D    +   V +    FTV FE   + +I +NF LA+K+I   I+ D + +Q+MSR++   +T QYMGTK    V +   + LSKFM  +   DTS+ I APMPGLVK++ V VGQ V++GQE+CVLEAMKMQNS+  A AG +KAVHF+ G+TV++ D+I+ELE
Sbjct:   26 SAARQADAIYWNDKHDSNESRFEKILIANRGEIACRVINSCKRLGIKSVAVHSEIDASSKFVQLADEAVCIGPAPTSKSYLNMEAILQAVKQTGAQAVHPGYGFLSENTVFAKRLEDLDVVFLGPNSKAIRAMGDKIESKRIANKAKVNCIPGFDGEVKDADEAVKIANEIGYPVMIKASAGGGGKGMRIAWNDKQAREGYRLSQEEAKSSFGDDRMLIEKFIDKPRHIEVQVLCDRHGNALYLNERECSIQRRNQKVIEEAPSVYIDPDTRKAMGAQATALAKAVGYDSAGTVEFLVDSKKNFYFLEMNTRLQVEHPITECITGVDIVHQMIRVGKGHPLLLTQKDIGVKGWAVECRVYAEDPYKAFGLPSIGRLTTYSEPTALENVRCDSGIQEGSEISIYYDPMICKLVTYGKDRQSALNTMVNALDNYVIRGVTHNIPLLRDIVTENRFVSGNITTNYLPEVYPDGFRGKQFSDRDRLNIAAVSAVVFAKNDLRNKTYLKKDRSNIVAGEAKKSF--------DWDIVAS--LDGKD----LLCRVSYKEGGFTVAFEGSETLQIKDNFSLANKVIPAVINGDSVCMQMMSRSFDERVTLQYMGTKCTTIVRTARAYDLSKFMPVRSDKDTSTTIKAPMPGLVKSIGVTVGQTVAEGQEICVLEAMKMQNSLSCAIAGKVKAVHFKAGETVNEEDVIVELE 716          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. TrEMBL
Match: A0A267FX90 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032858g3 PE=4 SV=1)

HSP 1 Score: 1032.32 bits (2668), Expect = 0.000e+0
Identity = 501/705 (71.06%), Postives = 587/705 (83.26%), Query Frame = 1
Query:  133 SAARN---IYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIA-EKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            SAAR    IYWNDKHD  E++F+KILIANRGEIACR+INSCKR GIK+VAVHS++DA S+FVQ+ADEA+CIGPA TS SYLNME IL AVKQTGA+AVHPGYGFLSENTVFAK+LED++VVFLGPNSKAI +MGDKIESKRIAN AKV+CIPG+DGE+ D DEA+KIAN IGYPVMIKASAGGGGKGMRIAWNDK+A EGY+LS+ EAKSSFGDDRMLIEK+I+KPRHIE+Q++CD+HGNALYLNERECSIQRRNQKVIEEAPS +I+P+TRKAMG QA  +AKAVGYDSAGTVEFLVD K+NFYFLEMNTRLQVEHPI+E ITGVDIVHQM RVGKGHPLLL Q DI V GWAVECRVYAEDPYK+FGLPS+GRLT+Y EP  L NVRCDSGIQEGSEISIYYDPMICKLVTYG+DR  AL TMV ALD+YVIRGVTHNIPLLRDIVTE RFVSG+ITTNYLPEVYPDGF+GKQ + ++   + A+SAVVF KN++RNKT+LKKDRS ++A E  +SF        +W +  S  L+ +D    +   V +    FTV FE   + +I +NF LA+K+I   I+ D + +Q+MSR++   +T QYMGTK    V +   + LSKFM  +   DTS+ I APMPGLVK+V V VGQ V++GQE+CVLEAMKMQNS+  A AG +KAVHF+ G+TV++ D+I+ELE
Sbjct:   26 SAARQADAIYWNDKHDSNESRFEKILIANRGEIACRVINSCKRLGIKSVAVHSEIDASSKFVQLADEAVCIGPAPTSKSYLNMEAILQAVKQTGAQAVHPGYGFLSENTVFAKRLEDLDVVFLGPNSKAIRAMGDKIESKRIANKAKVNCIPGFDGEVKDADEAVKIANDIGYPVMIKASAGGGGKGMRIAWNDKQAREGYRLSQEEAKSSFGDDRMLIEKFIDKPRHIEVQVLCDRHGNALYLNERECSIQRRNQKVIEEAPSVYIDPDTRKAMGAQATALAKAVGYDSAGTVEFLVDSKKNFYFLEMNTRLQVEHPITECITGVDIVHQMIRVGKGHPLLLTQKDIGVKGWAVECRVYAEDPYKAFGLPSIGRLTTYSEPTALENVRCDSGIQEGSEISIYYDPMICKLVTYGKDRQSALNTMVNALDNYVIRGVTHNIPLLRDIVTENRFVSGDITTNYLPEVYPDGFRGKQFSDRDRLNIAAVSAVVFAKNDLRNKTYLKKDRSNIVAGEAKKSF--------DWDIVAS--LDGKD----LLCRVSYKEGGFTVAFEGSETLQIKDNFSLANKVIPAVINGDSVCMQMMSRSFDERVTLQYMGTKCTTIVRTARAYDLSKFMPVRSDKDTSTTIKAPMPGLVKSVGVTVGQTVAEGQEICVLEAMKMQNSLSCAIAGKVKAVHFKAGETVNEEDVIVELE 716          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. TrEMBL
Match: A0A1I8G7U7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 1028.85 bits (2659), Expect = 0.000e+0
Identity = 498/705 (70.64%), Postives = 587/705 (83.26%), Query Frame = 1
Query:  133 SAARN---IYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIA-EKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            SAAR    IYWNDKHD  E++F+KILIANRGEIACR+INSCKR GIK+VAVHS++DA S+FVQ+ADEA+CIGPA TS SYLNME IL AVKQTGA+AVHPGYGFLSENTVFAK+LED++VVFLGPNSKAI +MGDKIESKRIAN AKV+CIPG+DGE+ D DEA+KIAN IGYPVMIKASAGGGGKGMRIAWNDK+A EGY+LS+ EAKSSFGDDRMLIEK+I+KPRHIE+Q++CD+HGNALYLNERECSIQRRNQKVIEEAPS +I+P+TRKAMG QA  +AKAVGYDSAGTVEFLVD K+NFYFLEMNTRLQVEHPI+E ITGVDIVHQM RVGKGHPLLL Q DI V GWAVECRVYAEDPYK+FGLPS+GRLT+Y EP  L NVRCDSGIQEGSEISIYYDPMICKLVTYG+DR  AL TMV ALD+YVIRGVTHNIPLLRDIVTE RFVSG+ITTNYLPEVYPDGF+GKQ + ++   + A+SAVVF KN++RNKT+LKKDRS ++A E  +SF        +W +  S  L+ +D    +   V +    FTV FE   + +I +NF L+DK+I   I+ + + +Q+M+R++   +T QY+GTK    V +   + LSKFM  +   DTS+ I APMPGLVK+V V VGQ V++GQE+CVLEAMKMQNS+  A AG +KAVHF+ G+TV++ D+I+ELE
Sbjct:   23 SAARQAEAIYWNDKHDSNESRFEKILIANRGEIACRVINSCKRLGIKSVAVHSEIDASSKFVQLADEAVCIGPAPTSKSYLNMEAILQAVKQTGAQAVHPGYGFLSENTVFAKRLEDLDVVFLGPNSKAIRAMGDKIESKRIANKAKVNCIPGFDGEVKDADEAVKIANDIGYPVMIKASAGGGGKGMRIAWNDKQAREGYRLSQEEAKSSFGDDRMLIEKFIDKPRHIEVQVLCDRHGNALYLNERECSIQRRNQKVIEEAPSVYIDPDTRKAMGAQATALAKAVGYDSAGTVEFLVDSKKNFYFLEMNTRLQVEHPITECITGVDIVHQMIRVGKGHPLLLTQKDIGVKGWAVECRVYAEDPYKAFGLPSIGRLTTYSEPTALENVRCDSGIQEGSEISIYYDPMICKLVTYGKDRQSALNTMVNALDNYVIRGVTHNIPLLRDIVTENRFVSGDITTNYLPEVYPDGFRGKQFSDRDRLNIAAVSAVVFAKNDLRNKTYLKKDRSNIVAGEAKKSF--------DWDIVAS--LDGKD----LLCRVSYKEGGFTVAFEGSETLQIKDNFSLSDKVIPAVINGESVCMQMMARSFDERVTLQYLGTKCTTIVRTARAYDLSKFMPVRSDKDTSTTIKAPMPGLVKSVGVTVGQTVAEGQEICVLEAMKMQNSLSCAIAGKVKAVHFKAGETVNEEDVIVELE 713          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. TrEMBL
Match: A0A267F535 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig032858g1 PE=4 SV=1)

HSP 1 Score: 1028.85 bits (2659), Expect = 0.000e+0
Identity = 498/705 (70.64%), Postives = 587/705 (83.26%), Query Frame = 1
Query:  133 SAARN---IYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIA-EKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            SAAR    IYWNDKHD  E++F+KILIANRGEIACR+INSCKR GIK+VAVHS++DA S+FVQ+ADEA+CIGPA TS SYLNME IL AVKQTGA+AVHPGYGFLSENTVFAK+LED++VVFLGPNSKAI +MGDKIESKRIAN AKV+CIPG+DGE+ D DEA+KIAN IGYPVMIKASAGGGGKGMRIAWNDK+A EGY+LS+ EAKSSFGDDRMLIEK+I+KPRHIE+Q++CD+HGNALYLNERECSIQRRNQKVIEEAPS +I+P+TRKAMG QA  +AKAVGYDSAGTVEFLVD K+NFYFLEMNTRLQVEHPI+E ITGVDIVHQM RVGKGHPLLL Q DI V GWAVECRVYAEDPYK+FGLPS+GRLT+Y EP  L NVRCDSGIQEGSEISIYYDPMICKLVTYG+DR  AL TMV ALD+YVIRGVTHNIPLLRDIVTE RFVSG+ITTNYLPEVYPDGF+GKQ + ++   + A+SAVVF KN++RNKT+LKKDRS ++A E  +SF        +W +  S  L+ +D    +   V +    FTV FE   + +I +NF L+DK+I   I+ + + +Q+M+R++   +T QY+GTK    V +   + LSKFM  +   DTS+ I APMPGLVK+V V VGQ V++GQE+CVLEAMKMQNS+  A AG +KAVHF+ G+TV++ D+I+ELE
Sbjct:   27 SAARQAEAIYWNDKHDSNESRFEKILIANRGEIACRVINSCKRLGIKSVAVHSEIDASSKFVQLADEAVCIGPAPTSKSYLNMEAILQAVKQTGAQAVHPGYGFLSENTVFAKRLEDLDVVFLGPNSKAIRAMGDKIESKRIANKAKVNCIPGFDGEVKDADEAVKIANDIGYPVMIKASAGGGGKGMRIAWNDKQAREGYRLSQEEAKSSFGDDRMLIEKFIDKPRHIEVQVLCDRHGNALYLNERECSIQRRNQKVIEEAPSVYIDPDTRKAMGAQATALAKAVGYDSAGTVEFLVDSKKNFYFLEMNTRLQVEHPITECITGVDIVHQMIRVGKGHPLLLTQKDIGVKGWAVECRVYAEDPYKAFGLPSIGRLTTYSEPTALENVRCDSGIQEGSEISIYYDPMICKLVTYGKDRQSALNTMVNALDNYVIRGVTHNIPLLRDIVTENRFVSGDITTNYLPEVYPDGFRGKQFSDRDRLNIAAVSAVVFAKNDLRNKTYLKKDRSNIVAGEAKKSF--------DWDIVAS--LDGKD----LLCRVSYKEGGFTVAFEGSETLQIKDNFSLSDKVIPAVINGESVCMQMMARSFDERVTLQYLGTKCTTIVRTARAYDLSKFMPVRSDKDTSTTIKAPMPGLVKSVGVTVGQTVAEGQEICVLEAMKMQNSLSCAIAGKVKAVHFKAGETVNEEDVIVELE 717          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Cavefish
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:ZFIN;Acc:ZDB-GENE-040718-246])

HSP 1 Score: 812.757 bits (2098), Expect = 0.000e+0
Identity = 409/695 (58.85%), Postives = 518/695 (74.53%), Query Frame = 1
Query:  154 WNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVH-VSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            ++  +DP E  F KILIANRGEIACR+I +CK+ GIK VAVHSDVD+ +  V+MADEA C+GPA TS SYLNM+ I++A++QTGA+AVHPGYGFLSEN  FA++L    V F+GP++ AI +MGDKIESK IA AAKV+ IPG+DG + + +EA+KIA +IGYPVMIKASAGGGGKGMRIAWND+E  EG++ S  EA SSFGDDR+LIEKYI+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPSTF++P TR+AMGEQAV +AKAV Y SAGTVEFLVD K+NFYFLEMNTRLQVEHPI+E ITG+D+V QM RV KG+ L  KQ DI +NGWA+E RVYAEDPYKSFGLPS+GRL+ Y+EPL+LP VR DSGIQEGS+ISIYYDPMI KLVTYG  R++AL  M  ALD+YVIRGVTHNIPLLR+I+  PRF+SG+I+TN+LPEVYP+GFKG  L   E   L A +A + V  ++R++ FL + R   + ++  +          W L +       +  + VH + V    + +TV  + G    ++  ++LA  ++   I+                IT QY+GT +K++V S +   L+K M  K   DTSS++ +PMPG V  VSVK G  V++GQE+CV+EAMKMQNSM AAK   +K+VH   G+TV +GD+++ELE
Sbjct:   35 YSTVYDPHEKTFDKILIANRGEIACRVIKTCKKMGIKTVAVHSDVDSSAVHVKMADEAFCVGPAPTSKSYLNMDAIMEAIRQTGAQAVHPGYGFLSENKEFARRLAADGVSFIGPDTHAIQAMGDKIESKLIAKAAKVNTIPGFDGVVKNAEEAVKIAGEIGYPVMIKASAGGGGKGMRIAWNDEETREGFRFSSQEAASSFGDDRLLIEKYIDNPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPVTRRAMGEQAVSLAKAVKYSSAGTVEFLVDSKKNFYFLEMNTRLQVEHPITECITGLDLVQQMIRVAKGYKLQHKQEDIPINGWAIESRVYAEDPYKSFGLPSIGRLSQYEEPLNLPGVRVDSGIQEGSDISIYYDPMISKLVTYGSTRAEALKKMEDALDNYVIRGVTHNIPLLREIIVHPRFISGDISTNFLPEVYPEGFKGHPLAAGEQRELLAAAAALHVAAQLRSQRFLGQQRVSSVPQERRN----------WELCV-------ELDKRVHMLGVSRSGNSYTVEID-GEKVVVSGEWNLASALLPLTINE---------------ITLQYLGTSFKVRVLSKLAASLNKLMPEKIPEDTSSILRSPMPGTVVAVSVKPGDTVAEGQEICVIEAMKMQNSMTAAKTAKVKSVHCTAGETVGEGDLLVELE 696          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Cavefish
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:ZFIN;Acc:ZDB-GENE-040718-246])

HSP 1 Score: 778.859 bits (2010), Expect = 0.000e+0
Identity = 395/680 (58.09%), Postives = 505/680 (74.26%), Query Frame = 1
Query:  202 IANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVH-VSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVV-DTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            IANRGEIACR+I +CK+ GIK VAVHSDVD+ +  V+MADEA C+GPA TS SYLNM+ I++A++QTGA+AVHPGYGFLSEN  FA++L    V F+GP++ AI +MGDKIESK IA AAKV+ IPG+DG + + +EA+KIA +IGYPVMIKASAGGGGKGMRIAWND+E  EG++ S  EA SSFGDDR+LIEKYI+ PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPSTF++P TR+AMGEQAV +AKAV Y SAGTVEFLVD K+NFYFLEMNTRLQVEHPI+E ITG+D+V QM RV KG+ L  KQ DI +NGWA+E RVYAEDPYKSFGLPS+GRL+ Y+EPL+LP VR DSGIQEGS+ISIYYDPMI KLVTYG  R++AL  M  ALD+YVIRGVTHNIPLLR+I+  PRF+SG+I+TN+LPEVYP+GFKG  L   E   L A +A + V  ++R++ FL + R   + ++  +          W L +       +  + VH + V    + +TV  + G    ++  ++LA  ++   I+   I+L +  +  +  +  +   +  KL              +P+K+  DTSS++ +PMPG V  VSVK G  V++GQE+CV+EAMKMQNSM AAK   +K+VH   G+TV +GD+++ELE
Sbjct:    1 IANRGEIACRVIKTCKKMGIKTVAVHSDVDSSAVHVKMADEAFCVGPAPTSKSYLNMDAIMEAIRQTGAQAVHPGYGFLSENKEFARRLAADGVSFIGPDTHAIQAMGDKIESKLIAKAAKVNTIPGFDGVVKNAEEAVKIAGEIGYPVMIKASAGGGGKGMRIAWNDEETREGFRFSSQEAASSFGDDRLLIEKYIDNPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPVTRRAMGEQAVSLAKAVKYSSAGTVEFLVDSKKNFYFLEMNTRLQVEHPITECITGLDLVQQMIRVAKGYKLQHKQEDIPINGWAIESRVYAEDPYKSFGLPSIGRLSQYEEPLNLPGVRVDSGIQEGSDISIYYDPMISKLVTYGSTRAEALKKMEDALDNYVIRGVTHNIPLLREIIVHPRFISGDISTNFLPEVYPEGFKGHPLAAGEQRELLAAAAALHVAAQLRSQRFLGQQRVSSVPQERRN----------WELCV-------ELDKRVHMLGVSRSGNSYTVEID-GEKVVVSGEWNLASALLPLTINGVPILLSIQCKTQNLLLLSKLAASLNKL--------------MPEKIPEDTSSILRSPMPGTVVAVSVKPGDTVAEGQEICVIEAMKMQNSMTAAKTAKVKSVHCTAGETVGEGDLLVELE 648          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Cavefish
Match: mccc1 (methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gene;Acc:103043051])

HSP 1 Score: 468.774 bits (1205), Expect = 8.257e-154
Identity = 228/446 (51.12%), Postives = 305/446 (68.39%), Query Frame = 1
Query:  181 TKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPE 1518
             + +K+LIANRGEIACR++ + K+ G+++VAV+SD D  S  V MADEA  IG AQ+  SYL MEK+L+  K++ A+AVHPGYGFLSENT FA+  +   ++F+GP S AI  MG K  SK I +AA V  I GY GE     +    A +IGYPVMIKA  GGGGKGMRIA ++ E  E  + +R EA+ SF DD ML+EK++  PRH+E+Q+  D+HGNA+YL ER+CS+QRR+QK+IEEAP   I+PE R+ +GE AV+ AKAV Y  AGTVEF++D + NFYF+EMNTRLQVEHP+SE+ITG D+V    RV  G  + L Q DI + G + E R+YAEDP   F +P  G L     P    + R ++G+++G E+S +YDPMI KLV +GEDR  AL  +   L  Y I G+  NI  L ++   P F +GN+ T+++P+
Sbjct:   33 ARIEKVLIANRGEIACRVMRTAKKMGVRSVAVYSDADRHSMHVAMADEAYHIGAAQSQQSYLCMEKVLEVAKKSSAQAVHPGYGFLSENTEFAELCKQEGIIFIGPPSSAIRDMGIKSTSKHIMSAAGVPIIEGYHGEDQSDKKLQAEAARIGYPVMIKAVRGGGGKGMRIAHSEAEFHEQLESARREARKSFNDDVMLVEKFVENPRHVEVQVFGDQHGNAVYLFERDCSVQRRHQKIIEEAPGPGISPEVRRKLGEAAVRAAKAVNYVGAGTVEFIMDSQHNFYFMEMNTRLQVEHPVSEMITGTDLVEWQLRVAAGEKIPLSQEDIVLRGHSFEARIYAEDPNNDF-MPGAGHLQHLSNPQADEHTRIETGVRDGDEVSAHYDPMIAKLVVWGEDRPAALKKLRYCLRQYNIVGLNTNIDFLLNLSGHPEFEAGNVHTSFIPQ 477          

HSP 2 Score: 52.7582 bits (125), Expect = 1.445e-6
Identity = 29/74 (39.19%), Postives = 40/74 (54.05%), Query Frame = 1
Query: 1987 LSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVS 2208
            L KF+            +APM G ++ + VK G  V  G  L V+ AMKM++++ A KAGVIK V F+ G   S
Sbjct:  619 LPKFLAGVGTTGAQGGAVAPMSGTIEKIFVKAGDTVQKGDPLVVMIAMKMEHTIRAPKAGVIKKVLFREGSQAS 692          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Cavefish
Match: pcxb (pyruvate carboxylase b [Source:ZFIN;Acc:ZDB-GENE-000831-1])

HSP 1 Score: 349.747 bits (896), Expect = 8.603e-105
Identity = 188/448 (41.96%), Postives = 285/448 (63.62%), Query Frame = 1
Query:  190 KKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLS-YLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLL---LKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQ-EGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPE 1518
            KK+++ANR    C  + +C   GI+ VAV+S+ D      Q ADEA  IG     ++ YL++  I+   K+   +A+HPGYGFLSE + FA+  ED  V F+GP+   +  MGDK+E++ +A  A V  +PG D  I    EA + A   G+P++ KA+ GGGG+GMR+    +E  E Y+ + +EA ++FG+  + +EK+I KPRHIE+QI+ DK+GN ++L ER+CSIQRR+QKV+E AP+  ++P  R  +   +V +AK VGY++AGTVEFLVD     YF+E+N+RLQVEH ++E IT VD+VH   RV +G  L    LKQ  I +NG A++CRV  EDP + F  P  GRL  ++    +  +R DS    +G+ IS +YD ++ K+++ G+D   A + M++AL  + IRGV  NIP L+++++  +F+   + T ++ E
Sbjct:   40 KKVMVANRDCNPC--VRACTELGIRTVAVYSEQDTGQMHRQKADEAYLIGKGLPPVAAYLHIPDIIKVAKENNVDAIHPGYGFLSERSDFAQACEDAGVRFVGPSPDVVRKMGDKVEARALAIQAGVPVVPGTDAPITSQQEAHEFAKTYGFPIIFKAAYGGGGRGMRVVREYEELEENYQRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDKYGNVIHLYERDCSIQRRHQKVVEIAPAAQLDPHLRDRLTSDSVTLAKQVGYENAGTVEFLVDKHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQLRVCEGRSLPELGLKQDKIRINGCAIQCRVTTEDPARGFQ-PDTGRLEVFRSAEGM-GIRLDSASAFQGAVISPHYDSLLVKVISSGKDLPTAASKMLRALAEFRIRGVKTNIPFLQNVLSNNQFLHSTVDTQFIDE 483          

HSP 2 Score: 61.2326 bits (147), Expect = 3.939e-9
Identity = 35/103 (33.98%), Postives = 55/103 (53.40%), Query Frame = 1
Query: 1924 ITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIEL 2232
            + F+  G    + V+  +  K   F  PK + D    + APMPG V  V VK GQ+V  GQ LCVL AMKM+  + +  +G +  V+ +   ++   D+I+E+
Sbjct:  993 VFFELNGQLRSVLVKDTVAMKEMHFH-PKALKDVRGQVGAPMPGKVVEVKVKQGQKVEKGQPLCVLSAMKMETVVNSPLSGTVAKVYVKTDTSLEGDDLILEI 1094          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Cavefish
Match: pcxb (pyruvate carboxylase b [Source:ZFIN;Acc:ZDB-GENE-000831-1])

HSP 1 Score: 326.25 bits (835), Expect = 3.764e-96
Identity = 174/408 (42.65%), Postives = 263/408 (64.46%), Query Frame = 1
Query:  310 QMADEAICIGPAQTSLS-YLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLL---LKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQ-EGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPE 1518
            Q ADEA  IG     ++ YL++  I+   K+   +A+HPGYGFLSE + FA+  ED  V F+GP+   +  MGDK+E++ +A  A V  +PG D  I    EA + A   G+P++ KA+ GGGG+GMR+    +E  E Y+ + +EA ++FG+  + +EK+I KPRHIE+QI+ DK+GN ++L ER+CSIQRR+QKV+E AP+  ++P  R  +   +V +AK VGY++AGTVEFLVD     YF+E+N+RLQVEH ++E IT VD+VH   RV +G  L    LKQ  I +NG A++CRV  EDP + F  P  GRL  ++    +  +R DS    +G+ IS +YD ++ K+++ G+D   A + M++AL  + IRGV  NIP L+++++  +F+   + T ++ E
Sbjct:    4 QKADEAYLIGKGLPPVAAYLHIPDIIKVAKENNVDAIHPGYGFLSERSDFAQACEDAGVRFVGPSPDVVRKMGDKVEARALAIQAGVPVVPGTDAPITSQQEAHEFAKTYGFPIIFKAAYGGGGRGMRVVREYEELEENYQRAYSEALAAFGNGALFVEKFIEKPRHIEVQILGDKYGNVIHLYERDCSIQRRHQKVVEIAPAAQLDPHLRDRLTSDSVTLAKQVGYENAGTVEFLVDKHGKHYFIEVNSRLQVEHTVTEEITDVDLVHAQLRVCEGRSLPELGLKQDKIRINGCAIQCRVTTEDPARGFQ-PDTGRLEVFRSAEGM-GIRLDSASAFQGAVISPHYDSLLVKVISSGKDLPTAASKMLRALAEFRIRGVKTNIPFLQNVLSNNQFLHSTVDTQFIDE 409          

HSP 2 Score: 61.2326 bits (147), Expect = 3.882e-9
Identity = 35/103 (33.98%), Postives = 55/103 (53.40%), Query Frame = 1
Query: 1924 ITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIEL 2232
            + F+  G    + V+  +  K   F  PK + D    + APMPG V  V VK GQ+V  GQ LCVL AMKM+  + +  +G +  V+ +   ++   D+I+E+
Sbjct: 1002 VFFELNGQLRSVLVKDTVAMKEMHFH-PKALKDVRGQVGAPMPGKVVEVKVKQGQKVEKGQPLCVLSAMKMETVVNSPLSGTVAKVYVKTDTSLEGDDLILEI 1103          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Sea Lamprey
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:ZFIN;Acc:ZDB-GENE-040718-246])

HSP 1 Score: 501.901 bits (1291), Expect = 1.357e-172
Identity = 240/355 (67.61%), Postives = 290/355 (81.69%), Query Frame = 1
Query:  154 WNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEA---VEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAE 1209
            +   HDP E  F KILIANRGEIACR+I +CK+ GI  VAVHSDVDA +  V+MADEA C+GPA T+ SYLNM  ILDAVK +GA+AVHPGYGFLSEN  FAK+L    V F+GP++ A+ +MGDKIESK IA  A V+ IPG+DG + +T +A+KIA +IGYPVMIKASAGGGGKGMRIAWND+E     EG++ S  EA SSFGDDR+LIEK+I+ PRHIEIQ++ D+HGNAL+LNERECS+QRRNQKV+EEAPS F++ +TR+AMGEQAV +A+AV Y SAGTVEFLVD +RNFYFLEMNTRLQVEHPI+E ITG+D+V +M RV  GH L L QS++ + GWA+ECRVYAE
Sbjct:    3 YTATHDPSEKTFDKILIANRGEIACRVIKTCKKMGITTVAVHSDVDANAVHVKMADEAFCVGPAPTAQSYLNMAAILDAVKTSGAQAVHPGYGFLSENKEFAKQLAAEGVKFIGPDTHALQAMGDKIESKLIAKTAGVNTIPGFDGVVKNTKDAVKIAREIGYPVMIKASAGGGGKGMRIAWNDEETNVRREGFRFSSQEAASSFGDDRLLIEKFIDNPRHIEIQVLADEHGNALWLNERECSVQRRNQKVVEEAPSMFLDTQTRRAMGEQAVALARAVRYSSAGTVEFLVDSQRNFYFLEMNTRLQVEHPITECITGLDLVMEMIRVAAGHRLRLSQSEVPIRGWAIECRVYAE 357          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006351.1 (pep scaffold:Pmarinus_7.0:GL476470:805693:813506:1 gene:ENSPMAG00000005733.1 transcript:ENSPMAT00000006351.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 293.893 bits (751), Expect = 3.144e-92
Identity = 156/363 (42.98%), Postives = 232/363 (63.91%), Query Frame = 1
Query:  196 ILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLS-YLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLL---LKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPL 1272
            + I   GEIA R+  +C   GI+ VAV+S+ D      Q ADEA  IG     ++ YL++  I+   ++   +A+HPGYGFLSE + FA+   D ++ F+GP+ + +  MGDK+E++ IA +A V  +PG +  +    EA       G+P++ KA+ GGGG+GMR+  + +E  E ++ + +EA ++FG+  + IEKYI KPRHIE+QI+ DK+GN ++L ER+CSIQRR+QKV+E AP   ++P  R+ +   AV++AK VGY++AGTVEFL+D     YF+E+N+RLQVEH ++E ITGVD+VH    + +G  L    L Q  I +NG A++CRV  EDP + F  P  GR+     P 
Sbjct:    1 VCIVALGEIATRVFRACTELGIRTVAVYSEQDNGQVHRQKADEAYLIGKGLAPVAAYLHIPDIIRVAQENAVDAIHPGYGFLSERSDFAQACLDADIRFIGPSPEVVRQMGDKVEARAIAISAGVPVVPGTEEPVVSLVEARHFCETYGFPIIFKAAFGGGGRGMRVVRSYEELEESFQRAYSEALAAFGNGSLFIEKYIEKPRHIEVQILGDKYGNVVHLYERDCSIQRRHQKVVEIAPGANLDPSMREHLTNDAVKLAKQVGYENAGTVEFLLDKSGRHYFIEVNSRLQVEHTVTEQITGVDLVHSQIHIAEGRSLPSLGLHQDTIRINGCAIQCRVTTEDPARGFQ-PDTGRIEXKVAPF 362          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006346.1 (pep scaffold:Pmarinus_7.0:GL476470:805110:813016:1 gene:ENSPMAG00000005733.1 transcript:ENSPMAT00000006346.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 293.508 bits (750), Expect = 1.394e-91
Identity = 155/356 (43.54%), Postives = 231/356 (64.89%), Query Frame = 1
Query:  196 ILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLS-YLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLL---LKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRL 1251
            + I   GEIA R+  +C   GI+ VAV+S+ D      Q ADEA  IG     ++ YL++  I+   ++   +A+HPGYGFLSE + FA+   D ++ F+GP+ + +  MGDK+E++ IA +A V  +PG +  +    EA       G+P++ KA+ GGGG+GMR+  + +E  E ++ + +EA ++FG+  + IEKYI KPRHIE+QI+ DK+GN ++L ER+CSIQRR+QKV+E AP   ++P  R+ +   AV++AK VGY++AGTVEFL+D     YF+E+N+RLQVEH ++E ITGVD+VH    + +G  L    L Q  I +NG A++CRV  EDP + F  P  GR+
Sbjct:   40 VCIVALGEIATRVFRACTELGIRTVAVYSEQDNGQVHRQKADEAYLIGKGLAPVAAYLHIPDIIRVAQENAVDAIHPGYGFLSERSDFAQACLDADIRFIGPSPEVVRQMGDKVEARAIAISAGVPVVPGTEEPVVSLVEARHFCETYGFPIIFKAAFGGGGRGMRVVRSYEELEESFQRAYSEALAAFGNGSLFIEKYIEKPRHIEVQILGDKYGNVVHLYERDCSIQRRHQKVVEIAPGANLDPSMREHLTNDAVKLAKQVGYENAGTVEFLLDKSGRHYFIEVNSRLQVEHTVTEQITGVDLVHSQIHIAEGRSLPSLGLHQDTIRINGCAIQCRVTTEDPARGFQ-PDTGRI 394          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001516.1 (pep scaffold:Pmarinus_7.0:GL477673:133580:241371:-1 gene:ENSPMAG00000001304.1 transcript:ENSPMAT00000001516.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 234.187 bits (596), Expect = 3.629e-64
Identity = 213/755 (28.21%), Postives = 356/755 (47.15%), Query Frame = 1
Query:  190 KKILIANRGEIACRIINSCKRFGIK-----------AVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFL--GPNSKAIHSMGDKIESKRIANAAKVHCIP--GYD------------------------GEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISV-----------------------NGWAVECRVYAEDPYKSFGLPSVG-----RLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRG-VTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHG--LESQDKTQNVHVSVDFDRSHFT--VNFESGNSFRIA-NNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            +K+LIAN G  A + + S +R+  +            +    D+ A + +++MAD  + +     + +Y N+E ILD  ++   +AV  G+G  SEN    + L   ++ F+  GP S+A+ S+GDKI S  +A  A +  +P  G+                         G +ND +E +K A  IG+PVMIKAS GGGGKG+R + N +E    ++  +AE   S     + + K  N  RH+E+QI+ D +GNA+ L  R+CSIQRR+QK+IEEAP+T  +    + M + AV++AK VGY SAGTVE+L     +F+FLE+N RLQVEHP +E++  V++     ++  G P L +  DI +                        G  +  R+ +E+P + F  PS G        S K      +V    G+ E      + D       ++GE+R +A++ MV AL    IRG     +  L  ++    F    I T +L  +  +                       V+ E  N T      +L +A+   SFR  +S+   +  S+  G  L +   T +V+V + ++   +T  V  +S +++ +  NN H+  ++    + +  ++L     +++ Y+  +    +Y+L     IG+K   F    +  +  S++ AP  G +    V+ G  V  GQ    +E MKM  SMV  ++G +  V  +PG  +  G ++ +L+
Sbjct:   44 EKVLIANNGIAAVKCMRSIRRWAYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGANNNNYANVELILDIARRIPVQAVWAGWGHASENPKLPELLHKNDIAFMGIGPPSQAMWSLGDKIASSIVAQTANIPTLPWSGFGTFQSWNEADRKGKVINVPPEIYERGCVNDAEEGLKAAQTIGFPVMIKASEGGGGKGIRKSTNAEEFANLFRQVQAEVPGS----PVFVMKLANHARHLEVQILADAYGNAISLFGRDCSIQRRHQKIIEEAPATVAHAHVFQQMEQCAVRLAKMVGYVSAGTVEYLYSQDGSFHFLELNPRLQVEHPCTEMVADVNLPAAQLQISMGIP-LYRIKDIRILYGEPPWGDAPIDFEIPPRTPSPRGHVIAARITSENPDEGFK-PSAGTVQELNFRSNKNVWGYFSVAAAGGLHE------FADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFHENTIDTGWLDRLISEK----------------------VQAERPNTTLGIVSGALHVADG--SFRSSMSN---FLHSLERGQVLPAHTLTNSVNVELIYEGMKYTLKVTRQSPSTYVVTMNNSHM--EVDVHRMSDGGLLLSYDGSSHTTYMKEEV--DRYRLT----IGNKTCVF----EKENDPSILRAPSAGKLIQYMVEDGGHVFVGQCYAEIEVMKMVMSMVVNESGCVHYVK-RPGAVLEPGCVVAKLQ 746          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006397.1 (pep scaffold:Pmarinus_7.0:GL476470:932002:942971:-1 gene:ENSPMAG00000005777.1 transcript:ENSPMAT00000006397.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.3142 bits (155), Expect = 6.684e-11
Identity = 33/77 (42.86%), Postives = 44/77 (57.14%), Query Frame = 1
Query: 2005 PKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            PK +      + APMPG V  + VK GQ+V  GQ LCVL AMKM+  + A   G I  +H QP   +   D+I+E+E
Sbjct:  499 PKALKSVKGQVGAPMPGSVIEIKVKEGQQVEKGQPLCVLSAMKMETVVNAPMTGKIIKLHVQPSMHLEGDDLILEIE 575          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Yeast
Match: DUR1,2 (Urea amidolyase; contains both urea carboxylase and allophanate hydrolase activities, degrades urea to CO2 and NH3; expression sensitive to nitrogen catabolite repression and induced by allophanate, an intermediate in allantoin degradation; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000000412])

HSP 1 Score: 353.599 bits (906), Expect = 1.747e-104
Identity = 182/443 (41.08%), Postives = 281/443 (63.43%), Query Frame = 1
Query:  187 FKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRN-FYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYL 1512
            F  +LIANRGEIA RII + K+ GI++VAV+SD D  S+ V  AD ++ +     + +YL+M KI+DA KQT A+A+ PGYGFLSEN  F+       + F+GP+   I  +G K  +++IA  A V  +PG    I   +EA K+A ++ YPVM+K++AGGGG G++   ++++    ++  + + ++ FGD  + +E++I   RH+E+Q+M D  G A+ L ER+CS+QRRNQKVIEE P+  +  +TR A+ + A  +   + Y  AGTVEF+ D+K++ FYFLE+NTRLQVEHPI+E++TG+D+V  M R+          + + VNG ++E R+YAE+P K+F  PS G L   K P      R D+ +++G+ IS  YDP + K++ +G+DR  A++ + +AL+   + G   NI  L+ I+T   F    ++TN L
Sbjct:  633 FDTVLIANRGEIAVRIIKTLKKLGIRSVAVYSDPDKYSQHVTDADVSVPLHGTTAAQTYLDMNKIIDAAKQTNAQAIIPGYGFLSENADFSDACTSAGITFVGPSGDIIRGLGLKHSARQIAQKAGVPLVPG-SLLITSVEEAKKVAAELEYPVMVKSTAGGGGIGLQKVDSEEDIEHIFETVKHQGETFFGDAGVFLERFIENARHVEVQLMGDGFGKAIALGERDCSLQRRNQKVIEETPAPNLPEKTRLALRKAAESLGSLLNYKCAGTVEFIYDEKKDEFYFLEVNTRLQVEHPITEMVTGLDLVEWMIRIAANDAPDFDSTKVEVNGVSMEARLYAENPLKNF-RPSPGLLVDVKFPDW---ARVDTWVKKGTNISPEYDPTLAKIIVHGKDRDDAISKLNQALEETKVYGCITNIDYLKSIITSDFFAKAKVSTNIL 1070          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Yeast
Match: PYC2 (Pyruvate carboxylase isoform; cytoplasmic enzyme that converts pyruvate to oxaloacetate; differentially regulated than isoform Pyc1p; mutations in the human homolog are associated with lactic acidosis; PYC2 has a paralog, PYC1, that arose from the whole genome duplication [Source:SGD;Acc:S000000422])

HSP 1 Score: 334.724 bits (857), Expect = 1.100e-99
Identity = 189/492 (38.41%), Postives = 291/492 (59.15%), Query Frame = 1
Query:  193 KILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSL---SYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLL---LKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSG-IQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRS 1647
            KIL+ANRGEI  RI  S     ++ +A++S  D LS     ADEA  IG         +YL M++I++  K+   + +HPGYGFLSEN+ FA K+    + ++GP ++ I S+GDK+ ++ +A  A V  +PG  G I    EA+   N+ GYPV+IKA+ GGGG+GMR+     +  + ++ + +EA+++FG+    +E++++KP+HIE+Q++ D HGN ++L ER+CS+QRR+QKV+E AP+  +  E R A+   AV++AK  GY +AGT EFLVD++   YF+E+N R+QVEH I+E ITG+DIV    ++  G  L    L Q  I+  G++++CR+  EDP K+F  P  GRL  Y+       VR D G    G+ IS +YD M+ K    G         M++AL  + IRGV  NIP L  ++T P F+ G   T ++ +  P  F+      +   LL  ++ +    + I+ +  L K +S
Sbjct:   22 KILVANRGEIPIRIFRSAHELSMRTIAIYSHEDRLSMHRLKADEAYVIGEEGQYTPVGAYLAMDEIIEIAKKHKVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARHLAARANVPTVPGTPGPIETVQEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKVCGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIVSAQIQIAAGATLTQLGLLQDKITTRGFSIQCRITTEDPSKNFQ-PDTGRLEVYRSA-GGNGVRLDGGNAYAGATISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDT-PQLFQMVSSQNRAQKLLHYLADLAVNGSSIKGQIGLPKLKS 510          

HSP 2 Score: 47.7506 bits (112), Expect = 8.144e-6
Identity = 27/77 (35.06%), Postives = 42/77 (54.55%), Query Frame = 1
Query: 2005 PKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            PK  V  +  I APM G++  V V  G  V  G+ + VL AMKM+  + +   G +K V  + G++V   D+++ LE
Sbjct: 1094 PKADVHDTHQIGAPMAGVIIEVKVHKGSLVKKGESIAVLSAMKMEMVVSSPADGQVKDVFIKDGESVDASDLLVVLE 1170          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Yeast
Match: PYC1 (Pyruvate carboxylase isoform; cytoplasmic enzyme that converts pyruvate to oxaloacetate; differentially regulated than isoform Pyc2p; mutations in the human homolog are associated with lactic acidosis; PYC1 has a paralog, PYC2, that arose from the whole genome duplication [Source:SGD;Acc:S000003030])

HSP 1 Score: 327.02 bits (837), Expect = 5.793e-97
Identity = 189/492 (38.41%), Postives = 292/492 (59.35%), Query Frame = 1
Query:  193 KILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSL---SYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLL---LKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSG-IQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRS 1647
            KIL+ANRGEI  RI  +     ++ VA++S  D LS   Q ADEA  IG         +YL +++I+   ++   + +HPGYGFLSEN+ FA K+    + ++GP ++ I S+GDK+ ++ +A  A V  +PG  G I   +EA+   N+ GYPV+IKA+ GGGG+GMR+     +  + ++ + +EA+++FG+    +E++++KP+HIE+Q++ D HGN ++L ER+CS+QRR+QKV+E AP+  +  E R A+   AV++AK  GY +AGT EFLVD++   YF+E+N R+QVEH I+E ITG+DIV    ++  G  L    L Q  I+  G+A++CR+  EDP K+F  P  GR+  Y+       VR D G    G+ IS +YD M+ K    G         M++AL  + IRGV  NIP L  ++T P F+ G   T ++ +  P  F+      +   LL  ++ V    + I+ +  L K +S
Sbjct:   21 KILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQKADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGITWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAAFGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGNVVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDNQNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQCRITTEDPAKNFQ-PDTGRIEVYRSA-GGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTYEIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDT-PQLFQMVSSQNRAQKLLHYLADVAVNGSSIKGQIGLPKLKS 509          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Yeast
Match: HFA1 (Mitochondrial acetyl-coenzyme A carboxylase; catalyzes production of malonyl-CoA in mitochondrial fatty acid biosynthesis; relocalizes from mitochondrion to cytoplasm upon DNA replication stress; genetic and comparative analysis suggests that translation begins at a non-canonical (Ile) start codon at -372 relative to the annotated start codon [Source:SGD;Acc:S000004820])

HSP 1 Score: 280.411 bits (716), Expect = 1.309e-79
Identity = 226/746 (30.29%), Postives = 350/746 (46.92%), Query Frame = 1
Query:  223 ACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKL--EDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDT-------------------------DEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLV---DDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDI----------------------SVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQ------EGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRG-VTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKG-KQLTPKETGLL-EAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQ-NVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE*KSTASYSHCKLF 2274
            A    N  K      +A   D+ A S +++MAD+ + +     + +Y N++ ILD  +QT  +AV  G+G  SEN    + L      ++F+GP  +A+ S+GDKI S  +A +AK+ CIP + G   DT                         ++A++ A  IG+PVMIKAS GGGGKG+R   N+ + +  Y+ +  E   S     M + K +   RH+E+Q++ D++G  + L  R+CSIQRR+QK+IEEAP T   PET + M   A+++ + VGY SAGTVE+L    DDK  FYFLE+N RLQVEHP +E+I+GV++     ++  G P+ +  SDI                      S  G  + CR+ +EDP + F  PS G+       +H  N R  S +           I  + D     +   G DR  A   MV AL  + IRG     I  L +++    F S NI+T +L ++         +L P    +   AM A VF + ++RNK               E  R     P+++            KT+  V    D +R  F V   S   F ++ N    + +  Q + +D +++ +  + ++ Y      GT+  +   +I    L   + P +V       I+P PG +    V+ G  V  GQ+   +E MKMQ  +VA   GVI+ +  QPG  +  GD+I +L   S +  +   L+
Sbjct:    8 AYETFNDEKIIQFVVMATPDDLHANSEYIRMADQYVQVPGGTNNNNYANIDLILDVAEQTDVDAVWAGWGHASENPCLPELLASSQRKILFIGPPGRAMRSLGDKISSTIVAQSAKIPCIP-WSGSHIDTIHIDNKTNFVSVPDDVYVRGCCSSPEDALEKAKLIGFPVMIKASEGGGGKGIRRVDNEDDFIALYRQAVNETPGS----PMFVMKVVTDARHLEVQLLADQYGTNITLFGRDCSIQRRHQKIIEEAPVTITKPETFQRMERAAIRLGELVGYVSAGTVEYLYSPKDDK--FYFLELNPRLQVEHPTTEMISGVNLPATQLQIAMGIPMHMI-SDIRKLYGLDPTGTSYIDFKNLKRPSPKGHCISCRITSEDPNEGFK-PSTGK-------IHELNFRSSSNVWGYFSVGNNGAIHSFSDSQFGHIFAVGNDRQDAKQNMVLALKDFSIRGEFKTPIEYLIELLETRDFESNNISTGWLDDLILKNLSSDSKLDPTLAIICGAAMKAYVFTE-KVRNKYL-------------ELLRRGQVPPKDFL-----------KTKFPVDFIFDNNRYLFNVAQSSEEQFILSINKSQCE-VNVQKLSSDCLLISVDGKCHTVYWKDDIRGTRLSIDSNTIF---LEAELNPTQV-------ISPTPGKLVKYLVRSGDHVFAGQQYAEIEIMKMQMPLVAKSDGVIELLR-QPGSIIEAGDVIAKLTLDSPSKANESSLY 700          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Yeast
Match: ACC1 (Acetyl-CoA carboxylase, biotin containing enzyme; catalyzes carboxylation of cytosolic acetyl-CoA to form malonyl-CoA and regulates histone acetylation by regulating the availablity of acetyl-CoA; required for de novo biosynthesis of long-chain fatty acids; ACC1 has a paralog, HFA1, that arose from the whole genome duplication [Source:SGD;Acc:S000005299])

HSP 1 Score: 263.848 bits (673), Expect = 4.262e-74
Identity = 214/756 (28.31%), Postives = 348/756 (46.03%), Query Frame = 1
Query:  181 TKFKKILIANRGEIACRIINSCKRFGIK-----------AVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLED--MNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIP----GYD--------------------GEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVD-DKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISV------------------------------NGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQ------EGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRG-VTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDII 2223
            T   KILIAN G  A + I S +++  +           A+A   D++A + +++MAD+ I +     + +Y N++ I+D  ++   +AV  G+G  SEN +  +KL      V+F+GP   A+ S+GDKI S  +A +AKV CIP    G D                    G     ++ ++ A +IG+PVMIKAS GGGGKG+R    +++ +  Y  +  E   S     + I K   + RH+E+Q++ D++G  + L  R+CS+QRR+QK+IEEAP T    ET   M + AV++ K VGY SAGTVE+L   D   FYFLE+N RLQVEHP +E+++GV++     ++  G P + + SDI                                 G    CR+ +EDP   F  PS G        LH  N R  S +           I  + D     +  +GE+R  +   MV AL    IRG     +  L  ++    F    ITT +L ++       ++  P    +  A +       E R+K       SL   +K +    DL             L++      +H   +  R  FTV     + + +  N    D II + + +  +++ +  ++++ Y   +   T  +L V+S     ++  +   +V +  + +  P PG +    V+ G+ +  GQ    +E MKMQ  +V+ + G+++ +  QPG T+  GDI+
Sbjct:   57 TVISKILIANNGIAAVKEIRSVRKWAYETFGDDRTVQFVAMATPEDLEANAEYIRMADQYIEVPGGTNNNNYANVDLIVDIAERADVDAVWAGWGHASENPLLPEKLSQSKRKVIFIGPPGNAMRSLGDKISSTIVAQSAKVPCIPWSGTGVDTVHVDEKTGLVSVDDDIYQKGCCTSPEDGLQKAKRIGFPVMIKASEGGGGKGIRQVEREEDFIALYHQAANEIPGS----PIFIMKLAGRARHLEVQLLADQYGTNISLFGRDCSVQRRHQKIIEEAPVTIAKAETFHEMEKAAVRLGKLVGYVSAGTVEYLYSHDDGKFYFLELNPRLQVEHPTTEMVSGVNLPAAQLQIAMGIP-MHRISDIRTLYGMNPHSASEIDFEFKTQDATKKQRRPIPKGHCTACRITSEDPNDGFK-PSGGT-------LHELNFRSSSNVWGYFSVGNNGNIHSFSDSQFGHIFAFGENRQASRKHMVVALKELSIRGDFRTTVEYLIKLLETEDFEDNTITTGWLDDLITHKMTAEKPDPTLAVICGAATKAFLASEEARHKYI----ESL---QKGQVLSKDL-------------LQTMFPVDFIH---EGKRYKFTVAKSGNDRYTLFINGSKCD-IILRQLSDGGLLIAIGGKSHTIYWKEEVAAT--RLSVDS-----MTTLL---EVENDPTQLRTPSPGKLVKFLVENGEHIIKGQPYAEIEVMKMQMPLVSQENGIVQLLK-QPGSTIVAGDIM 764          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Nematostella
Match: EDO35385 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLP5])

HSP 1 Score: 719.539 bits (1856), Expect = 0.000e+0
Identity = 375/689 (54.43%), Postives = 489/689 (70.97%), Query Frame = 1
Query:  178 ETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHL-PNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSL--LIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            E  F KILIANRGEIACR++ +C+R GIK VA++S+ DA +  V+MADE++C+GP  T  SYLNM  ILDA++ TGA+AVHPGYGFLSEN  F  +LE+  + F+GPN+KA+H+MGDKIESK I   AKV+ IPG++G +           ++ YPVM+KASAGGGGKGMR+AWND+EA EG++LS  EA SSFGDDR+L+E++I+ PRHIEIQ++ DKHGNA+YLNERECSIQRRNQKVIEEAPS F++P+ R+AMGEQAV +AKAVGYDSAGTVE LVD ++NFYFLEMNTRLQVEHPI+E+ TGVDIV QM RV  G+PL +KQ DI + GWA+E RVYAEDP K+FGLPS+GRL  Y +P H+ PNVRCDSGI EGSEISIYYD MI KL TYGE R +A+  M  ALDSYVIRGVT N+ LLRD++  P+F +G+ITT +LP  YP GFKG  LT KE   L A SA +FV+   R +TF  +  S+  + AE++            W L  S   ES      ++V+   D  +  V   SG          L+  +   N++  +++LQ +S+ +      Q+ GT YK++V +    +L ++M  K   D S  + +PMPG V +V+V VG  V +GQEL V+EAMKMQNS+ +A  G +  V+++ G  V++GDI++++E
Sbjct:   46 EKFFDKILIANRGEIACRVMRTCQRLGIKTVAIYSEADANALHVKMADESVCVGPPPTGASYLNMNAILDAIRSTGAQAVHPGYGFLSENYRFVGRLEEEGITFIGPNAKAMHAMGDKIESKLIGKRAKVNIIPGFEGVV-----------KVSYPVMLKASAGGGGKGMRVAWNDEEAREGFRLSSQEAASSFGDDRLLVERFIDNPRHIEIQVIGDKHGNAVYLNERECSIQRRNQKVIEEAPSPFVDPDMRRAMGEQAVSLAKAVGYDSAGTVECLVDSQKNFYFLEMNTRLQVEHPITEMTTGVDIVEQMIRVAAGYPLPMKQEDIPLKGWAIESRVYAEDPTKNFGLPSIGRLYKYIDPTHISPNVRCDSGIVEGSEISIYYDSMISKLATYGETRDEAIDLMNVALDSYVIRGVTDNVSLLRDVLNHPKFRAGDITTKFLPMEYPKGFKGHVLTEKEREELLATSAYMFVQRVRRARTFKNQSTSVDKVTAEQT-----------SWELVCSLLGESYP----INVTYIGDGKYRMVC--SGEEIEFFAGTPLSAPVFEGNVNGKKVLLQTISK-HGNLFNIQHCGTIYKVRVHTKAEEELMQYMPVKDEEDMSPFLKSPMPGKVVSVAVVVGDEVREGQELAVVEAMKMQNSLHSATTGKVIKVNYKAGDNVAEGDIMVQIE 705          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Nematostella
Match: EDO44779 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUP0])

HSP 1 Score: 472.241 bits (1214), Expect = 1.411e-155
Identity = 264/675 (39.11%), Postives = 400/675 (59.26%), Query Frame = 1
Query:  193 KILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNS-FRIANNFHL--ADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVS 2208
            KIL+ANRGEIACR++++ +R G++ VAV+S+ DA S  V +ADEA  IGPA +S SYL M KI++  K+TGA+A+HPGYGFLSE+  FA   ++ N++F+GP + AI  MG K  SK I + A V  I GY GE    +   + A +IGYPVM+KA  GGGGKGMRI  +  E  E  + ++ E+  SF DD ML+EK++  PRH+E+Q+  D+ GN +YL ER+CS+QRR+QK+IEEAP+  ++ E R+++GE AV+ AKAVGY  AGTVEF++D  +NFYF+EMNTRLQ +HPI+E+ITG+D+V    ++  G  L LKQ ++ ++G A E RVYAEDP   F LP  G L     P    ++R D+G+++G ++S YYDPMI KLV + E R  AL  + ++L  Y + G+  NI  L  +     F +G++ T+++ +   D F  K   P +  + +A  A++ ++ E RN+       +  +   S SFR         +  +   +   D    + + + ++R   + + E G+  F ++ +        ++T  ++       L+ ++ + ++ F   G +          H+     L   +        APMPG +  V V+ GQ V  GQ L V+EAMKM++S+ + KAGVI  V    G +V+
Sbjct:   37 KILVANRGEIACRVMHTARRMGVQTVAVYSNADAKSLHVSLADEAYRIGPAPSSESYLKMHKIMEVAKKTGAQAIHPGYGFLSESPEFADLCQEENIIFIGPPASAIRDMGIKSTSKSIMSDAGVPIIQGYHGEDQSVERLQQEAERIGYPVMLKAVRGGGGKGMRIVNSPDEFHEMLESAKNESIKSFNDDSMLVEKFVETPRHVEVQVFGDRQGNVVYLYERDCSVQRRHQKIIEEAPAPGVSDEVRRSIGEAAVRAAKAVGYFGAGTVEFIMDSSQNFYFMEMNTRLQAKHPITEMITGLDLVEWQLKIAAGEDLPLKQDEVQLHGHAFEARVYAEDPSSDF-LPGAGPLLHLTTPQETQHIRIDTGVRQGDQVSTYYDPMIAKLVVWSETRPSALRLLKESLKKYNVVGLETNISFLTSLCDHNSFQAGDVHTDFIKQHMADLFPAKGSMPGDD-VAQAGLALLLLEREQRNEKAAASSDTFSLWNTSGSFR--------INSELRRRIRLNDGDAKIEMFITYNRDG-SFDIEIGDELFNVSGSLSREGGKTMLTATVNGRTCKSALVDQDGTLHL-FTKDGCRRL--------HRHVPKYLKSTLGGAVGGAAAPMPGNIVKVLVEPGQEVEQGQVLVVMEAMKMEHSIRSPKAGVIDRVLCSVGGSVT 691          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Nematostella
Match: EDO35168 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM69])

HSP 1 Score: 431.795 bits (1109), Expect = 6.025e-142
Identity = 213/456 (46.71%), Postives = 302/456 (66.23%), Query Frame = 1
Query:  193 KILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIG-YPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTP 1557
            KIL+ANRGEIACR++++ +R G++ VAV+SD DA S  V +ADEA  IGPA +S SYL M KI++  K+TGA+A+HPGYGFLSE+  FA   ++ N++F+GP + AI  MG K  SK I + A V   P   G I  +  +I   +    YPVM+KA  GGGGKGMRI  +  E  E  + ++ E+  SF DD ML+EK++  PRH+E+Q+  D+ GN +YL ER+CS+QRR+QK+IEEAP+  ++ E R+++GE AV+ AKAVGY  AGTVEF++D  +NFYF+EMNTRLQ +HPI+E+ITG+D+V    ++  G  L LKQ ++ ++G A E RVYAEDP   F LP  G L     P    ++R D+G+++G ++S YYDPMI KLV + E R  AL  + ++L  Y + G+  NI  L  +     F +G++ T+++ +   D F  K   P
Sbjct:    3 KILVANRGEIACRVMHTARRMGVQTVAVYSDADAKSLHVSLADEAYRIGPAPSSESYLKMHKIMEVAKKTGAQAIHPGYGFLSESPEFADLCQEENIIFIGPPASAIRDMGIKSTSKSIMSDAGV---PIIQGNILSSLLSIHFYSSTSKYPVMLKAVRGGGGKGMRIVNSPDEFHEMLESAKNESIKSFNDDSMLVEKFVETPRHVEVQVFGDRQGNVVYLYERDCSVQRRHQKIIEEAPAPGVSDEVRRSIGEAAVRAAKAVGYFGAGTVEFIMDSSQNFYFMEMNTRLQAKHPITEMITGLDLVEWQLKIAAGEDLPLKQEEVQLHGHAFEARVYAEDPSSDF-LPGAGPLLHLSTPQETQHIRIDTGVRQGDQVSTYYDPMIAKLVVWSETRPSALRLLKESLKKYNVVGLETNISFLTSLCGHNSFQAGDVHTDFIKQHMADLFPAKGSMP 454          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Nematostella
Match: EDO48484 (Pyruvate carboxylase [Source:UniProtKB/TrEMBL;Acc:A7RIZ1])

HSP 1 Score: 368.237 bits (944), Expect = 2.007e-111
Identity = 192/489 (39.26%), Postives = 302/489 (61.76%), Query Frame = 1
Query:   91 ISLPTLHGSSNKFSSAARNIYWN-DKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLS-YLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHP---LLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCD-SGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFK 1539
             S P    ++ ++  AA  ++ +  K DP + + KKIL+ANRGEIA R+  +    GI+ VA++S+ DA     Q ADEA  +G     ++ YLN+ +I+   K+   +A+HPGYGFLSE   FA       V+F+GP+ + +H MGDK+E++++A  + V  +PG +  I   +EA +   + G PV+ KA+ GGGG+GMR+ W  ++  E + L+  EA ++FGD  M IEK+I KPRHIE+Q+M D +G+ ++L ER+CS+QRR+QKVIE AP+  ++   R+ + E AV++ KAVGY +AGTVEFL+D + N YF+E+N RLQVEH ++E ITGVD+V     V +G     L L Q +I + G A++ RV  EDP  +F  P  GR+  ++    +  +R D S    G+ IS +YD ++ K++ +     +A   + ++L  + +RGV  N   +R+++    F+ G++TT+++ E  PD  K
Sbjct:   17 FSRPAGIQTTCRYIHAANTLHQDAKKRDPPKHEIKKILVANRGEIAIRVFRAATEAGIRTVAIYSEQDANHMHRQKADEAYLVGKGMPPVAAYLNIPEIIRIAKERECDAIHPGYGFLSERADFAHACTKSGVIFIGPSPQVVHMMGDKLEARKMAINSGVPVVPGTENPIRTAEEAKQFCEEHGLPVITKAAYGGGGRGMRVIWKMEDLEEFFNLASNEAYAAFGDGSMFIEKFIEKPRHIEVQVMGDNYGDVVHLFERDCSVQRRHQKVIEIAPAPHLDDAIRQTLTEDAVRLCKAVGYSNAGTVEFLLDQEGNHYFIEVNARLQVEHTVTEEITGVDLVRAQIGVAEGKTLGELGLVQDNIKITGAAIQARVTTEDPANNF-TPDTGRIEVFRSGEGM-GIRLDGSSAFAGAVISPHYDSLLTKVIAHANSHREAATKLHRSLREFRVRGVKTNTEFIRNVLQHKDFLDGHVTTDFILE-NPDMLK 502          

HSP 2 Score: 49.2914 bits (116), Expect = 8.325e-6
Identity = 28/77 (36.36%), Postives = 40/77 (51.95%), Query Frame = 1
Query: 2005 PKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            PK        + APMPG V  V VK  + V  G  L VL AMKM+ ++ A   G++K +       V  GD++I++E
Sbjct: 1121 PKADKGVKGSVGAPMPGKVVGVRVKENEVVKKGMPLVVLSAMKMETNVSAPIDGIVKKISVSLNSNVEAGDLLIDIE 1197          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Nematostella
Match: EDO48483 (Pyruvate carboxylase [Source:UniProtKB/TrEMBL;Acc:A7RIZ0])

HSP 1 Score: 354.755 bits (909), Expect = 7.332e-107
Identity = 181/452 (40.04%), Postives = 280/452 (61.95%), Query Frame = 1
Query:  199 LIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLS-YLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHP---LLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCD-SGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFK 1539
            ++ANRGEIA R+  +    GI+ VA++S+ DA     Q ADEA  +G     ++ YLN+ +I+   K    +A+HPGYGFLSE   FA+      ++F+GP+ + +H MGDK+E++++A  A V  +PG    I + ++A     + G PV+ KA+ GGGG+GMR+ WN  +  + + L+  EA ++FGD  M IEK+I KPRHIE+Q+M D +G+ ++L ER+CS+QRR+QKVIE AP+  ++   R+ + E AV++ KAVGY +AGTVEFL+D + N YF+E+N RLQVEH ++E ITG+D+V     V +G     L L Q +I + G A++ RV  EDP  +F  P  GR+  ++    +  +R D S    G+ IS +YD ++ K++ +     +A   + +AL  Y IRGV  N   L +++    F++G + T+++ E  PD  K
Sbjct:    1 MVANRGEIAIRVFRAATEAGIRTVAIYSEQDANHMHRQKADEAYLVGKGMPPVAAYLNIPEIIRIAKDKECDAIHPGYGFLSERADFARACTKSGIIFIGPSPQVVHMMGDKLEARKVAVEAGVPVVPGTAEPIRNAEDARAFCQEHGLPVITKAAYGGGGRGMRVIWNLDDVEKYFTLASNEAYAAFGDGSMFIEKFIEKPRHIEVQVMGDNYGDVVHLFERDCSVQRRHQKVIEIAPAPLLDENIRQTLTEDAVRLCKAVGYSNAGTVEFLLDQEGNHYFIEVNARLQVEHTVTEEITGIDLVRAQIGVAEGKTLGELGLVQDNIKITGAAIQARVTTEDPANNF-TPDTGRIEVFRSGEGM-GIRLDGSSAFAGAVISPHYDSLLTKVIAHASSHREAATKLHRALTEYRIRGVKTNTSFLMNVLKHDSFLNGTVNTDFILE-NPDLLK 449          

HSP 2 Score: 49.6766 bits (117), Expect = 5.437e-6
Identity = 26/65 (40.00%), Postives = 38/65 (58.46%), Query Frame = 1
Query: 2041 APMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            APMPG V  V VK  + V  G  L VL AMKM+ ++ A   G +K +      +++ GD+++ELE
Sbjct: 1073 APMPGKVVAVRVKENEVVKKGTSLVVLSAMKMETNVSAPIDGRVKKISVSQNMSLNAGDLLVELE 1137          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Medaka
Match: pcca (propionyl-CoA carboxylase subunit alpha [Source:NCBI gene;Acc:101175100])

HSP 1 Score: 832.017 bits (2148), Expect = 0.000e+0
Identity = 415/707 (58.70%), Postives = 539/707 (76.24%), Query Frame = 1
Query:  115 SSNKFSSAARNIYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            S  ++SS+ R        + +E  F+K+LIANRGEIACR+I +CKR GI+ +AVHSDVD+ +  V+MADEA+C+GPA TSLSYLNM+ IL+AV++TGA+AVHPGYGFLSEN  FAK+L   +V F+GP++ AI +MGDKI+SK IA AAKV+ IPG+DG +   ++A+KIA QIGYPVMIKASAGGGGKGMRIAWND+E  EG++ S  EA SSFGDDR+LIEKYI++PRHIEIQ++ DKHGNAL+LNERECSIQRRNQKV+EEAPSTF++P TR+AMGEQAVQ+AKAV Y SAGTVEFLVD ++NFYFLEMNTRLQVEHPI+E ITG+D+V QM RV KG+ L  KQ DI +NGWA+E RVYAEDP+KSFGLPS+GRL+ Y+EPL L NVR DSGI+EGS+ISIYYDPMI KLVT+G  R++ALA M ++LD YVIRGVTHNIPLLR+I+T P F+SG+I+TN+LPEVYP+GFKG QL  ++   L A +A + +  ++R+++ L   R       S S  G  S    W LS+  G    ++  +VH++     S +TV  + G    +   ++LA  ++   I+  + +LQ +SR  SG I  Q+MGT +K++V S +  KL+ +M  K   DTSS++ +PMPG V  VSV  G  V++GQE+CV+EAMKMQNS+ A K   +K+VH +PG+TV +GD+++ELE
Sbjct:   31 SRAQYSSSCR------PEEEQEETFQKLLIANRGEIACRVIKTCKRMGIQTIAVHSDVDSNAVHVKMADEAVCVGPAPTSLSYLNMDAILNAVRRTGAQAVHPGYGFLSENKEFAKRLAAEDVTFIGPDTHAIQAMGDKIQSKLIAKAAKVNTIPGFDGVVKSAEDAVKIAQQIGYPVMIKASAGGGGKGMRIAWNDEETREGFRFSSQEAASSFGDDRLLIEKYIDRPRHIEIQVLADKHGNALWLNERECSIQRRNQKVVEEAPSTFLDPTTRRAMGEQAVQLAKAVQYSSAGTVEFLVDAQKNFYFLEMNTRLQVEHPITECITGLDLVEQMIRVAKGYRLQHKQEDIPINGWAIESRVYAEDPFKSFGLPSIGRLSQYQEPLDLSNVRVDSGIEEGSDISIYYDPMISKLVTFGATRAEALARMEESLDRYVIRGVTHNIPLLREIITHPLFISGDISTNFLPEVYPEGFKGHQLEAEQRRELLASAAALHIAAQLRSQSILGNLRV------SSSVAGHSS----WDLSLELG----ERHYDVHITK--SGSIYTVEVDGGR-VEVIGEWNLASPLLPLTINGSQRMLQCLSREASGTIALQFMGTLFKVRVLSKLASKLNSYMPEKLPEDTSSILRSPMPGTVVAVSVHPGDTVAEGQEICVIEAMKMQNSLTAVKQAKVKSVHCKPGETVGEGDLLVELE 714          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Medaka
Match: mccc1 (methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gene;Acc:101161876])

HSP 1 Score: 474.937 bits (1221), Expect = 3.755e-156
Identity = 239/486 (49.18%), Postives = 323/486 (66.46%), Query Frame = 1
Query:   88 FISLPTLHGS---SNKFSSAARNIYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGF 1536
             +S PTL G      K + + R++         E + +K+LIANRGEIACR++ + K+ G+++VAV+S+ D  S  V MADEA  IGP  +  SYL++EK+L+  K++G+ AVHPGYGFLSENT FA+  +   ++F+GP S AI  MG K  SK I +AA V  I GY GE    +  +  A +IG+PVMIKA  GGGGKGMRIA ++ + +E  + +R EA+ SF DD ML+EK++  PRH+E+Q+  D HGNA+YL ER+CS+QRR+QK+IEEAP   I+PE RK +GE AV+ AKAV Y  AGTVEF+VD + NFYF+EMNTRLQVEHP++E+ITG D+V    RV  G  L L Q DI + G + E R+YAEDP   F LP  G L     P    + R ++G++EG E+S +YDPMI KLV +GEDRS AL  +   L  Y I G+  NI  L  +   P F +GN++T+++P+ Y D F
Sbjct:    5 ILSFPTLCGLRILPRKLTWSRRSVRLASGGGGVE-RIEKVLIANRGEIACRVMRTAKKMGVRSVAVYSEADKSSMHVAMADEAYHIGPPPSQQSYLSVEKVLEVAKKSGSHAVHPGYGFLSENTEFAEACKREGIIFIGPPSSAIRDMGIKSTSKHIMSAAGVPIIGGYHGEDQSNERLLAEAAKIGFPVMIKAVRGGGGKGMRIARSETDFLEQLESARREARKSFNDDVMLVEKFVEDPRHVEVQVFGDTHGNAVYLFERDCSVQRRHQKIIEEAPGPGISPEVRKKLGEAAVRAAKAVNYVGAGTVEFIVDAQHNFYFMEMNTRLQVEHPVTEMITGTDLVEWQLRVAAGERLPLLQDDIILRGHSFEARIYAEDPNNEF-LPGAGPLLHLSTPPADRHTRIETGVREGDEVSAHYDPMIAKLVVWGEDRSAALKKLRYCLRQYNIVGLNTNIDFLLSLSGHPEFEAGNVSTSFIPQHYSDLF 488          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Medaka
Match: mccc1 (methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gene;Acc:101161876])

HSP 1 Score: 474.167 bits (1219), Expect = 4.420e-156
Identity = 231/451 (51.22%), Postives = 310/451 (68.74%), Query Frame = 1
Query:  184 KFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGF 1536
            + +K+LIANRGEIACR++ + K+ G+++VAV+S+ D  S  V MADEA  IGP  +  SYL++EK+L+  K++G+ AVHPGYGFLSENT FA+  +   ++F+GP S AI  MG K  SK I +AA V  I GY GE    +  +  A +IG+PVMIKA  GGGGKGMRIA ++ + +E  + +R EA+ SF DD ML+EK++  PRH+E+Q+  D HGNA+YL ER+CS+QRR+QK+IEEAP   I+PE RK +GE AV+ AKAV Y  AGTVEF+VD + NFYF+EMNTRLQVEHP++E+ITG D+V    RV  G  L L Q DI + G + E R+YAEDP   F LP  G L     P    + R ++G++EG E+S +YDPMI KLV +GEDRS AL  +   L  Y I G+  NI  L  +   P F +GN++T+++P+ Y D F
Sbjct:   21 RIEKVLIANRGEIACRVMRTAKKMGVRSVAVYSEADKSSMHVAMADEAYHIGPPPSQQSYLSVEKVLEVAKKSGSHAVHPGYGFLSENTEFAEACKREGIIFIGPPSSAIRDMGIKSTSKHIMSAAGVPIIGGYHGEDQSNERLLAEAAKIGFPVMIKAVRGGGGKGMRIARSETDFLEQLESARREARKSFNDDVMLVEKFVEDPRHVEVQVFGDTHGNAVYLFERDCSVQRRHQKIIEEAPGPGISPEVRKKLGEAAVRAAKAVNYVGAGTVEFIVDAQHNFYFMEMNTRLQVEHPVTEMITGTDLVEWQLRVAAGERLPLLQDDIILRGHSFEARIYAEDPNNEF-LPGAGPLLHLSTPPADRHTRIETGVREGDEVSAHYDPMIAKLVVWGEDRSAALKKLRYCLRQYNIVGLNTNIDFLLSLSGHPEFEAGNVSTSFIPQHYSDLF 470          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Medaka
Match: pcxb (pyruvate carboxylase [Source:NCBI gene;Acc:101170548])

HSP 1 Score: 311.612 bits (797), Expect = 3.385e-91
Identity = 178/471 (37.79%), Postives = 270/471 (57.32%), Query Frame = 1
Query:  190 KKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLS-YLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQ-EGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVV 1596
            KK+++ANRGEIA R+  +C   GI+ VAV+S+ D      Q ADEA  IG     ++ YL++  I+   K+ G +A+HPGYGFLSE   FA+   D  V F+GP    +  MGDK+E++ +AN+A V  +PG D  I+   +A   A   G+P++ KA+ GGGG+GMR+    +E  E Y+ + +EA ++FG+  + +EK+I KPRHIE+QI+ DK+GN ++L ER+CSIQRR+QKV+E AP   ++P  R  +   AV +AK VGY++AGTVEFLVD     YF+E+N+RLQVEH ++E IT    V Q+FR G+G                                                 +R DS    +G+ IS +YD ++ K++  G+D + A + M +AL  + +RGV  NIP L+++++  +F+   + T ++ E  P+ F  K    +   LL  +  V+
Sbjct:   38 KKVMVANRGEIAIRVFRACTEMGIRTVAVYSEQDTGQMHRQKADEAYLIGRGLPPVAAYLHIPDIIKVAKENGVDAIHPGYGFLSERADFAQACADAGVRFVGPTPDTVRKMGDKVEARSLANSAGVPVVPGTDAPISCLQDAQAFAQTYGFPIIFKAAYGGGGRGMRVVREYEELEENYQRAYSEALTAFGNGALFVEKFIEKPRHIEVQILGDKYGNVIHLYERDCSIQRRHQKVVEIAPGFQLDPHLRDRLHSDAVNLAKQVGYENAGTVEFLVDKHGKHYFIEVNSRLQVEHTVTEEITDKPFVLQVFRSGEGM-----------------------------------------------GIRLDSASAFQGAIISPHYDSLLVKVIASGKDLNTAASKMSRALAEFRVRGVKTNIPFLQNVLSNNQFLHSTVDTQFIDE-NPELFNLKPTQNRAQKLLHYLGHVM 460          

HSP 2 Score: 71.633 bits (174), Expect = 2.480e-12
Identity = 41/112 (36.61%), Postives = 60/112 (53.57%), Query Frame = 1
Query: 1900 MSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            +++N    + F+  G    + V+  +  K  KF  PK        + APMPG V  V VK G +V  GQ LCVL AMKM+  + +  AG IKA+H  P  ++   D+I+E+E
Sbjct:  937 LNKNGQREVFFEMNGQLRSVLVKDTVAMKEMKFH-PKAQKSIKGQVGAPMPGKVLEVKVKTGSKVEKGQPLCVLSAMKMETVVNSPMAGTIKAIHVSPDASLEGDDLILEIE 1047          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Medaka
Match: acacb (acetyl-CoA carboxylase beta [Source:NCBI gene;Acc:101171338])

HSP 1 Score: 230.72 bits (587), Expect = 3.012e-62
Identity = 157/507 (30.97%), Postives = 252/507 (49.70%), Query Frame = 1
Query:  190 KKILIANRGEIACRIINSCKRFGIK-----------AVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGY---------------------------DGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHP--------LLLKQS---DISVN-----------GWAVECRVYAEDPYKSFGLPSVGRLT-----SYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRG-VTHNIPLLRDIVTEPRFVSGNITTNYL 1512
            +K+LIAN G  A + + S +R+  +            +    D+ A + +++MAD  + +     + +Y N+E I+D  K+   + V  G+G  SEN    + L    + FLGP+SKA+ ++GDK+ S  +A +A +  +P                             +G + D ++ +  A +IGYPV+IKAS GGGGKG+R   N ++    ++  + E   S     + + +     RH+E+QI+ D++GNA+ L  R+CSIQRR+QK+IEEAP+T     T + M + AV+MAK VGY SAGTVE+L  +  +F+FLE+N RLQVEHP +E+I  V++     ++  G P        LL  +S   D  +N           G  +  R+ +E+P + F  PS G +      S K      +V    G+ E      + D       ++GE+R +A++ MV AL    IRG     +  L  I+    + +  I T +L
Sbjct:  198 EKVLIANNGIAAVKCMRSIRRWSYEMFRNERTIRFVVMVTPEDLKANAEYIKMADHYVPVPGGSNNNNYANVELIVDIAKRIPVQGVWAGWGHASENPKLPELLHKAGISFLGPSSKAMWALGDKVASSIVAQSADIPTLPWSGSGLKVDWTEEDQTQGKVISVPPEVYNEGCVRDVEDGLAGAERIGYPVVIKASEGGGGKGIRKVENSEDFPGFFRQVQTEVPGS----PIFVMQLAQHARHLEVQILADEYGNAISLFGRDCSIQRRHQKIIEEAPATIAASSTLEQMEQYAVRMAKMVGYVSAGTVEYLYSEDGSFHFLELNPRLQVEHPCTEMIGDVNLPAAQLQIAMGIPLSRIKDIRLLYGESPWGDTHINFEVPYRLPSPRGHVIAVRITSENPDEGFK-PSSGTVQELNFRSSKNVWGYFSVGATGGLHE------FADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKILETESYRNNEIDTGWL 693          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Planmine SMEST
Match: SMESG000034830.1 (SMESG000034830.1)

HSP 1 Score: 1502.26 bits (3888), Expect = 0.000e+0
Identity = 722/722 (100.00%), Postives = 722/722 (100.00%), Query Frame = 1
Query:   70 MLRIKCFISLPTLHGSSNKFSSAARNIYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            MLRIKCFISLPTLHGSSNKFSSAARNIYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE
Sbjct:    1 MLRIKCFISLPTLHGSSNKFSSAARNIYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 722          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Planmine SMEST
Match: SMESG000034830.1 (SMESG000034830.1)

HSP 1 Score: 1479.15 bits (3828), Expect = 0.000e+0
Identity = 713/722 (98.75%), Postives = 713/722 (98.75%), Query Frame = 1
Query:   70 MLRIKCFISLPTLHGSSNKFSSAARNIYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            MLRIKCFISLPTLHGSSNKFSSAARNIYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDR         SFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE
Sbjct:    1 MLRIKCFISLPTLHGSSNKFSSAARNIYWNDKHDPKETKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDR---------SFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 713          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Planmine SMEST
Match: SMESG000025178.1 (SMESG000025178.1)

HSP 1 Score: 424.091 bits (1089), Expect = 2.582e-137
Identity = 262/694 (37.75%), Postives = 387/694 (55.76%), Query Frame = 1
Query:  181 TKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPL-LLKQSDISVNGWAVECRVYAEDPYKSFG-LPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFD---RSHF--TVNFESGNS--FRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            T+  KILIANRGEIACR+I + KR GI+ +AV+S+ D  S   +MA ++ CIGPA + LSYLN EK+L   + T ++A+HPGYGFLSEN  FA   +  NV+F+GP   AI  MG K  SK I  AA V  + GY G   + D  ++ A +IG+P+MIKA  GGGGKGMRI  +  E  E  + ++ EA  SF DD ML+EK+I  PRH+E+Q+                       K+IEEAP   I  E R  +G+ AV+ A AV Y  AGTVEF++D K NFYF+EMNTRLQVEHPI+E+ITG D+V    RV  G  L ++ Q+ I   G A E R+YAED       +P+ G +   + P    NVR D+G+ EG EIS++YDPMI KLV +  DRS AL  +  AL+SY I G+  NI  L+ +   P F+ G + T+++ +     F  ++   ++  +  A+S ++  ++ I   +   +DR    A +   FR  ++H  +  +  +H      K+    + V+ D    S+F  TVN E       RI  N       I  ++D  +  + +       ++ F     K++L    +    L    L +   D S   I+PMPG+++ + V+VGQ+++ G+ L  L AMKM+  + A   G++++++   G+TV+    ++EL+
Sbjct:    4 TRISKILIANRGEIACRVIKTAKRMGIETIAVYSEADRNSLHAKMASQSYCIGPAASQLSYLNAEKLLSVAQMTKSQAIHPGYGFLSENVEFAALCKANNVIFIGPPESAIRDMGIKNTSKSIMEAAGVPVVKGYHGNNQNKDYLLEEATKIGFPIMIKAVRGGGGKGMRICLSKNEFFEQLESAKREAIKSFNDDAMLLEKFIETPRHVEVQVFGIV------------------TKIIEEAPGPGITAEIRDRLGKAAVKAAAAVSYVGAGTVEFIMDAKHNFYFMEMNTRLQVEHPITEMITGTDLVEWQLRVASGERLPIIDQALIQPKGHAFEARIYAEDCTNPTAFMPTAGLIKHMRLPEINENVRIDTGVLEGDEISVHYDPMISKLVVWSHDRSSALQKLTMALNSYQIVGLPTNIEFLKSLSLHPSFIDGLVHTDFIKQHTDSLFAVEKSETRDVSIAAAVSVMIDSQHPIVIDS--SEDRYSPFATQLPGFR--INHNFQQKIKFNH------KSMISEMIVERDTHSNSYFVSTVNGEQKTLKISRIVENHETNPNRIRLDVDGIQTDVSMFRDGLDLHLFFD---GKHELFTYCVDELALGSATLVENAGDGSLFGISPMPGVIEKIFVEVGQKITRGESLLTLIAMKMEYIIRAGSDGIVQSINVSEGETVAKNIHLVELK 666          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Planmine SMEST
Match: SMESG000025190.1 (SMESG000025190.1)

HSP 1 Score: 420.624 bits (1080), Expect = 3.213e-136
Identity = 258/694 (37.18%), Postives = 385/694 (55.48%), Query Frame = 1
Query:  181 TKFKKILIANRGEIACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPL-LLKQSDISVNGWAVECRVYAEDPYKSFG-LPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFD---RSHF--TVNFESGNS--FRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
            T+  KILIANRGEIACR+I + KR GI+ +AV+S+ D  S   +MA ++ CIGPA + LSYLN EK+L   + T ++A+HPGYGFLSEN  FA                                     C   Y G   + D  ++ A +IG+P+MIKA  GGGGKGMRI  +  E  E  + ++ EA  SF DD ML+EK+I  PRH+E+Q+  D +GN ++L ER+CS+QRR+QK+IEEAP   I  E R  +G+ AV+ A AV Y  AGTVEF++D K NFYF+EMNTRLQVEHPI+E+ITG D+V    RV  G  L ++ Q+ I   G A E R+YAED       +P+ G +   + P    NVR D+G+ EG EIS++YDPMI KLV +  DRS AL  +  AL+SY I G+  NI  L+ +   P F+ G + T+++ +     F  ++   ++  +  A+S ++  ++ I   +   +DR    A +   FR  ++H  +  +  +H      K+    + V+ D    S+F  TVN E       RI  N       I  ++D  +  + +       ++ F     K++L    +    L    L +   D S   I+PMPG+++ + V+VGQ+++ G+ L  L AMKM+  + A   G++++++   G+TV+    ++EL+
Sbjct:    4 TRISKILIANRGEIACRVIKTAKRMGIETIAVYSEADRNSLHAKMASQSYCIGPAASQLSYLNAEKLLSVAQMTKSQAIHPGYGFLSENVEFAAL-----------------------------------C---YHGNNQNKDYLLEEATKIGFPIMIKAVRGGGGKGMRICLSKNEFFEQLESAKREAIKSFNDDAMLLEKFIETPRHVEVQVFGDSYGNYVHLCERDCSVQRRHQKIIEEAPGPGITAEIRDRLGKAAVKAAAAVSYVGAGTVEFIMDAKHNFYFMEMNTRLQVEHPITEMITGTDLVEWQLRVASGERLPIIDQALIQPKGHAFEARIYAEDCTNPTAFMPTAGLIKHMRLPEINENVRIDTGVLEGDEISVHYDPMISKLVVWSHDRSSALQKLTMALNSYQIVGLPTNIEFLKSLSLHPSFIDGLVHTDFIKQHTDSLFAVEKSETRDVSIAAAVSVMIDSQHPIVIDS--SEDRYSPFATQLPGFR--INHNFQQKIKFNH------KSMISEMIVERDTHSNSYFVSTVNGEQKTLKISRIVENHETNPNRIRLDVDGIQTDVSMFRDGLDLHLFFD---GKHELFTYCVDELALGSATLVENAGDGSLFGISPMPGVIEKIFVEVGQKITRGESLLTLIAMKMEYIIRAGSDGIVQSINVSEGETVAKNIHLVELK 646          
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Planmine SMEST
Match: SMESG000025178.1 (SMESG000025178.1)

HSP 1 Score: 386.341 bits (991), Expect = 3.043e-123
Identity = 245/670 (36.57%), Postives = 367/670 (54.78%), Query Frame = 1
Query:  253 FGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLNMEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHSMGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAGGGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQIMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQMAKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQMFRVGKGHPL-LLKQSDISVNGWAVECRVYAEDPYKSFG-LPSVGRLTSYKEPLHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSYVIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETGLLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSISHGLESQDKTQNVHVSVDFD---RSHF--TVNFESGNS--FRIANNFHLADKIITQNIDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVVDTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGVIKAVHFQPGQTVSDGDIIIELE 2235
             GI+ +AV+S+ D  S   +MA ++ CIGPA + LSYLN EK+L   + T ++A+HPGYGFLSEN  FA   +  NV+F+GP   AI  MG K  SK I  AA V  + GY G   + D  ++ A +IG+P+MIKA  GGGGKGMRI  +  E  E  + ++ EA  SF DD ML+EK+I  PRH+E+Q+                       K+IEEAP   I  E R  +G+ AV+ A AV Y  AGTVEF++D K NFYF+EMNTRLQVEHPI+E+ITG D+V    RV  G  L ++ Q+ I   G A E R+YAED       +P+ G +   + P    NVR D+G+ EG EIS++YDPMI KLV +  DRS AL  +  AL+SY I G+  NI  L+ +   P F+ G + T+++ +     F  ++   ++  +  A+S ++  ++ I   +   +DR    A +   FR  ++H  +  +  +H      K+    + V+ D    S+F  TVN E       RI  N       I  ++D  +  + +       ++ F     K++L    +    L    L +   D S   I+PMPG+++ + V+VGQ+++ G+ L  L AMKM+  + A   G++++++   G+TV+    ++EL+
Sbjct:    1 MGIETIAVYSEADRNSLHAKMASQSYCIGPAASQLSYLNAEKLLSVAQMTKSQAIHPGYGFLSENVEFAALCKANNVIFIGPPESAIRDMGIKNTSKSIMEAAGVPVVKGYHGNNQNKDYLLEEATKIGFPIMIKAVRGGGGKGMRICLSKNEFFEQLESAKREAIKSFNDDAMLLEKFIETPRHVEVQVFGIV------------------TKIIEEAPGPGITAEIRDRLGKAAVKAAAAVSYVGAGTVEFIMDAKHNFYFMEMNTRLQVEHPITEMITGTDLVEWQLRVASGERLPIIDQALIQPKGHAFEARIYAEDCTNPTAFMPTAGLIKHMRLPEINENVRIDTGVLEGDEISVHYDPMISKLVVWSHDRSSALQKLTMALNSYQIVGLPTNIEFLKSLSLHPSFIDGLVHTDFIKQHTDSLFAVEKSETRDVSIAAAVSVMIDSQHPIVIDS--SEDRYSPFATQLPGFR--INHNFQQKIKFNH------KSMISEMIVERDTHSNSYFVSTVNGEQKTLKISRIVENHETNPNRIRLDVDGIQTDVSMFRDGLDLHLFFD---GKHELFTYCVDELALGSATLVENAGDGSLFGISPMPGVIEKIFVEVGQKITRGESLLTLIAMKMEYIIRAGSDGIVQSINVSEGETVAKNIHLVELK 639          
The following BLAST results are available for this feature:
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCCA0.000e+058.99propionyl-CoA carboxylase subunit alpha [Source:HG... [more]
PCCA0.000e+059.15propionyl-CoA carboxylase subunit alpha [Source:HG... [more]
PCCA0.000e+055.65propionyl-CoA carboxylase subunit alpha [Source:HG... [more]
PCCA0.000e+070.43propionyl-CoA carboxylase subunit alpha [Source:HG... [more]
MCCC12.984e-15940.03methylcrotonoyl-CoA carboxylase 1 [Source:HGNC Sym... [more]
back to top
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcca-10.000e+058.69Propionyl-CoA carboxylase alpha chain, mitochondri... [more]
pcca-10.000e+058.69Propionyl-CoA carboxylase alpha chain, mitochondri... [more]
mccc-19.253e-15840.00MethylCrotonoyl-Coenzyme A Carboxylase (Alpha) [S... [more]
mccc-19.253e-15840.00MethylCrotonoyl-Coenzyme A Carboxylase (Alpha) [S... [more]
pyc-13.191e-10338.68Pyruvate carboxylase 1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mccc14.799e-16340.03gene:FBgn0039877 transcript:FBtr0307551[more]
Mccc14.799e-16340.03gene:FBgn0039877 transcript:FBtr0085856[more]
Mccc16.209e-14639.27gene:FBgn0039877 transcript:FBtr0307552[more]
Mccc16.209e-14639.27gene:FBgn0039877 transcript:FBtr0085855[more]
PCB6.009e-10640.72gene:FBgn0027580 transcript:FBtr0088455[more]
back to top
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcca0.000e+060.49propionyl-CoA carboxylase subunit alpha [Source:ZF... [more]
pcca0.000e+058.69propionyl-CoA carboxylase subunit alpha [Source:ZF... [more]
mccc11.298e-16440.58methylcrotonoyl-CoA carboxylase 1 (alpha) [Source:... [more]
mccc19.060e-16440.44methylcrotonoyl-CoA carboxylase 1 (alpha) [Source:... [more]
pcxa3.657e-10942.86pyruvate carboxylase a [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCCA0.000e+059.34propionyl-CoA carboxylase subunit alpha [Source:NC... [more]
PCCA0.000e+059.34propionyl-CoA carboxylase subunit alpha [Source:NC... [more]
PCCA9.038e-1568.15propionyl-CoA carboxylase subunit alpha [Source:NC... [more]
PCCA2.380e-1471.23propionyl-CoA carboxylase subunit alpha [Source:NC... [more]
PCCA9.391e-1669.63propionyl-CoA carboxylase subunit alpha [Source:NC... [more]
back to top
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcca0.000e+059.33propionyl-Coenzyme A carboxylase, alpha polypeptid... [more]
Mccc19.032e-15939.77methylcrotonoyl-Coenzyme A carboxylase 1 (alpha) [... [more]
Pcx3.599e-11542.92pyruvate carboxylase [Source:MGI Symbol;Acc:MGI:97... [more]
Pcx3.599e-11542.92pyruvate carboxylase [Source:MGI Symbol;Acc:MGI:97... [more]
Pcx4.725e-11542.92pyruvate carboxylase [Source:MGI Symbol;Acc:MGI:97... [more]
back to top
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91ZA3|PCCA_MOUSE0.000e+059.33Propionyl-CoA carboxylase alpha chain, mitochondri... [more]
sp|P05165|PCCA_HUMAN0.000e+058.99Propionyl-CoA carboxylase alpha chain, mitochondri... [more]
sp|P14882|PCCA_RAT0.000e+058.61Propionyl-CoA carboxylase alpha chain, mitochondri... [more]
sp|P0DTA4|PCCA_PIG0.000e+057.96Propionyl-CoA carboxylase alpha chain, mitochondri... [more]
sp|Q19842|PCCA_CAEEL0.000e+058.69Propionyl-CoA carboxylase alpha chain, mitochondri... [more]
back to top
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GL115.124e-1371.06Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H6330.000e+071.06Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267FX900.000e+071.06Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8G7U70.000e+070.64Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267F5350.000e+070.64Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcca0.000e+058.85propionyl-CoA carboxylase subunit alpha [Source:ZF... [more]
pcca0.000e+058.09propionyl-CoA carboxylase subunit alpha [Source:ZF... [more]
mccc18.257e-15451.12methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gen... [more]
pcxb8.603e-10541.96pyruvate carboxylase b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
pcxb3.764e-9642.65pyruvate carboxylase b [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcca1.357e-17267.61propionyl-CoA carboxylase subunit alpha [Source:ZF... [more]
ENSPMAT00000006351.13.144e-9242.98pep scaffold:Pmarinus_7.0:GL476470:805693:813506:1... [more]
ENSPMAT00000006346.11.394e-9143.54pep scaffold:Pmarinus_7.0:GL476470:805110:813016:1... [more]
ENSPMAT00000001516.13.629e-6428.21pep scaffold:Pmarinus_7.0:GL477673:133580:241371:-... [more]
ENSPMAT00000006397.16.684e-1142.86pep scaffold:Pmarinus_7.0:GL476470:932002:942971:-... [more]
back to top
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DUR1,21.747e-10441.08Urea amidolyase; contains both urea carboxylase an... [more]
PYC21.100e-9938.41Pyruvate carboxylase isoform; cytoplasmic enzyme t... [more]
PYC15.793e-9738.41Pyruvate carboxylase isoform; cytoplasmic enzyme t... [more]
HFA11.309e-7930.29Mitochondrial acetyl-coenzyme A carboxylase; catal... [more]
ACC14.262e-7428.31Acetyl-CoA carboxylase, biotin containing enzyme; ... [more]
back to top
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO353850.000e+054.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO447791.411e-15539.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO351686.025e-14246.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484842.007e-11139.26Pyruvate carboxylase [Source:UniProtKB/TrEMBL;Acc... [more]
EDO484837.332e-10740.04Pyruvate carboxylase [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcca0.000e+058.70propionyl-CoA carboxylase subunit alpha [Source:NC... [more]
mccc13.755e-15649.18methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gen... [more]
mccc14.420e-15651.22methylcrotonoyl-CoA carboxylase 1 [Source:NCBI gen... [more]
pcxb3.385e-9137.79pyruvate carboxylase [Source:NCBI gene;Acc:1011705... [more]
acacb3.012e-6230.97acetyl-CoA carboxylase beta [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Propionyl-CoA carboxylase alpha chain, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034830.10.000e+0100.00SMESG000034830.1[more]
SMESG000034830.10.000e+098.75SMESG000034830.1[more]
SMESG000025178.12.582e-13737.75SMESG000025178.1[more]
SMESG000025190.13.213e-13637.18SMESG000025190.1[more]
SMESG000025178.13.043e-12336.57SMESG000025178.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031468 ID=SMED30031468|Name=Propionyl-CoA carboxylase alpha chain, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=2582bp
GATTACATTGTTTTAGTTAACGCGTAATATTTCGATAATTTTAAGCAATC
TGCAGTGATCACGTACCAAATGCTTCGAATAAAATGTTTCATTTCGCTTC
CTACTCTTCATGGGAGTAGCAATAAATTTTCCTCTGCTGCTCGTAATATT
TATTGGAATGATAAACATGACCCCAAAGAAACAAAATTCAAAAAAATATT
GATTGCCAATCGAGGAGAAATTGCTTGTAGAATTATCAATTCTTGCAAAC
GTTTTGGTATTAAAGCAGTTGCAGTTCACAGTGATGTTGATGCTTTGAGT
CGTTTTGTTCAAATGGCCGATGAGGCGATTTGTATAGGGCCAGCTCAGAC
ATCATTGAGCTATCTAAATATGGAAAAAATCTTAGATGCAGTTAAACAGA
CAGGAGCTGAAGCAGTTCATCCTGGATATGGGTTTCTTTCAGAAAACACA
GTTTTCGCTAAAAAACTAGAAGATATGAATGTTGTTTTCCTGGGTCCCAA
TTCTAAAGCCATTCATAGCATGGGAGATAAAATTGAAAGTAAAAGAATTG
CCAACGCAGCAAAAGTCCATTGTATTCCCGGCTATGATGGAGAAATCAAC
GATACAGACGAAGCCATTAAAATTGCTAATCAAATTGGATATCCGGTAAT
GATTAAAGCGTCCGCCGGTGGAGGGGGTAAGGGTATGCGCATTGCGTGGA
ACGACAAAGAAGCAGTCGAGGGATATAAATTAAGTCGCGCTGAGGCGAAA
TCAAGTTTTGGAGACGATAGAATGCTCATTGAAAAATACATTAATAAGCC
AAGGCACATCGAGATTCAAATAATGTGTGATAAACACGGCAATGCTCTCT
ATTTAAACGAACGTGAATGCTCTATTCAACGGAGAAACCAAAAAGTCATC
GAAGAAGCCCCATCAACATTTATTAATCCCGAAACTAGAAAAGCCATGGG
AGAACAAGCGGTTCAAATGGCAAAAGCGGTTGGATATGATTCTGCTGGTA
CAGTGGAATTTCTGGTTGATGATAAAAGGAATTTCTATTTCCTCGAAATG
AATACTCGTTTGCAAGTTGAACATCCGATTTCGGAATTAATTACCGGAGT
TGATATCGTCCATCAGATGTTTAGGGTCGGTAAAGGACATCCTCTACTTC
TTAAGCAGAGTGACATTTCCGTTAATGGATGGGCTGTGGAATGTAGAGTG
TATGCCGAAGATCCATATAAAAGTTTTGGGTTACCATCAGTAGGTAGATT
AACATCATACAAGGAGCCTTTACATCTACCAAATGTCAGATGTGACAGTG
GGATACAGGAAGGATCTGAGATTTCAATTTACTATGATCCAATGATTTGT
AAGTTAGTCACTTATGGAGAAGATAGATCGAAGGCCTTGGCAACTATGGT
CAAGGCACTGGATTCTTATGTTATTAGAGGTGTCACTCATAATATACCGT
TATTGAGAGACATTGTTACTGAGCCTCGTTTTGTCAGTGGCAACATTACA
ACAAATTATCTCCCAGAAGTATATCCAGACGGATTTAAAGGCAAGCAATT
AACTCCTAAAGAAACGGGTTTATTAGAAGCTATGTCTGCGGTTGTTTTTG
TGAAAAACGAGATTAGAAACAAAACCTTTTTGAAGAAAGACAGAAGTTTA
CTTATCGCAGAGAAATCGGAATCATTCCGAGGAGATCTTTCACACCCAGA
AGAATGGCATCTATCCATTTCACATGGATTGGAAAGTCAAGATAAAACAC
AAAATGTTCACGTATCTGTAGATTTTGACCGTTCACATTTCACTGTTAAC
TTTGAAAGTGGGAATTCATTTAGAATTGCAAATAATTTTCACTTGGCGGA
TAAAATTATCACACAAAATATTGATAATGACGAAATTATTCTGCAATTAA
TGAGTCGCAATTACAGTGGATATATAACCTTTCAATACATGGGCACTAAG
TATAAACTAAAGGTCGAATCGATAATCGGCCATAAACTTAGTAAATTCAT
GTTGCCTAAGAAAGTGGTTGACACAAGTTCTGTAATTATTGCTCCAATGC
CGGGATTGGTCAAAACGGTTTCAGTTAAAGTCGGACAAAGGGTCAGTGAC
GGTCAGGAATTGTGTGTCCTAGAAGCCATGAAAATGCAAAATAGTATGGT
AGCTGCAAAAGCTGGCGTGATAAAAGCTGTTCATTTTCAACCGGGGCAAA
CCGTTTCTGATGGGGATATTATTATCGAGTTGGAATGAAAATCAACTGCG
AGTTATTCGCATTGTAAACTATTCTTTAGTCATTATAATTGACTGTGCTA
GTGCTGCTTTTTCAATTTACTAACAAATTAATCCTCCTATAAATACCGAT
CTGAAATTTAGCCAATGCATTATTTGATATTATTGTTAGAAATTTGTATT
TCATTTGTGATTTTTCAAAAATATATATCACGTTGTTTATATGTTCTCTG
AGTTCCATAGTTTTTTCATTTATAATACTTCTATGCTTTCAATGTGGTTT
TGTCTCGTATTTATTTTATATAGTTATATTGCAATCACTATATTTGTGTG
TGCATGATTGTGTAATAAATTTTATGGACTTC
back to top

protein sequence of SMED30031468-orf-1

>SMED30031468-orf-1 ID=SMED30031468-orf-1|Name=SMED30031468-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=723bp
MLRIKCFISLPTLHGSSNKFSSAARNIYWNDKHDPKETKFKKILIANRGE
IACRIINSCKRFGIKAVAVHSDVDALSRFVQMADEAICIGPAQTSLSYLN
MEKILDAVKQTGAEAVHPGYGFLSENTVFAKKLEDMNVVFLGPNSKAIHS
MGDKIESKRIANAAKVHCIPGYDGEINDTDEAIKIANQIGYPVMIKASAG
GGGKGMRIAWNDKEAVEGYKLSRAEAKSSFGDDRMLIEKYINKPRHIEIQ
IMCDKHGNALYLNERECSIQRRNQKVIEEAPSTFINPETRKAMGEQAVQM
AKAVGYDSAGTVEFLVDDKRNFYFLEMNTRLQVEHPISELITGVDIVHQM
FRVGKGHPLLLKQSDISVNGWAVECRVYAEDPYKSFGLPSVGRLTSYKEP
LHLPNVRCDSGIQEGSEISIYYDPMICKLVTYGEDRSKALATMVKALDSY
VIRGVTHNIPLLRDIVTEPRFVSGNITTNYLPEVYPDGFKGKQLTPKETG
LLEAMSAVVFVKNEIRNKTFLKKDRSLLIAEKSESFRGDLSHPEEWHLSI
SHGLESQDKTQNVHVSVDFDRSHFTVNFESGNSFRIANNFHLADKIITQN
IDNDEIILQLMSRNYSGYITFQYMGTKYKLKVESIIGHKLSKFMLPKKVV
DTSSVIIAPMPGLVKTVSVKVGQRVSDGQELCVLEAMKMQNSMVAAKAGV
IKAVHFQPGQTVSDGDIIIELE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000101muscle cell
PLANA:0000110pharynx progenitor cell
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR041265PCC_BT
IPR005482Biotin_COase_C
IPR013816ATP_grasp_subdomain_2
IPR016185PreATP-grasp_dom_sf
IPR005479CbamoylP_synth_lsu-like_ATP-bd
IPR013815ATP_grasp_subdomain_1
IPR000089Biotin_lipoyl
IPR005481BC-like_N
IPR001882Biotin_BS
IPR011761ATP-grasp
IPR011764Biotin_carboxylation_dom
IPR011053Single_hybrid_motif
IPR011054Rudment_hybrid_motif
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0003824catalytic activity
GO:0046872metal ion binding
GO:0004075biotin carboxylase activity
GO:0000166nucleotide binding
GO:0016874ligase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005482Biotin carboxylase, C-terminalSMARTSM00878Biotin_carb_C_2coord: 374..482
e-value: 1.3E-48
score: 177.5
IPR005482Biotin carboxylase, C-terminalPFAMPF02785Biotin_carb_Ccoord: 374..482
e-value: 1.4E-34
score: 118.4
IPR013815ATP-grasp fold, subdomain 1GENE3DG3DSA:3.30.1490.20coord: 170..240
e-value: 1.9E-31
score: 109.7
NoneNo IPR availableGENE3DG3DSA:2.40.50.100coord: 656..722
e-value: 3.0E-21
score: 77.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.20coord: 28..169
e-value: 3.6E-52
score: 178.2
NoneNo IPR availableGENE3DG3DSA:3.30.470.20coord: 241..486
e-value: 1.1E-106
score: 357.5
NoneNo IPR availablePANTHERPTHR18866CARBOXYLASE:PYRUVATE/ACETYL-COA/PROPIONYL-COA CARBOXYLASEcoord: 21..722
NoneNo IPR availablePANTHERPTHR18866:SF104PROPIONYL-COA CARBOXYLASE ALPHA CHAIN, MITOCHONDRIALcoord: 21..722
NoneNo IPR availableCDDcd06850biotinyl_domaincoord: 655..721
e-value: 3.26541E-26
score: 99.7979
NoneNo IPR availableSUPERFAMILYSSF56059Glutathione synthetase ATP-binding domain-likecoord: 121..389
IPR005479Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domainPFAMPF02786CPSase_L_D2coord: 153..359
e-value: 2.1E-80
score: 269.2
IPR005479Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domainPROSITEPS00866CPSASE_1coord: 191..205
IPR005479Carbamoyl-phosphate synthetase large subunit-like, ATP-binding domainPROSITEPS00867CPSASE_2coord: 324..331
IPR005481Biotin carboxylase-like, N-terminal domainPFAMPF00289Biotin_carb_Ncoord: 40..148
e-value: 1.2E-42
score: 144.9
IPR041265Propionyl-coenzyme A carboxylase, BT domainPFAMPF18140PCC_BTcoord: 503..647
e-value: 7.9E-17
score: 61.8
IPR000089Biotin/lipoyl attachmentPFAMPF00364Biotin_lipoylcoord: 656..721
e-value: 5.0E-17
score: 61.5
IPR000089Biotin/lipoyl attachmentPROSITEPS50968BIOTINYL_LIPOYLcoord: 646..722
score: 24.273
IPR001882Biotin-binding sitePROSITEPS00188BIOTINcoord: 678..695
IPR011764Biotin carboxylation domainPROSITEPS50979BCcoord: 39..486
score: 52.88
IPR011761ATP-grasp foldPROSITEPS50975ATP_GRASPcoord: 158..355
score: 43.888
IPR016185Pre-ATP-grasp domain superfamilySUPERFAMILYSSF52440PreATP-grasp domaincoord: 18..151
IPR011054Rudiment single hybrid motifSUPERFAMILYSSF51246Rudiment single hybrid motifcoord: 369..485
IPR011053Single hybrid motifSUPERFAMILYSSF51230Single hybrid motifcoord: 643..722