VASA-1

Overview
NameVASA-1 (AFD29608.1)
Smed IDSMED30031463
Length (bp)2964
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of VASA-1 (SMED30031463) t-SNE clustered cells

Violin plots show distribution of expression levels for VASA-1 (SMED30031463) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of VASA-1 (SMED30031463) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for VASA-1 (SMED30031463) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031463

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 24

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031463SMESG000067941.1 SmedASXL_006346SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30031463SMESG000067941.1 SmedASXL_006346SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30031463SMESG000067941.1 dd_Smed_v4_1985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031463SMESG000067941.1 dd_Smed_v4_1985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031463SMESG000067941.1 dd_Smed_v4_1985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031463SMESG000067941.1 dd_Smed_v4_1985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031463SMESG000067941.1 dd_Smed_v4_1985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031463SMESG000067941.1 dd_Smed_v4_1985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031463SMESG000067941.1 dd_Smed_v4_1985_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031463SMESG000067941.1 Contig54171uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031463SMESG000067941.1 Contig54171newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
X1 cellSMED30031463SMESG000067941.1 JQ425140.1smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30031463SMESG000067941.1 JQ425140.1smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30031463SMESG000067941.1 dd_Smed_v6_1985_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30031463SMESG000067941.1 dd_Smed_v4_1985_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
testisSMED30031463SMESG000067941.1 JQ425140.1smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
male germ cellSMED30031463SMESG000067941.1 JQ425140.1smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30031463SMESG000067941.1 KU852684smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
male germ cellSMED30031463SMESG000067941.1 KU852684smed_ncbi_20200123PMID:27330085
Iyer et al., 2016
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
neoblastSMED30031463SMESG000067941.1 JQ425140.1smed_ncbi_20200123PMID:27523733
Lei et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30031463SMESG000067941.1 SMED_00256_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30031463SMESG000067941.1 SMED_00256_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30031463SMESG000067941.1 SmWIOct06_014371GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30031463SMESG000067941.1 SMED30031463smed_20140614PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of VASA-1 vs. Ensembl Human
Match: DDX4 (DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:18700])

HSP 1 Score: 414.846 bits (1065), Expect = 3.191e-133
Identity = 230/463 (49.68%), Postives = 290/463 (62.63%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDG------SGSRMANY--SRDTRKNVK-------SSKYIDNPTDD 2777
            H  +GINFD YD I VEV+G D PPA+ TF   +L + L +N+    YTKLTPVQKY+IPII + RDLMACAQTGSGKTAAFL+PI+  +  +G T S    +  P+ +I+APTREL  QI+  AR    G+ ++   IYGG ++  S R I   GC+IL ATPGRL+  +    + L+ +++ VLDEADRMLD  GF   + K+ +       ++  Q  MFSATFP EIQ LA   LK NYLF+AVG VG A  DV+Q ++Q  Q  K    +E ++ I DE+T++FVE+K+ ADF+   L       T+IHGDREQ +RE AL DF+ G+   +VAT+VAARGLDI  V +VIN D+P TID YVHRIGRTGRCGN GRAISFFD   D  LAQ LV  L +A Q+ P WL  +         SGS   N   S DTRK          SS    NP DD
Sbjct:  112 HYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQI-VQGCNILCATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDM-GFGPEMKKLISCPGMPSKEQR-QTLMFSATFPEEIQRLAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDD 571          
BLAST of VASA-1 vs. Ensembl Human
Match: DDX4 (DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:18700])

HSP 1 Score: 414.461 bits (1064), Expect = 1.337e-131
Identity = 230/463 (49.68%), Postives = 290/463 (62.63%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC------DGSGSRMANY--SRDTRKNVK-------SSKYIDNPTDD 2777
            H  +GINFD YD I VEV+G D PPA+ TF   +L + L +N+    YTKLTPVQKY+IPII + RDLMACAQTGSGKTAAFL+PI+  +  +G T S    +  P+ +I+APTREL  QI+  AR    G+ ++   IYGG ++  S R I   GC+IL ATPGRL+  +    + L+ +++ VLDEADRMLD  GF   + K+ +       ++  Q  MFSATFP EIQ LA   LK NYLF+AVG VG A  DV+Q ++Q  Q  K    +E ++ I DE+T++FVE+K+ ADF+   L       T+IHGDREQ +RE AL DF+ G+   +VAT+VAARGLDI  V +VIN D+P TID YVHRIGRTGRCGN GRAISFFD   D  LAQ LV  L +A Q+ P WL  +         SGS   N   S DTRK          SS    NP DD
Sbjct:  227 HYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQI-VQGCNILCATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDM-GFGPEMKKLISCPGMPSKEQR-QTLMFSATFPEEIQRLAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDD 686          
BLAST of VASA-1 vs. Ensembl Human
Match: DDX4 (DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:18700])

HSP 1 Score: 414.461 bits (1064), Expect = 1.337e-131
Identity = 230/463 (49.68%), Postives = 290/463 (62.63%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC------DGSGSRMANY--SRDTRKNVK-------SSKYIDNPTDD 2777
            H  +GINFD YD I VEV+G D PPA+ TF   +L + L +N+    YTKLTPVQKY+IPII + RDLMACAQTGSGKTAAFL+PI+  +  +G T S    +  P+ +I+APTREL  QI+  AR    G+ ++   IYGG ++  S R I   GC+IL ATPGRL+  +    + L+ +++ VLDEADRMLD  GF   + K+ +       ++  Q  MFSATFP EIQ LA   LK NYLF+AVG VG A  DV+Q ++Q  Q  K    +E ++ I DE+T++FVE+K+ ADF+   L       T+IHGDREQ +RE AL DF+ G+   +VAT+VAARGLDI  V +VIN D+P TID YVHRIGRTGRCGN GRAISFFD   D  LAQ LV  L +A Q+ P WL  +         SGS   N   S DTRK          SS    NP DD
Sbjct:  227 HYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQI-VQGCNILCATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDM-GFGPEMKKLISCPGMPSKEQR-QTLMFSATFPEEIQRLAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDD 686          
BLAST of VASA-1 vs. Ensembl Human
Match: DDX4 (DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:18700])

HSP 1 Score: 414.461 bits (1064), Expect = 2.385e-131
Identity = 230/463 (49.68%), Postives = 290/463 (62.63%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC------DGSGSRMANY--SRDTRKNVK-------SSKYIDNPTDD 2777
            H  +GINFD YD I VEV+G D PPA+ TF   +L + L +N+    YTKLTPVQKY+IPII + RDLMACAQTGSGKTAAFL+PI+  +  +G T S    +  P+ +I+APTREL  QI+  AR    G+ ++   IYGG ++  S R I   GC+IL ATPGRL+  +    + L+ +++ VLDEADRMLD  GF   + K+ +       ++  Q  MFSATFP EIQ LA   LK NYLF+AVG VG A  DV+Q ++Q  Q  K    +E ++ I DE+T++FVE+K+ ADF+   L       T+IHGDREQ +RE AL DF+ G+   +VAT+VAARGLDI  V +VIN D+P TID YVHRIGRTGRCGN GRAISFFD   D  LAQ LV  L +A Q+ P WL  +         SGS   N   S DTRK          SS    NP DD
Sbjct:  241 HYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQI-VQGCNILCATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDM-GFGPEMKKLISCPGMPSKEQR-QTLMFSATFPEEIQRLAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDD 700          
BLAST of VASA-1 vs. Ensembl Human
Match: DDX4 (DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:18700])

HSP 1 Score: 414.461 bits (1064), Expect = 3.977e-131
Identity = 230/463 (49.68%), Postives = 290/463 (62.63%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDG------SGSRMANY--SRDTRKNVK-------SSKYIDNPTDD 2777
            H  +GINFD YD I VEV+G D PPA+ TF   +L + L +N+    YTKLTPVQKY+IPII + RDLMACAQTGSGKTAAFL+PI+  +  +G T S    +  P+ +I+APTREL  QI+  AR    G+ ++   IYGG ++  S R I   GC+IL ATPGRL+  +    + L+ +++ VLDEADRMLD  GF   + K+ +       ++  Q  MFSATFP EIQ LA   LK NYLF+AVG VG A  DV+Q ++Q  Q  K    +E ++ I DE+T++FVE+K+ ADF+   L       T+IHGDREQ +RE AL DF+ G+   +VAT+VAARGLDI  V +VIN D+P TID YVHRIGRTGRCGN GRAISFFD   D  LAQ LV  L +A Q+ P WL  +         SGS   N   S DTRK          SS    NP DD
Sbjct:  261 HYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQI-VQGCNILCATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDM-GFGPEMKKLISCPGMPSKEQR-QTLMFSATFPEEIQRLAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDD 720          
BLAST of VASA-1 vs. Ensembl Celegans
Match: laf-1 (ATP-dependent RNA helicase laf-1 [Source:UniProtKB/Swiss-Prot;Acc:D0PV95])

HSP 1 Score: 368.237 bits (944), Expect = 4.768e-115
Identity = 194/423 (45.86%), Postives = 272/423 (64.30%), Query Frame = 3
Query: 1449 SGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVA--------FPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEK-TLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC 2687
            SGINFD Y++IPVE TGDDVP  ++ FS L L E++  N++   Y + TPVQKY+IP +   RDLM+CAQTGSGKTAAFL+P++ ++ ++G ++   +V         +P AL+++PTREL  QIF  +R     + I  A +YGG E  K + +    GC IL+ATPGRLI  ++   + +   ++ VLDEADRMLD  GF   + +I         +  I  +MFSATFP EIQ LA++ LK NY+FLAVG VGS + ++ Q+I+  ++ EK +  ++ +    D   TL+FVE+KR A  +   L    ++  TIHGD +Q +RE  L+ F++G    +VAT VAARGLDIP V +VIN D+P  +D YVHRIGRTGR GNVG A SFF++ K+  +A+ L+  + EANQE PDWL  + 
Sbjct:  142 SGINFDKYEEIPVEATGDDVPQPISLFSDLSLHEWIEENIKTAGYDRPTPVQKYSIPALQGGRDLMSCAQTGSGKTAAFLVPLVNAILQDGPDAVHRSVTSSGGRKKQYPSALVLSPTRELSLQIFNESRKFAYRTPITSALLYGGRENYKDQIHKLRLGCHILIATPGRLIDVMDQGLIGMEGCRYLVLDEADRMLDM-GFEPQIRQIVECNRMPSKEERI-TAMFSATFPKEIQLLAQDFLKENYVFLAVGRVGSTSENIMQKIVWVEEDEKRSYLMDLLDATGDSSLTLVFVETKRGASDLAYYLNRQNYEVVTIHGDLKQFEREKHLDLFRTGTAPILVATAVAARGLDIPNVKHVINYDLPSDVDEYVHRIGRTGRVGNVGLATSFFND-KNRNIARELMDLIVEANQELPDWLEGMS 561          
BLAST of VASA-1 vs. Ensembl Celegans
Match: laf-1 (ATP-dependent RNA helicase laf-1 [Source:UniProtKB/Swiss-Prot;Acc:D0PV95])

HSP 1 Score: 369.007 bits (946), Expect = 1.555e-114
Identity = 194/423 (45.86%), Postives = 272/423 (64.30%), Query Frame = 3
Query: 1449 SGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVA--------FPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEK-TLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC 2687
            SGINFD Y++IPVE TGDDVP  ++ FS L L E++  N++   Y + TPVQKY+IP +   RDLM+CAQTGSGKTAAFL+P++ ++ ++G ++   +V         +P AL+++PTREL  QIF  +R     + I  A +YGG E  K + +    GC IL+ATPGRLI  ++   + +   ++ VLDEADRMLD  GF   + +I         +  I  +MFSATFP EIQ LA++ LK NY+FLAVG VGS + ++ Q+I+  ++ EK +  ++ +    D   TL+FVE+KR A  +   L    ++  TIHGD +Q +RE  L+ F++G    +VAT VAARGLDIP V +VIN D+P  +D YVHRIGRTGR GNVG A SFF++ K+  +A+ L+  + EANQE PDWL  + 
Sbjct:  207 SGINFDKYEEIPVEATGDDVPQPISLFSDLSLHEWIEENIKTAGYDRPTPVQKYSIPALQGGRDLMSCAQTGSGKTAAFLVPLVNAILQDGPDAVHRSVTSSGGRKKQYPSALVLSPTRELSLQIFNESRKFAYRTPITSALLYGGRENYKDQIHKLRLGCHILIATPGRLIDVMDQGLIGMEGCRYLVLDEADRMLDM-GFEPQIRQIVECNRMPSKEERI-TAMFSATFPKEIQLLAQDFLKENYVFLAVGRVGSTSENIMQKIVWVEEDEKRSYLMDLLDATGDSSLTLVFVETKRGASDLAYYLNRQNYEVVTIHGDLKQFEREKHLDLFRTGTAPILVATAVAARGLDIPNVKHVINYDLPSDVDEYVHRIGRTGRVGNVGLATSFFND-KNRNIARELMDLIVEANQELPDWLEGMS 626          
BLAST of VASA-1 vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 348.206 bits (892), Expect = 1.698e-107
Identity = 197/436 (45.18%), Postives = 271/436 (62.16%), Query Frame = 3
Query: 1410 PDDNQEDYELH-VNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG---TESPASA----VAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEK-TLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC 2687
            P +  E    H  +SGINFD Y+ IPVEV+GD VP A+  F+       +  NV    Y+K TPVQK++IP + + RDLM+CAQTGSGKTAAFL+PII+ +   G    + PA        +P AL+++PTREL  QI   A      SNI+ A +YGG E  + + N    G  IL+ATPGRLI  +E  ++ L   ++ VLDEADRMLD  GF   + KI  +       R+   +MFSATFP EIQ LA++ LK NY+FLAVG VGS + +++Q ++  ++ EK +  +E +     E   L+FVE+KR A+ +   L     ++ +IHGD +Q +RE  L  F+SG+   +VAT VAARGLDIP V +VIN D+P   D YVHRIGRTGRCGN+G A SFF++ K+ G+ + L + + E+NQE P+WL  + 
Sbjct:   85 PAEYSESNLFHRTDSGINFDKYENIPVEVSGDSVPAAIEHFNEAGFGPAVMENVNRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDM-GFEPQIRKIVGQGMPPKTARTT--AMFSATFPKEIQVLAKDFLKDNYIFLAVGRVGSTSENIEQRLLWVNEMEKRSNLMEILMNEHSENLVLVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFFND-KNRGIGRDLKNLIVESNQEVPEWLHQVA 516          
BLAST of VASA-1 vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 348.206 bits (892), Expect = 1.698e-107
Identity = 197/436 (45.18%), Postives = 271/436 (62.16%), Query Frame = 3
Query: 1410 PDDNQEDYELH-VNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG---TESPASA----VAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEK-TLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC 2687
            P +  E    H  +SGINFD Y+ IPVEV+GD VP A+  F+       +  NV    Y+K TPVQK++IP + + RDLM+CAQTGSGKTAAFL+PII+ +   G    + PA        +P AL+++PTREL  QI   A      SNI+ A +YGG E  + + N    G  IL+ATPGRLI  +E  ++ L   ++ VLDEADRMLD  GF   + KI  +       R+   +MFSATFP EIQ LA++ LK NY+FLAVG VGS + +++Q ++  ++ EK +  +E +     E   L+FVE+KR A+ +   L     ++ +IHGD +Q +RE  L  F+SG+   +VAT VAARGLDIP V +VIN D+P   D YVHRIGRTGRCGN+G A SFF++ K+ G+ + L + + E+NQE P+WL  + 
Sbjct:   85 PAEYSESNLFHRTDSGINFDKYENIPVEVSGDSVPAAIEHFNEAGFGPAVMENVNRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDM-GFEPQIRKIVGQGMPPKTARTT--AMFSATFPKEIQVLAKDFLKDNYIFLAVGRVGSTSENIEQRLLWVNEMEKRSNLMEILMNEHSENLVLVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFFND-KNRGIGRDLKNLIVESNQEVPEWLHQVA 516          
BLAST of VASA-1 vs. Ensembl Celegans
Match: vbh-1 (Vasa-and Belle-like Helicase [Source:UniProtKB/TrEMBL;Acc:Q65XX1])

HSP 1 Score: 348.206 bits (892), Expect = 1.698e-107
Identity = 197/436 (45.18%), Postives = 271/436 (62.16%), Query Frame = 3
Query: 1410 PDDNQEDYELH-VNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG---TESPASA----VAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEK-TLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC 2687
            P +  E    H  +SGINFD Y+ IPVEV+GD VP A+  F+       +  NV    Y+K TPVQK++IP + + RDLM+CAQTGSGKTAAFL+PII+ +   G    + PA        +P AL+++PTREL  QI   A      SNI+ A +YGG E  + + N    G  IL+ATPGRLI  +E  ++ L   ++ VLDEADRMLD  GF   + KI  +       R+   +MFSATFP EIQ LA++ LK NY+FLAVG VGS + +++Q ++  ++ EK +  +E +     E   L+FVE+KR A+ +   L     ++ +IHGD +Q +RE  L  F+SG+   +VAT VAARGLDIP V +VIN D+P   D YVHRIGRTGRCGN+G A SFF++ K+ G+ + L + + E+NQE P+WL  + 
Sbjct:   85 PAEYSESNLFHRTDSGINFDKYENIPVEVSGDSVPAAIEHFNEAGFGPAVMENVNRSGYSKPTPVQKHSIPTLLANRDLMSCAQTGSGKTAAFLLPIIQHILAGGPDMVKPPAFTNGRRTYYPCALVLSPTRELAIQIHKEATKFSYKSNIQTAILYGGRENYRDQVNRLRAGTHILIATPGRLIDIIEQGFIGLAGCRYLVLDEADRMLDM-GFEPQIRKIVGQGMPPKTARTT--AMFSATFPKEIQVLAKDFLKDNYIFLAVGRVGSTSENIEQRLLWVNEMEKRSNLMEILMNEHSENLVLVFVETKRGANELAYFLNRQQIRSVSIHGDLKQIERERNLELFRSGQCPILVATAVAARGLDIPNVRHVINYDLPGDSDEYVHRIGRTGRCGNLGIATSFFND-KNRGIGRDLKNLIVESNQEVPEWLHQVA 516          
BLAST of VASA-1 vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445187)

HSP 1 Score: 376.326 bits (965), Expect = 1.057e-117
Identity = 206/445 (46.29%), Postives = 274/445 (61.57%), Query Frame = 3
Query: 1392 KRATFIP----DDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMAN 2714
            KR  +IP    +D  E +   + SGI+F  Y+ IPV+VTG DVP  +  F+S  L + +  NV    Y   TP+QK +IP+I S RDLMACAQTGSGKTAAFL+PI+  L E+  E     +  P+ +I++PTREL  QIF  AR     S +K   +YGG         I   GC +++ATPGRL+ F++  +++    +F VLDEADRMLD  GF E + +I        + +++   MFSATFP EIQ +A   LKNY+F+A+G+VG A SDVKQ I + ++  K +  IE +    D  T++FVE+KR ADF+   L    F  T+IHGDR Q QRE AL DFK+G +  ++AT+VA+RGLDI  + +VIN DMP  ID YVHRIGRTGR GN GRA SFFD  KD  +A  LV  L+ + Q  PD+LR    G     +N
Sbjct:  198 KREFYIPPEPSNDAIEIFSSGIASGIHFSKYNNIPVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHEL---ELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECI-TRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDM-GFSEDMRRIMTHVTMRPEHQTL---MFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQAD-GTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFLRTCGAGGDGGYSN 633          
BLAST of VASA-1 vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445185)

HSP 1 Score: 376.326 bits (965), Expect = 1.057e-117
Identity = 206/445 (46.29%), Postives = 274/445 (61.57%), Query Frame = 3
Query: 1392 KRATFIP----DDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMAN 2714
            KR  +IP    +D  E +   + SGI+F  Y+ IPV+VTG DVP  +  F+S  L + +  NV    Y   TP+QK +IP+I S RDLMACAQTGSGKTAAFL+PI+  L E+  E     +  P+ +I++PTREL  QIF  AR     S +K   +YGG         I   GC +++ATPGRL+ F++  +++    +F VLDEADRMLD  GF E + +I        + +++   MFSATFP EIQ +A   LKNY+F+A+G+VG A SDVKQ I + ++  K +  IE +    D  T++FVE+KR ADF+   L    F  T+IHGDR Q QRE AL DFK+G +  ++AT+VA+RGLDI  + +VIN DMP  ID YVHRIGRTGR GN GRA SFFD  KD  +A  LV  L+ + Q  PD+LR    G     +N
Sbjct:  198 KREFYIPPEPSNDAIEIFSSGIASGIHFSKYNNIPVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHEL---ELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECI-TRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDM-GFSEDMRRIMTHVTMRPEHQTL---MFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQAD-GTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFLRTCGAGGDGGYSN 633          
BLAST of VASA-1 vs. Ensembl Fly
Match: vas (gene:FBgn0283442 transcript:FBtr0445186)

HSP 1 Score: 376.326 bits (965), Expect = 1.057e-117
Identity = 206/445 (46.29%), Postives = 274/445 (61.57%), Query Frame = 3
Query: 1392 KRATFIP----DDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMAN 2714
            KR  +IP    +D  E +   + SGI+F  Y+ IPV+VTG DVP  +  F+S  L + +  NV    Y   TP+QK +IP+I S RDLMACAQTGSGKTAAFL+PI+  L E+  E     +  P+ +I++PTREL  QIF  AR     S +K   +YGG         I   GC +++ATPGRL+ F++  +++    +F VLDEADRMLD  GF E + +I        + +++   MFSATFP EIQ +A   LKNY+F+A+G+VG A SDVKQ I + ++  K +  IE +    D  T++FVE+KR ADF+   L    F  T+IHGDR Q QRE AL DFK+G +  ++AT+VA+RGLDI  + +VIN DMP  ID YVHRIGRTGR GN GRA SFFD  KD  +A  LV  L+ + Q  PD+LR    G     +N
Sbjct:  198 KREFYIPPEPSNDAIEIFSSGIASGIHFSKYNNIPVKVTGSDVPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHEL---ELGRPQVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECI-TRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLDEADRMLDM-GFSEDMRRIMTHVTMRPEHQTL---MFSATFPEEIQRMAGEFLKNYVFVAIGIVGGACSDVKQTIYEVNKYAKRSKLIEILSEQAD-GTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLDIKNIKHVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFFDPEKDRAIAADLVKILEGSGQTVPDFLRTCGAGGDGGYSN 633          
BLAST of VASA-1 vs. Ensembl Fly
Match: bel (gene:FBgn0263231 transcript:FBtr0081888)

HSP 1 Score: 353.599 bits (906), Expect = 1.119e-107
Identity = 197/432 (45.60%), Postives = 264/432 (61.11%), Query Frame = 3
Query: 1446 NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAV-------AFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEII---QSDQREKVNTAIEYIKTIP----DEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSG 2699
            N+GINFD Y+ IPVE TG +VPP + +F  + L E + +NV   +Y K TPVQK+AIPII + RDLMACAQTGSGKTAAFL+PI+  + E G   P  +         +P  L++APTREL  QIF  A+     S ++ A +YGG   ++  R +   GC ++VATPGRL   +    + L  ++F VLDEADRMLD  GF   + +I  + N     +  Q  MFSATFP +IQ LA + L NY+FLAVG VGS + ++ Q I+   + D+R  +   +  I+  P    D  TLIFVE+K+ AD +   L       T+IHGDR Q++RE AL  F+SG    +VAT VAARGLDIP V +VIN D+P  ++ YVHRIGRTGR GN+G A SFF+E K+  +   L+  L E  QE P ++  +    G
Sbjct:  270 NTGINFDKYEDIPVEATGQNVPPNITSFDDVQLTEIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPILNQMYELGHVPPPQSTRQYSRRKQYPLGLVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSEQMRELD-RGCHLIVATPGRLEDMITRGKVGLENIRFLVLDEADRMLDM-GFEPQIRRIVEQLNMPPTGQR-QTLMFSATFPKQIQELASDFLSNYIFLAVGRVGSTSENITQTILWVYEPDKRSYLLDLLSSIRDGPEYTKDSLTLIFVETKKGADSLEEFLYQCNHPVTSIHGDRTQKEREEALRCFRSGDCPILVATAVAARGLDIPHVKHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNE-KNRNICSDLLELLIETKQEIPSFMEDMSSDRG 697          
BLAST of VASA-1 vs. Ensembl Fly
Match: bel (gene:FBgn0263231 transcript:FBtr0334319)

HSP 1 Score: 353.599 bits (906), Expect = 1.277e-107
Identity = 197/432 (45.60%), Postives = 264/432 (61.11%), Query Frame = 3
Query: 1446 NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAV-------AFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEII---QSDQREKVNTAIEYIKTIP----DEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSG 2699
            N+GINFD Y+ IPVE TG +VPP + +F  + L E + +NV   +Y K TPVQK+AIPII + RDLMACAQTGSGKTAAFL+PI+  + E G   P  +         +P  L++APTREL  QIF  A+     S ++ A +YGG   ++  R +   GC ++VATPGRL   +    + L  ++F VLDEADRMLD  GF   + +I  + N     +  Q  MFSATFP +IQ LA + L NY+FLAVG VGS + ++ Q I+   + D+R  +   +  I+  P    D  TLIFVE+K+ AD +   L       T+IHGDR Q++RE AL  F+SG    +VAT VAARGLDIP V +VIN D+P  ++ YVHRIGRTGR GN+G A SFF+E K+  +   L+  L E  QE P ++  +    G
Sbjct:  270 NTGINFDKYEDIPVEATGQNVPPNITSFDDVQLTEIIRNNVALARYDKPTPVQKHAIPIIINGRDLMACAQTGSGKTAAFLVPILNQMYELGHVPPPQSTRQYSRRKQYPLGLVLAPTRELATQIFEEAKKFAYRSRMRPAVLYGGNNTSEQMRELD-RGCHLIVATPGRLEDMITRGKVGLENIRFLVLDEADRMLDM-GFEPQIRRIVEQLNMPPTGQR-QTLMFSATFPKQIQELASDFLSNYIFLAVGRVGSTSENITQTILWVYEPDKRSYLLDLLSSIRDGPEYTKDSLTLIFVETKKGADSLEEFLYQCNHPVTSIHGDRTQKEREEALRCFRSGDCPILVATAVAARGLDIPHVKHVINFDLPSDVEEYVHRIGRTGRMGNLGVATSFFNE-KNRNICSDLLELLIETKQEIPSFMEDMSSDRG 697          
BLAST of VASA-1 vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 390.963 bits (1003), Expect = 6.660e-123
Identity = 205/418 (49.04%), Postives = 273/418 (65.31%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTE-SPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANF-SGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRAL 2684
            H  +GINFD YD I V+V+G + P A+ TF    L + L+ NV    Y K TPVQK+ IPII + RDLMACAQTGSGKTAAFL+PI++    +G   S  S +  P+A+I+APTREL  QI+  AR    G+ ++   +YGGI    + R +   GC++L ATPGRL   +    + L  +++ VLDEADRMLD  GF   + K+       S ++R  Q  MFSAT+P +IQ +A + LK +Y+FLAVGVVG A SDV+Q I+Q DQ  K +  +E ++   +E+T++FVE+KR ADF+   L       T+IHGDREQ +RE AL+DF+ G+   +VAT+VAARGLDI +V +V+N DMP +ID YVHRIGRTGRCGN GRA+SFF+   D  LA+ LV  L  A Q  P WL  +
Sbjct:  221 HYATGINFDKYDDILVDVSGSNPPKAIMTFEEAGLCDSLSKNVSKSGYVKPTPVQKHGIPIISAGRDLMACAQTGSGKTAAFLLPILQRFMTDGVAASKFSEIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREV-LKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDM-GFEPEMRKLVASPGMPSKEER--QTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVGGACSDVEQTIVQVDQYSKRDQLLELLRATGNERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLARSLVKVLSGAQQVVPKWLEEV 634          
BLAST of VASA-1 vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 390.193 bits (1001), Expect = 1.342e-122
Identity = 205/418 (49.04%), Postives = 273/418 (65.31%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTE-SPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANF-SGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRAL 2684
            H  +GINFD YD I V+V+G + P A+ TF    L + L+ NV    Y K TPVQK+ IPII + RDLMACAQTGSGKTAAFL+PI++    +G   S  S +  P+A+I+APTREL  QI+  AR    G+ ++   +YGGI    + R +   GC++L ATPGRL   +    + L  +++ VLDEADRMLD  GF   + K+       S ++R  Q  MFSAT+P +IQ +A + LK +Y+FLAVGVVG A SDV+Q I+Q DQ  K +  +E ++   +E+T++FVE+KR ADF+   L       T+IHGDREQ +RE AL+DF+ G+   +VAT+VAARGLDI +V +V+N DMP +ID YVHRIGRTGRCGN GRA+SFF+   D  LA+ LV  L  A Q  P WL  +
Sbjct:  222 HYATGINFDKYDDILVDVSGSNPPKAIMTFEEAGLCDSLSKNVSKSGYVKPTPVQKHGIPIISAGRDLMACAQTGSGKTAAFLLPILQRFMTDGVAASKFSEIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREV-LKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDM-GFEPEMRKLVASPGMPSKEER--QTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVGGACSDVEQTIVQVDQYSKRDQLLELLRATGNERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLARSLVKVLSGAQQVVPKWLEEV 635          
BLAST of VASA-1 vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 390.193 bits (1001), Expect = 1.858e-122
Identity = 205/418 (49.04%), Postives = 273/418 (65.31%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTE-SPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANF-SGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRAL 2684
            H  +GINFD YD I V+V+G + P A+ TF    L + L+ NV    Y K TPVQK+ IPII + RDLMACAQTGSGKTAAFL+PI++    +G   S  S +  P+A+I+APTREL  QI+  AR    G+ ++   +YGGI    + R +   GC++L ATPGRL   +    + L  +++ VLDEADRMLD  GF   + K+       S ++R  Q  MFSAT+P +IQ +A + LK +Y+FLAVGVVG A SDV+Q I+Q DQ  K +  +E ++   +E+T++FVE+KR ADF+   L       T+IHGDREQ +RE AL+DF+ G+   +VAT+VAARGLDI +V +V+N DMP +ID YVHRIGRTGRCGN GRA+SFF+   D  LA+ LV  L  A Q  P WL  +
Sbjct:  233 HYATGINFDKYDDILVDVSGSNPPKAIMTFEEAGLCDSLSKNVSKSGYVKPTPVQKHGIPIISAGRDLMACAQTGSGKTAAFLLPILQRFMTDGVAASKFSEIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREV-LKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDM-GFEPEMRKLVASPGMPSKEER--QTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVGGACSDVEQTIVQVDQYSKRDQLLELLRATGNERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLARSLVKVLSGAQQVVPKWLEEV 646          
BLAST of VASA-1 vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 390.193 bits (1001), Expect = 1.910e-122
Identity = 205/418 (49.04%), Postives = 273/418 (65.31%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTE-SPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANF-SGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRAL 2684
            H  +GINFD YD I V+V+G + P A+ TF    L + L+ NV    Y K TPVQK+ IPII + RDLMACAQTGSGKTAAFL+PI++    +G   S  S +  P+A+I+APTREL  QI+  AR    G+ ++   +YGGI    + R +   GC++L ATPGRL   +    + L  +++ VLDEADRMLD  GF   + K+       S ++R  Q  MFSAT+P +IQ +A + LK +Y+FLAVGVVG A SDV+Q I+Q DQ  K +  +E ++   +E+T++FVE+KR ADF+   L       T+IHGDREQ +RE AL+DF+ G+   +VAT+VAARGLDI +V +V+N DMP +ID YVHRIGRTGRCGN GRA+SFF+   D  LA+ LV  L  A Q  P WL  +
Sbjct:  234 HYATGINFDKYDDILVDVSGSNPPKAIMTFEEAGLCDSLSKNVSKSGYVKPTPVQKHGIPIISAGRDLMACAQTGSGKTAAFLLPILQRFMTDGVAASKFSEIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREV-LKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDM-GFEPEMRKLVASPGMPSKEER--QTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVGGACSDVEQTIVQVDQYSKRDQLLELLRATGNERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLARSLVKVLSGAQQVVPKWLEEV 647          
BLAST of VASA-1 vs. Ensembl Zebrafish
Match: ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:ZFIN;Acc:ZDB-GENE-990415-272])

HSP 1 Score: 390.193 bits (1001), Expect = 3.443e-122
Identity = 205/418 (49.04%), Postives = 273/418 (65.31%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTE-SPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANF-SGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRAL 2684
            H  +GINFD YD I V+V+G + P A+ TF    L + L+ NV    Y K TPVQK+ IPII + RDLMACAQTGSGKTAAFL+PI++    +G   S  S +  P+A+I+APTREL  QI+  AR    G+ ++   +YGGI    + R +   GC++L ATPGRL   +    + L  +++ VLDEADRMLD  GF   + K+       S ++R  Q  MFSAT+P +IQ +A + LK +Y+FLAVGVVG A SDV+Q I+Q DQ  K +  +E ++   +E+T++FVE+KR ADF+   L       T+IHGDREQ +RE AL+DF+ G+   +VAT+VAARGLDI +V +V+N DMP +ID YVHRIGRTGRCGN GRA+SFF+   D  LA+ LV  L  A Q  P WL  +
Sbjct:  249 HYATGINFDKYDDILVDVSGSNPPKAIMTFEEAGLCDSLSKNVSKSGYVKPTPVQKHGIPIISAGRDLMACAQTGSGKTAAFLLPILQRFMTDGVAASKFSEIQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREV-LKGCNVLCATPGRLHDLIGRGKIGLSKVRYLVLDEADRMLDM-GFEPEMRKLVASPGMPSKEER--QTLMFSATYPEDIQRMAADFLKVDYIFLAVGVVGGACSDVEQTIVQVDQYSKRDQLLELLRATGNERTMVFVETKRSADFIATFLCQEKISTTSIHGDREQREREKALSDFRLGQCPVLVATSVAARGLDIEQVQHVVNFDMPSSIDEYVHRIGRTGRCGNTGRAVSFFNPESDTPLARSLVKVLSGAQQVVPKWLEEV 662          
BLAST of VASA-1 vs. Ensembl Xenopus
Match: polg2 (polymerase (DNA directed), gamma 2, accessory subunit [Source:Xenbase;Acc:XB-GENE-1009985])

HSP 1 Score: 405.986 bits (1042), Expect = 6.427e-129
Identity = 237/561 (42.25%), Postives = 329/561 (58.65%), Query Frame = 3
Query: 1116 NDSFARATKENG--ANNFESKKFRGNNDANNGFRNDEFDGNFQGKRNGNSNDFSTEFDRTVTLEENPAYSSKTFVRGQKQPEQ-TNQNDDAIPIVKRATFIP---DDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC-DGSGSRMANYSRDTRKNVKSSKYIDNPT 2771
            ND ++ +++ +G  AN    K FRG  D NN    +E    F     G  N+F ++                     +   E   NQ +     VK+  ++P    D+++D   H  SGINFD YD+I V+VTG DVPPA+ TF   +  E L+ NV    Y KLTPVQK++IPII + RDLMACAQTGSGKTAAFL+PI+  +   G T S    +  P+A+I+APTREL  QI+  AR    G+ ++   +YGGI    + R+++  GC+IL ATPGRL+  +    + L  L++ VLDEADRMLD  GF   +  +         +   Q  MFSAT+P EIQ LA   LK ++LF+ VG+VG A SDV+Q I++  +  K +  +E +++  +E+T+IFV +K+ AD +   L    F  T+IHGDREQ QRE A+ DF+SG+   +V T VAARGLDI  V +VIN D+P  ID YVHRIGRTGRCGNVG+A SFF+  +D  +A+ LV  L +A+QE P WL  +   G G+  + Y+ D+       KY+  P+
Sbjct:   83 NDQYSDSSERDGYNANEDTQKPFRGRGDWNNSGEGEERPRGFG---RGGFNNFDSDTGGRGHRGGRGGRGGYKGRNEEVGVESGKNQEEGTEKEVKKVIYVPLPPSDSEDDIFRHYQSGINFDKYDEILVDVTGKDVPPAILTFEEANFCETLSRNVTKAGYVKLTPVQKHSIPIILAGRDLMACAQTGSGKTAAFLLPILSHMMNEGITASQFLPLQEPQAIIIAPTRELINQIYLDARKFSYGTCVRPVVVYGGIHPVHAMRDVE-RGCNILCATPGRLMDIIGREKIGLSKLKYLVLDEADRMLDM-GFAPVMENLIGSPGMPAKEER-QTLMFSATYPAEIQRLASKFLKSDHLFVVVGLVGGACSDVEQTILEIQEYRKRDKLVEILQSSGNERTMIFVNTKKKADVIAGYLCQEHFPTTSIHGDREQCQREEAIRDFRSGKCPVIVCTAVAARGLDIENVQHVINYDVPKEIDEYVHRIGRTGRCGNVGKATSFFNVNEDHVVARPLVKILTDAHQEVPAWLEEIAFGGHGALNSLYAADSMGGEAGEKYVSAPS 637          
BLAST of VASA-1 vs. Ensembl Xenopus
Match: polg2 (polymerase (DNA directed), gamma 2, accessory subunit [Source:Xenbase;Acc:XB-GENE-1009985])

HSP 1 Score: 402.905 bits (1034), Expect = 1.883e-127
Identity = 219/476 (46.01%), Postives = 300/476 (63.03%), Query Frame = 3
Query: 1362 NQNDDAIPIVKRATFIP---DDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC-DGSGSRMANYSRDTRKNVKSSKYIDNPT 2771
            NQ +     VK+  ++P    D+++D   H  SGINFD YD+I V+VTG DVPPA+ TF   +  E L+ NV    Y KLTPVQK++IPII + RDLMACAQTGSGKTAAFL+PI+  +   G T S    +  P+A+I+APTREL  QI+  AR    G+ ++   +YGGI    + R+++  GC+IL ATPGRL+  +    + L  L++ VLDEADRMLD  GF   +  +         +   Q  MFSAT+P EIQ LA   LK ++LF+ VG+VG A SDV+Q I++  +  K +  +E +++  +E+T+IFV +K+ AD +   L    F  T+IHGDREQ QRE A+ DF+SG+   +V T VAARGLDI  V +VIN D+P  ID YVHRIGRTGRCGNVG+A SFF+  +D  +A+ LV  L +A+QE P WL  +   G G+  + Y+ D+       KY+  P+
Sbjct:  188 NQEEGTEKEVKKVIYVPLPPSDSEDDIFRHYQSGINFDKYDEILVDVTGKDVPPAILTFEEANFCETLSRNVTKAGYVKLTPVQKHSIPIILAGRDLMACAQTGSGKTAAFLLPILSHMMNEGITASQFLPLQEPQAIIIAPTRELINQIYLDARKFSYGTCVRPVVVYGGIHPVHAMRDVE-RGCNILCATPGRLMDIIGREKIGLSKLKYLVLDEADRMLDM-GFAPVMENLIGSPGMPAKEER-QTLMFSATYPAEIQRLASKFLKSDHLFVVVGLVGGACSDVEQTILEIQEYRKRDKLVEILQSSGNERTMIFVNTKKKADVIAGYLCQEHFPTTSIHGDREQCQREEAIRDFRSGKCPVIVCTAVAARGLDIENVQHVINYDVPKEIDEYVHRIGRTGRCGNVGKATSFFNVNEDHVVARPLVKILTDAHQEVPAWLEEIAFGGHGALNSLYAADSMGGEAGEKYVSAPS 660          
BLAST of VASA-1 vs. Ensembl Xenopus
Match: polg2 (polymerase (DNA directed), gamma 2, accessory subunit [Source:Xenbase;Acc:XB-GENE-1009985])

HSP 1 Score: 402.134 bits (1032), Expect = 2.617e-127
Identity = 219/476 (46.01%), Postives = 300/476 (63.03%), Query Frame = 3
Query: 1362 NQNDDAIPIVKRATFIP---DDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC-DGSGSRMANYSRDTRKNVKSSKYIDNPT 2771
            NQ +     VK+  ++P    D+++D   H  SGINFD YD+I V+VTG DVPPA+ TF   +  E L+ NV    Y KLTPVQK++IPII + RDLMACAQTGSGKTAAFL+PI+  +   G T S    +  P+A+I+APTREL  QI+  AR    G+ ++   +YGGI    + R+++  GC+IL ATPGRL+  +    + L  L++ VLDEADRMLD  GF   +  +         +   Q  MFSAT+P EIQ LA   LK ++LF+ VG+VG A SDV+Q I++  +  K +  +E +++  +E+T+IFV +K+ AD +   L    F  T+IHGDREQ QRE A+ DF+SG+   +V T VAARGLDI  V +VIN D+P  ID YVHRIGRTGRCGNVG+A SFF+  +D  +A+ LV  L +A+QE P WL  +   G G+  + Y+ D+       KY+  P+
Sbjct:  180 NQEEGTEKEVKKVIYVPLPPSDSEDDIFRHYQSGINFDKYDEILVDVTGKDVPPAILTFEEANFCETLSRNVTKAGYVKLTPVQKHSIPIILAGRDLMACAQTGSGKTAAFLLPILSHMMNEGITASQFLPLQEPQAIIIAPTRELINQIYLDARKFSYGTCVRPVVVYGGIHPVHAMRDVE-RGCNILCATPGRLMDIIGREKIGLSKLKYLVLDEADRMLDM-GFAPVMENLIGSPGMPAKEER-QTLMFSATYPAEIQRLASKFLKSDHLFVVVGLVGGACSDVEQTILEIQEYRKRDKLVEILQSSGNERTMIFVNTKKKADVIAGYLCQEHFPTTSIHGDREQCQREEAIRDFRSGKCPVIVCTAVAARGLDIENVQHVINYDVPKEIDEYVHRIGRTGRCGNVGKATSFFNVNEDHVVARPLVKILTDAHQEVPAWLEEIAFGGHGALNSLYAADSMGGEAGEKYVSAPS 652          
BLAST of VASA-1 vs. Ensembl Xenopus
Match: polg2 (polymerase (DNA directed), gamma 2, accessory subunit [Source:Xenbase;Acc:XB-GENE-1009985])

HSP 1 Score: 402.519 bits (1033), Expect = 2.802e-127
Identity = 219/476 (46.01%), Postives = 300/476 (63.03%), Query Frame = 3
Query: 1362 NQNDDAIPIVKRATFIP---DDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC-DGSGSRMANYSRDTRKNVKSSKYIDNPT 2771
            NQ +     VK+  ++P    D+++D   H  SGINFD YD+I V+VTG DVPPA+ TF   +  E L+ NV    Y KLTPVQK++IPII + RDLMACAQTGSGKTAAFL+PI+  +   G T S    +  P+A+I+APTREL  QI+  AR    G+ ++   +YGGI    + R+++  GC+IL ATPGRL+  +    + L  L++ VLDEADRMLD  GF   +  +         +   Q  MFSAT+P EIQ LA   LK ++LF+ VG+VG A SDV+Q I++  +  K +  +E +++  +E+T+IFV +K+ AD +   L    F  T+IHGDREQ QRE A+ DF+SG+   +V T VAARGLDI  V +VIN D+P  ID YVHRIGRTGRCGNVG+A SFF+  +D  +A+ LV  L +A+QE P WL  +   G G+  + Y+ D+       KY+  P+
Sbjct:  196 NQEEGTEKEVKKVIYVPLPPSDSEDDIFRHYQSGINFDKYDEILVDVTGKDVPPAILTFEEANFCETLSRNVTKAGYVKLTPVQKHSIPIILAGRDLMACAQTGSGKTAAFLLPILSHMMNEGITASQFLPLQEPQAIIIAPTRELINQIYLDARKFSYGTCVRPVVVYGGIHPVHAMRDVE-RGCNILCATPGRLMDIIGREKIGLSKLKYLVLDEADRMLDM-GFAPVMENLIGSPGMPAKEER-QTLMFSATYPAEIQRLASKFLKSDHLFVVVGLVGGACSDVEQTILEIQEYRKRDKLVEILQSSGNERTMIFVNTKKKADVIAGYLCQEHFPTTSIHGDREQCQREEAIRDFRSGKCPVIVCTAVAARGLDIENVQHVINYDVPKEIDEYVHRIGRTGRCGNVGKATSFFNVNEDHVVARPLVKILTDAHQEVPAWLEEIAFGGHGALNSLYAADSMGGEAGEKYVSAPS 668          
BLAST of VASA-1 vs. Ensembl Xenopus
Match: polg2 (polymerase (DNA directed), gamma 2, accessory subunit [Source:Xenbase;Acc:XB-GENE-1009985])

HSP 1 Score: 398.667 bits (1023), Expect = 9.957e-127
Identity = 219/476 (46.01%), Postives = 300/476 (63.03%), Query Frame = 3
Query: 1362 NQNDDAIPIVKRATFIP---DDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC-DGSGSRMANYSRDTRKNVKSSKYIDNPT 2771
            NQ +     VK+  ++P    D+++D   H  SGINFD YD+I V+VTG DVPPA+ TF   +  E L+ NV    Y KLTPVQK++IPII + RDLMACAQTGSGKTAAFL+PI+  +   G T S    +  P+A+I+APTREL  QI+  AR    G+ ++   +YGGI    + R+++  GC+IL ATPGRL+  +    + L  L++ VLDEADRMLD  GF   +  +         +   Q  MFSAT+P EIQ LA   LK ++LF+ VG+VG A SDV+Q I++  +  K +  +E +++  +E+T+IFV +K+ AD +   L    F  T+IHGDREQ QRE A+ DF+SG+   +V T VAARGLDI  V +VIN D+P  ID YVHRIGRTGRCGNVG+A SFF+  +D  +A+ LV  L +A+QE P WL  +   G G+  + Y+ D+       KY+  P+
Sbjct:  123 NQEEGTEKEVKKVIYVPLPPSDSEDDIFRHYQSGINFDKYDEILVDVTGKDVPPAILTFEEANFCETLSRNVTKAGYVKLTPVQKHSIPIILAGRDLMACAQTGSGKTAAFLLPILSHMMNEGITASQFLPLQEPQAIIIAPTRELINQIYLDARKFSYGTCVRPVVVYGGIHPVHAMRDVE-RGCNILCATPGRLMDIIGREKIGLSKLKYLVLDEADRMLDM-GFAPVMENLIGSPGMPAKEER-QTLMFSATYPAEIQRLASKFLKSDHLFVVVGLVGGACSDVEQTILEIQEYRKRDKLVEILQSSGNERTMIFVNTKKKADVIAGYLCQEHFPTTSIHGDREQCQREEAIRDFRSGKCPVIVCTAVAARGLDIENVQHVINYDVPKEIDEYVHRIGRTGRCGNVGKATSFFNVNEDHVVARPLVKILTDAHQEVPAWLEEIAFGGHGALNSLYAADSMGGEAGEKYVSAPS 595          
BLAST of VASA-1 vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 411.379 bits (1056), Expect = 2.140e-130
Identity = 227/470 (48.30%), Postives = 292/470 (62.13%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKN-YLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGS------------GSRMANYSRDTRKNVK----------SSKYIDNPTDD 2777
            H  +GINFD YD I VEV+G D PPA+ TF   +L + L +N+    YTKLTPVQKY+IPI+ + RDLMACAQTGSGKTAAFL+PI+  +  +G T S    +  P+ +I+APTREL  QI+  AR    G+ ++   IYGG +   S R I   GC+IL ATPGRL+  +    + L+ +++ VLDEADRMLD  GF   + K+ +       ++  Q  +FSATFP EIQ LA + LK+ YLF+AVG VG A  DV+Q I+Q  Q  K    +E ++ I DE+T++FVE+K+ ADF+   L       T+IHGDREQ +RE AL DF+ G+   +VAT+VAARGLDI  V +VIN D+P TID YVHRIGRTGRCGN GRAISFFD   D  LAQ LV  L +A Q+ P WL  +   +            G+  A  S DTRKN +          SS    NP DD
Sbjct:  234 HYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIVLAGRDLMACAQTGSGKTAAFLLPILAHMMRDGITASRFKELQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVIYGGTQFGHSVRQI-VQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDEADRMLDM-GFGPEMKKLISCPGMPSKEQR-QTLLFSATFPEEIQRLAGDFLKSSYLFVAVGQVGGACRDVQQTILQVGQYSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDTDSDNHLAQPLVKVLSDAQQDVPAWLEEIAFSTYVPPSFSSSTRGGAVFA--SVDTRKNYQGKHTLNTAGISSSQAPNPVDD 698          
BLAST of VASA-1 vs. Ensembl Mouse
Match: Ddx4 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:MGI Symbol;Acc:MGI:102670])

HSP 1 Score: 411.379 bits (1056), Expect = 3.996e-130
Identity = 227/470 (48.30%), Postives = 292/470 (62.13%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKN-YLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGS------------GSRMANYSRDTRKNVK----------SSKYIDNPTDD 2777
            H  +GINFD YD I VEV+G D PPA+ TF   +L + L +N+    YTKLTPVQKY+IPI+ + RDLMACAQTGSGKTAAFL+PI+  +  +G T S    +  P+ +I+APTREL  QI+  AR    G+ ++   IYGG +   S R I   GC+IL ATPGRL+  +    + L+ +++ VLDEADRMLD  GF   + K+ +       ++  Q  +FSATFP EIQ LA + LK+ YLF+AVG VG A  DV+Q I+Q  Q  K    +E ++ I DE+T++FVE+K+ ADF+   L       T+IHGDREQ +RE AL DF+ G+   +VAT+VAARGLDI  V +VIN D+P TID YVHRIGRTGRCGN GRAISFFD   D  LAQ LV  L +A Q+ P WL  +   +            G+  A  S DTRKN +          SS    NP DD
Sbjct:  260 HYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIVLAGRDLMACAQTGSGKTAAFLLPILAHMMRDGITASRFKELQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVIYGGTQFGHSVRQI-VQGCNILCATPGRLMDIIGKEKIGLKQVKYLVLDEADRMLDM-GFGPEMKKLISCPGMPSKEQR-QTLLFSATFPEEIQRLAGDFLKSSYLFVAVGQVGGACRDVQQTILQVGQYSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDTDSDNHLAQPLVKVLSDAQQDVPAWLEEIAFSTYVPPSFSSSTRGGAVFA--SVDTRKNYQGKHTLNTAGISSSQAPNPVDD 724          
BLAST of VASA-1 vs. Ensembl Mouse
Match: Ddx3x (DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-linked [Source:MGI Symbol;Acc:MGI:103064])

HSP 1 Score: 374.4 bits (960), Expect = 6.344e-117
Identity = 195/426 (45.77%), Postives = 277/426 (65.02%), Query Frame = 3
Query: 1446 NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVA----------FPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISM-FSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYI-KTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC 2687
            N+GINF+ YD IPVE TG++ PP + +FS + + E +  N+E  +YT+ TPVQK+AIPII  KRDLMACAQTGSGKTAAFL+PI+  +  +G      A+           +P +L++APTREL  QI+  AR     S ++   +YGG E+ +  R+++  GC +LVATPGRL+  +E   + L + ++ VLDEADRMLD  GF   + +I  +       + ++ +M FSATFP EIQ LAR+ L  Y+FLAVG VGS + ++ Q+++  ++ +K +  ++ +  T  D  TL+FVE+K+ AD +   L + G+  T+IHGDR Q  RE AL+ F+SG+   +VAT VAARGLDI  V +VIN D+P  I+ YVHRIGRTGR GN+G A SFF+E ++I + + L+  L EA QE P WL  + 
Sbjct:  155 NTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYADGPGEALRAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGAEIGQQIRDLE-RGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDM-GFEPQIRRIVEQDTMP--PKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEEIDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNE-RNINITKDLLDLLVEAKQEVPSWLENMA 575          
BLAST of VASA-1 vs. Ensembl Mouse
Match: D1Pas1 (DNA segment, Chr 1, Pasteur Institute 1 [Source:MGI Symbol;Acc:MGI:91842])

HSP 1 Score: 372.474 bits (955), Expect = 4.124e-116
Identity = 193/425 (45.41%), Postives = 272/425 (64.00%), Query Frame = 3
Query: 1446 NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVA----------FPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYI-KTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC 2687
            N+GINF+ YD IPVE TG++ PP + +FS + + E +  N+E  +YT+ TPVQK+AIPII  KRDLMACAQTGSGKTAAFL+PI+  +  +G      A+           +P +L++APTREL  QI+  AR     S ++   +YGG ++ +  R+++  GC +LVATPGRL+  +E   + L + ++ VLDEADRMLD  GF   + +I  +             MFSATFP EIQ LAR+ L  Y+FLAVG VGS + ++ Q+++  ++ +K +  ++ +  T  D   L+FVE+K+ AD +   L + G+  T+IHGDR Q  RE AL+ F+SG+   +VAT VAARGLDI  V +VIN D+P  I+ YVHRIGRTGR GN+G A SFF+E ++I + + L+  L EA QE P WL  + 
Sbjct:  154 NTGINFEKYDDIPVEATGNNCPPHIESFSDVEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALRAMKENGKYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADIGQQIRDLE-RGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDM-GFEPQIRRIVEQDTMPPKGVR-HTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEEADKRSFLLDLLNATGKDSLILVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNE-RNINITKDLLDLLVEAKQEVPSWLENMA 574          
BLAST of VASA-1 vs. Ensembl Mouse
Match: Ddx3y (DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked [Source:MGI Symbol;Acc:MGI:1349406])

HSP 1 Score: 369.007 bits (946), Expect = 6.871e-115
Identity = 193/426 (45.31%), Postives = 275/426 (64.55%), Query Frame = 3
Query: 1446 NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVA----------FPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQIS-MFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYI-KTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC 2687
            N+GINF+ YD IPVE TG++ PP +  FS + + E +  N+E  +YT+ TPVQK+AIPII  KRDLMACAQTGSGKTAAFL+PI+  +  +G      A+           +P +L++APTREL  QI+  AR     S ++   +YGG +  +  R+++  GC +LVATPGRL+  +E   + L + ++ VLDEADRMLD  GF   + +I  +       + ++ + MFSATFP EIQ LAR+ L  Y+FLAVG VGS + ++ Q+++  ++ +K +  ++ +  T  D  TL+FVE+K+ AD +   L    +  T+IHGDR Q+ RE AL+ F+SGR   +VAT VAARGLDI  V +VIN D+P  I+ YVHRIGRTGR GN+G A SFF+E +++ + + L+  L EA QE P WL ++ 
Sbjct:  154 NTGINFEKYDDIPVEATGNNCPPHIENFSDIEMGEIIMGNIELTRYTRPTPVQKHAIPIIKEKRDLMACAQTGSGKTAAFLLPILSQIYTDGPGEALKAMKENGRYGRRKQYPISLVLAPTRELAVQIYEEARKFSYRSRVRPCVVYGGADTVQQIRDLE-RGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDM-GFEPQIRRIVEQDTMP--PKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEELDKRSFLLDLLNATGKDSLTLVFVETKKGADSLENFLFQERYACTSIHGDRSQKDREEALHQFRSGRKPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNE-RNLNITKDLLDLLVEAKQEVPSWLESMA 574          
BLAST of VASA-1 vs. UniProt/SwissProt
Match: sp|Q5W5U4|DDX4_BOVIN (Probable ATP-dependent RNA helicase DDX4 OS=Bos taurus OX=9913 GN=DDX4 PE=2 SV=1)

HSP 1 Score: 416.772 bits (1070), Expect = 2.609e-131
Identity = 232/466 (49.79%), Postives = 290/466 (62.23%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC------DGSGSRMANY--SRDTRKNVK----------SSKYIDNPTDD 2777
            H  +GINFD YD I VEV+G D PPA+ TF   +L + L +N+    YTKLTPVQKY+IPII   RDLMACAQTGSGKTAAFL+PI+  +  +G T S    +  P+ +I+APTREL  QI+  AR    G+ ++   IYGG ++  S R I   GC+IL ATPGRL+  +    + LR +++ VLDEADRMLD  GF   + K+ +       ++  Q  MFSATFP EIQ LA   LK NYLF+AVG VG A  DV+Q I+Q  Q  K    +E ++ I DE+T++FVE+K+ ADF+   L       T+IHGDREQ +RE AL DF+ G+   +VAT+VAARGLDI  V +VIN D+P TID YVHRIGRTGRCGN GRAISFFD   D  LAQ LV  L +A Q+ P WL  +         SG+   N   S DTRKN            SS    NP DD
Sbjct:  263 HYQTGINFDKYDTILVEVSGHDPPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIIQGGRDLMACAQTGSGKTAAFLLPILAHMMRDGITASRFKELQEPECIIVAPTRELINQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQI-VQGCNILCATPGRLMDVIGKEKIGLRQVKYLVLDEADRMLDM-GFGPEMKKLISCPGMPSKEQR-QTLMFSATFPEEIQRLAGEFLKSNYLFVAVGQVGGACRDVQQTILQVGQYSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDLESDSQLAQPLVKVLSDAQQDVPAWLEEIAFSTYGPGFSGNARGNVFASVDTRKNYPGKSSLNTAGFSSTQAPNPVDD 725          
BLAST of VASA-1 vs. UniProt/SwissProt
Match: sp|Q9NQI0|DDX4_HUMAN (Probable ATP-dependent RNA helicase DDX4 OS=Homo sapiens OX=9606 GN=DDX4 PE=1 SV=2)

HSP 1 Score: 414.461 bits (1064), Expect = 1.910e-130
Identity = 230/463 (49.68%), Postives = 290/463 (62.63%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDG------SGSRMANY--SRDTRKNVK-------SSKYIDNPTDD 2777
            H  +GINFD YD I VEV+G D PPA+ TF   +L + L +N+    YTKLTPVQKY+IPII + RDLMACAQTGSGKTAAFL+PI+  +  +G T S    +  P+ +I+APTREL  QI+  AR    G+ ++   IYGG ++  S R I   GC+IL ATPGRL+  +    + L+ +++ VLDEADRMLD  GF   + K+ +       ++  Q  MFSATFP EIQ LA   LK NYLF+AVG VG A  DV+Q ++Q  Q  K    +E ++ I DE+T++FVE+K+ ADF+   L       T+IHGDREQ +RE AL DF+ G+   +VAT+VAARGLDI  V +VIN D+P TID YVHRIGRTGRCGN GRAISFFD   D  LAQ LV  L +A Q+ P WL  +         SGS   N   S DTRK          SS    NP DD
Sbjct:  261 HYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQI-VQGCNILCATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDM-GFGPEMKKLISCPGMPSKEQR-QTLMFSATFPEEIQRLAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDD 720          
BLAST of VASA-1 vs. UniProt/SwissProt
Match: sp|Q4R5S7|DDX4_MACFA (Probable ATP-dependent RNA helicase DDX4 OS=Macaca fascicularis OX=9541 GN=DDX4 PE=2 SV=1)

HSP 1 Score: 414.075 bits (1063), Expect = 2.503e-130
Identity = 229/463 (49.46%), Postives = 290/463 (62.63%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC------DGSGSRMANY--SRDTRKNVK-------SSKYIDNPTDD 2777
            H  +GI+FD YD I VEV+G D PPA+ TF   +L + L +N+    YTKLTPVQKY+IPII + RDLMACAQTGSGKTAAFL+PI+  +  +G T S    +  P+ +I+APTREL  QI+  AR    G+ ++   IYGG ++  S R I   GC+IL ATPGRL+  +    + L+ +++ VLDEADRMLD  GF   + K+ +       ++  Q  MFSATFP EIQ LA   LK NYLF+AVG VG A  DV+Q ++Q  Q  K    +E ++ I DE+T++FVE+K+ ADF+   L       T+IHGDREQ +RE AL DF+ G+   +VAT+VAARGLDI  V +VIN D+P TID YVHRIGRTGRCGN GRAISFFD   D  LAQ LV  L +A Q+ P WL  +         SGS   N   S DTRK          SS    NP DD
Sbjct:  262 HYQTGISFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGITASCFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQI-VQGCNILCATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDM-GFGPEMKKLISCPGMPSKEQR-QTLMFSATFPEEIQRLAAEFLKSNYLFVAVGQVGGACRDVQQTVLQVGQFSKREKLVEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRCGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSSLNTAGFSSSQAPNPVDD 721          
BLAST of VASA-1 vs. UniProt/SwissProt
Match: sp|Q3MSQ8|DDX4_PELLE (Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae OX=45623 GN=ddx4 PE=2 SV=1)

HSP 1 Score: 413.69 bits (1062), Expect = 3.711e-130
Identity = 225/458 (49.13%), Postives = 300/458 (65.50%), Query Frame = 3
Query: 1335 RGQKQPEQTNQNDDAIPIVKRATFIPDD---NQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPA-SAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANF-SGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKD--IGLAQGLVSKLQEANQECPDWLRAL 2684
            +GQ+  E++ Q         R T+IP      + D   H  +GINFD YD I VEV+G DVPPA+ TF   +L + L  NV    Y KLTP+QK++IPII + RDLMACAQTGSGKTAAFL+PI+  L   G ES A   +  P+A+I+APTREL  QI+  AR    G+ ++   IYGG +M  S + I + GC+IL ATPGRL+  +    + L  L++ VLDEADRMLD  GF E +  +   +   S ++R  Q  MFSATFP+ IQ+LAR +LK +YLF+ VG VG A SDV+Q +I+ D+  K +  +E ++ I  E+T++FV++K+ ADF+   L      +T+IHGDREQ++RE AL DF++G+   +VAT+VAARGLDI  V  VIN D+PD ID YVHRIGRTGRCGN GRAISFFD+  D    +A+ LV  L +A+QE P WL  +
Sbjct:  228 KGQEGFERSEQG-------PRVTYIPPPPPAEESDIFKHYQTGINFDKYDDIVVEVSGSDVPPAILTFEEANLCDSLAKNVCKSGYVKLTPIQKHSIPIIVAGRDLMACAQTGSGKTAAFLLPILAHLMVKGVESSAFQTLKEPEAIIVAPTRELINQIYLDARKFSYGTCVRPVVIYGGTQMFHSLKQI-SEGCNILCATPGRLLDVIRKEKIGLTKLRYLVLDEADRMLDM-GFREDIENLLKSSGMPSKEER--QTLMFSATFPSSIQSLAREILKPDYLFVVVGQVGGACSDVEQMVIEVDEFGKKDKLMEILQEIGSERTMVFVKTKKKADFIATFLCQEKVPSTSIHGDREQKERETALRDFRTGQCPVIVATSVAARGLDIENVSYVINFDIPDDIDEYVHRIGRTGRCGNTGRAISFFDKRGDDEQRIARSLVKVLSDAHQEVPAWLEEV 674          
BLAST of VASA-1 vs. UniProt/SwissProt
Match: sp|Q6GWX0|DDX4_PIG (Probable ATP-dependent RNA helicase DDX4 OS=Sus scrofa OX=9823 GN=DDX4 PE=2 SV=1)

HSP 1 Score: 412.149 bits (1058), Expect = 1.256e-129
Identity = 230/463 (49.68%), Postives = 289/463 (62.42%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC------DGSGSRMANY--SRDTRKNVK-------SSKYIDNPTDD 2777
            H  +GINFD YD I VEV+G D PPA+ TF   +L + L +N+    YTKLTPVQKY+IPII + RDLMACAQTGSGKTAAFL+PI+  +  +G T S    +  P+ +I+APTREL  QI+  AR    G+ ++   IYGG ++  S R I   GC+IL ATPGRL+  +    + L+ +++ VLDEADRMLD  GF   + K+ +       ++  Q  MFSATFP EIQ LA   LK NYLF+AVG VG A  DV+Q  +Q  Q  K    +E ++ I DE+T++FVE+K+ ADF+   L       T+IHGDREQ +RE AL DF+ G+   +VAT+VAARGLDI  V +VIN D+P TID YVHRIGRTGRCGN GRAISFFD   D  LAQ LV  L +A Q+ P WL  +         SGS   N   S DTRK          SS    NP DD
Sbjct:  259 HYQTGINFDKYDTILVEVSGHDAPPAILTFEEANLCQTLNNNIAKAGYTKLTPVQKYSIPIILAGRDLMACAQTGSGKTAAFLLPILAHMMHDGITASRFKELQEPECIIVAPTRELVNQIYLEARKFSFGTCVRAVVIYGGTQLGHSIRQI-VQGCNILCATPGRLMDIIGKEKIGLKQIKYLVLDEADRMLDM-GFGPEMKKLISCPGMPSKEQR-QTLMFSATFPEEIQRLAAEFLKSNYLFVAVGQVGGACRDVQQADLQVGQYSKREKLLEILRNIGDERTMVFVETKKKADFIATFLCQEKISTTSIHGDREQREREQALGDFRFGKCPVLVATSVAARGLDIENVQHVINFDLPSTIDEYVHRIGRTGRCGNTGRAISFFDLESDNHLAQPLVKVLTDAQQDVPAWLEEIAFSTYIPGFSGSTRGNVFASVDTRKGKSTLNTAGFSSSQAPNPVDD 718          
BLAST of VASA-1 vs. TrEMBL
Match: H9CXT7 (VASA 1 protein OS=Schmidtea mediterranea OX=79327 GN=VASA1 PE=2 SV=1)

HSP 1 Score: 1290.02 bits (3337), Expect = 0.000e+0
Identity = 669/669 (100.00%), Postives = 669/669 (100.00%), Query Frame = 3
Query:  837 MDRRKPRDDSRDHKKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQENRTRNRKEEFKRDESWEDRRSEFQRDQRINNDSFARATKENGANNFESKKFRGNNDANNGFRNDEFDGNFQGKRNGNSNDFSTEFDRTVTLEENPAYSSKTFVRGQKQPEQTNQNDDAIPIVKRATFIPDDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMANYSRDTRKNVKSSKYIDNPTDDGFMKGTNIDYDDVKPTSEWLED 2843
            MDRRKPRDDSRDHKKYRDDSRDKRNNLKRRDDSYDNNDRNRRPDRRNRDDSRENRKKRDDSQENRTRNRKEEFKRDESWEDRRSEFQRDQRINNDSFARATKENGANNFESKKFRGNNDANNGFRNDEFDGNFQGKRNGNSNDFSTEFDRTVTLEENPAYSSKTFVRGQKQPEQTNQNDDAIPIVKRATFIPDDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMANYSRDTRKNVKSSKYIDNPTDDGFMKGTNIDYDDVKPTSEWLED
Sbjct:  255 MDRRKPRDDSRDHKKYRDDSRDKRNNLKRRDDSYDNNDRNRRPDRRNRDDSRENRKKRDDSQENRTRNRKEEFKRDESWEDRRSEFQRDQRINNDSFARATKENGANNFESKKFRGNNDANNGFRNDEFDGNFQGKRNGNSNDFSTEFDRTVTLEENPAYSSKTFVRGQKQPEQTNQNDDAIPIVKRATFIPDDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMANYSRDTRKNVKSSKYIDNPTDDGFMKGTNIDYDDVKPTSEWLED 923          

HSP 2 Score: 348.591 bits (893), Expect = 3.158e-101
Identity = 189/189 (100.00%), Postives = 189/189 (100.00%), Query Frame = 3
Query:   72 MSVNDGLSDEEWGAWGQTSVVTENISTQKNNSKPQNGFGSDDEVIINTDTSNVQAISKFSVNSYNKENNLNGGSYEKXXXXXXXXXXXXXATRKVESEDKNETNGDRNYNRNGYSNDRDTKPNYQNNRNSEFKRNGNEQNNYPNDRNFNKRDNSPGDKNQYANKRNDSRERSRNNGLFDDSRERKTPRG 638
            MSVNDGLSDEEWGAWGQTSVVTENISTQKNNSKPQNGFGSDDEVIINTDTSNVQAISKFSVNSYNKENNLNGGSYEKRGGFNGNRGTNRFATRKVESEDKNETNGDRNYNRNGYSNDRDTKPNYQNNRNSEFKRNGNEQNNYPNDRNFNKRDNSPGDKNQYANKRNDSRERSRNNGLFDDSRERKTPRG
Sbjct:    1 MSVNDGLSDEEWGAWGQTSVVTENISTQKNNSKPQNGFGSDDEVIINTDTSNVQAISKFSVNSYNKENNLNGGSYEKRGGFNGNRGTNRFATRKVESEDKNETNGDRNYNRNGYSNDRDTKPNYQNNRNSEFKRNGNEQNNYPNDRNFNKRDNSPGDKNQYANKRNDSRERSRNNGLFDDSRERKTPRG 189          
BLAST of VASA-1 vs. TrEMBL
Match: D5JG81 (Vasa PlVAS1-like protein (Fragment) OS=Dugesia japonica OX=6161 GN=VAS-1 PE=2 SV=1)

HSP 1 Score: 957.977 bits (2475), Expect = 0.000e+0
Identity = 469/635 (73.86%), Postives = 533/635 (83.94%), Query Frame = 3
Query: 1023 ENRTRNRKEEFKRDESWEDRRSEFQR------DQRINNDSFARATKENGANNFESKKF------RGNNDANNG-------FRNDEFDGNFQGKRNGNSN---------DFSTEFDRTVTLEENPAYSSKTFVRGQKQPEQTNQNDDAIPIVKRATFIPDDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMANYSRDTRKNVKSSKYIDNPTDDGFMKGTNIDYDDVKPTSEWLED 2843
            +NR   R+E+F RD S + R   F++        R +ND F R  + N + N  ++ F      R   D NNG       +++ E + +F+GK++ +                F   V L++N  +SS+TFVRGQK  E+ NQ DD  P+ KRATFIPDD+QEDYELHVNSGINFDNY+KIPVEVTGDD P A+N+F+ L+LP+FL SN+  L+Y+KLTPVQKYAIPIID++RDLMACAQTGSGKTAAFLIPIIKSL EN  ++PASAVAFPKALIMAPTRELCRQIFTAAR LCRGSN+KCAYIYGGIEMNKSRRNIQ++GCDILVATPGRLIHFLELVW+SLRYL+FF+LDEADRML+S+GFYESV KIY +AN SGDDR+IQISMFSATFPNEIQ+LARNLLKNYLFLAVGVVGSAN+DVKQEIIQ+DQREKVNTAI+YIKTIPDEKTLIFVESKRMADF GIKLG+LGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMP  IDTYVHRIGRTGRCGNVGRAISFFD+ KDI LAQ L SKL+EANQECPDWL+ALCDG+G R + YSRDTRK+VK+SKY+DNPTDDGFMKGTNIDYDDVKP+SEWLED
Sbjct:  169 DNRKYRRREDFDRDSSRDSRNRNFKKRDDSREKSRNHNDVFKR-DESNDSRNGTNRGFVPKNNGREEKDRNNGRNRSNYRYQSPEDNDDFRGKKHQSYQRDREDKGYTKMVDNFAENVKLDDNEKFSSRTFVRGQKTSEKDNQVDDVAPVTKRATFIPDDDQEDYELHVNSGINFDNYEKIPVEVTGDDSPAAINSFTGLNLPDFLVSNINFLRYSKLTPVQKYAIPIIDTRRDLMACAQTGSGKTAAFLIPIIKSLHENIVDAPASAVAFPKALIMAPTRELCRQIFTAARQLCRGSNVKCAYIYGGIEMNKSRRNIQSSGCDILVATPGRLIHFLELVWISLRYLKFFILDEADRMLESEGFYESVNKIYVDANCSGDDRTIQISMFSATFPNEIQSLARNLLKNYLFLAVGVVGSANTDVKQEIIQTDQREKVNTAIDYIKTIPDEKTLIFVESKRMADFFGIKLGFLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPGDIDTYVHRIGRTGRCGNVGRAISFFDDTKDIALAQPLASKLEEANQECPDWLKALCDGTGVRKSAYSRDTRKDVKTSKYVDNPTDDGFMKGTNIDYDDVKPSSEWLED 802          
BLAST of VASA-1 vs. TrEMBL
Match: Q9GV07 (Vasa-related protein PlVAS1 (Fragment) OS=Girardia dorotocephala OX=135777 GN=Plvas1 PE=2 SV=1)

HSP 1 Score: 801.971 bits (2070), Expect = 0.000e+0
Identity = 406/574 (70.73%), Postives = 458/574 (79.79%), Query Frame = 3
Query: 1215 DEFDGNFQGKRNGNSNDFSTEFDRTVTLEE-----NPAYSSKTFVRGQKQPEQTNQ------NDDAIPIVKRATFIPDDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTE---SPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGD-DRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGS-----GSRMANYSRDTRKNVKSSKYIDNPTDD---------GFMKGTNIDYDDV--KPTSEWLED 2843
            D+ D ++   +   S  F  +FDR    ++        ++S+TF+RGQK PE  NQ      NDD+  + KRATFIPDD+QEDY+LHVNSGINFDNYDKIPV+VTG++ P  + +F  L LPEFL  N+ ++KY KLTPVQKYA+PIID  RDLMACAQTGSGKTAAFLIPIIK L     E   S  S+ AFP+ALIM PTRELCRQIFTAAR LCRGSNI+CAY+YGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVW+SLRY+++FVLDEADRMLD +GFYE V KIY EA+ SGD DRSI +SMFSATFPNEIQTLA  LL NYLFLAVGVVGSAN DVKQEII+++QR+KV +AIE IKTIPDEKTLIFVESKRMADF GIKLGYLGFKATTIHGDREQEQRE ALNDFKSGR+NFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFD+ KD+GLA  LV KLQEANQ    WLR L  GS       R ++ SRDTRKNVK +KY+DNP +          GFM+GTN+DYDD      SEWL++
Sbjct:    1 DDSDDDYLSNKFEKSMKFERKFDRDANGDKEDSNRKEGFTSRTFIRGQK-PELDNQSNKDGKNDDSAALPKRATFIPDDDQEDYKLHVNSGINFDNYDKIPVDVTGENTPGPIASFGELELPEFLMENIRDMKYVKLTPVQKYAVPIIDRGRDLMACAQTGSGKTAAFLIPIIKGLHGTVLETDSSNTSSTAFPRALIMTPTRELCRQIFTAARLLCRGSNIRCAYMYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWVSLRYIKYFVLDEADRMLDEEGFYEVVNKIYKEAHQSGDADRSIHLSMFSATFPNEIQTLASRLLSNYLFLAVGVVGSANCDVKQEIIRAEQRDKVTSAIELIKTIPDEKTLIFVESKRMADFFGIKLGYLGFKATTIHGDREQEQRESALNDFKSGRINFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDDQKDLGLAGALVGKLQEANQPVEQWLRELAAGSVGAICNPRYSSNSRDTRKNVKINKYVDNPNEQDDDDAAGGGGFMRGTNVDYDDSPKAAASEWLDE 573          
BLAST of VASA-1 vs. TrEMBL
Match: A0A172RVY9 (VASA 2 protein (Fragment) OS=Schmidtea mediterranea OX=79327 GN=VASA2 PE=2 SV=1)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 264/461 (57.27%), Postives = 345/461 (74.84%), Query Frame = 3
Query: 1389 VKRATFIPDDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMANYSR---DTRKNVKSSKYID 2762
            V+R  +IPDDN EDY+LHVNSGINFDNYD + V VTG ++P A+ +     +PEFL  N+++  Y KLTPVQKY IP+I+S RDLMACAQTGSGKT AFL+PIIK++SEN  ++ +S    PK LI+ PTRELCRQIFT A  LC+ S++KC+Y YGG+EM  S   ++   CDILV+TPGRL+  LE   +SL  +++ VLDEADR+L ++ F ES+  +Y ++   G D+   +SMFSATFP EIQ L  +LL ++LF+AVG+VG+AN+D+KQ ++Q +  +K+N ++EY+      KTL+FV++KR ADF+GI+L  L   ATTIHGDR+Q  RE ALNDFKSGRVNF+VAT+VA+RGLDIPKVD VINIDMP+ +D Y+HRIGRTGRCGN G ++SFFDE KDI LA  LV  L E+ QECPDWL +LC  SG R   + R   D R+NV+SS +++
Sbjct:   77 VQRVNYIPDDNAEDYQLHVNSGINFDNYDNVQVHVTGRNIPEAITSIEDFQIPEFLRLNIKSSDYKKLTPVQKYTIPMINSDRDLMACAQTGSGKTMAFLVPIIKNISEN-PDTSSSGKNSPKCLIVVPTRELCRQIFTVAHRLCKDSSVKCSYSYGGVEMRTSM--MKLYKCDILVSTPGRLVANLESAAISLDKIRYLVLDEADRLLQNEKFMESIKLVYEKSKLVGVDK-FHVSMFSATFPAEIQQLGESLLSDHLFVAVGLVGAANTDIKQTVLQVNSHDKLNASLEYLTNNKTGKTLVFVQAKRFADFLGIRLIDLNLLATTIHGDRDQAARESALNDFKSGRVNFLVATDVASRGLDIPKVDTVINIDMPEDMDVYIHRIGRTGRCGNPGLSVSFFDEEKDIALAPRLVKILNESGQECPDWLHSLC--SGYRPFEHGRNRKDYRQNVESSTFVE 531          
BLAST of VASA-1 vs. TrEMBL
Match: H9CXT8 (VASA-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 264/461 (57.27%), Postives = 345/461 (74.84%), Query Frame = 3
Query: 1389 VKRATFIPDDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMANYSR---DTRKNVKSSKYID 2762
            V+R  +IPDDN EDY+LHVNSGINFDNYD + V VTG ++P A+ +     +PEFL  N+++  Y KLTPVQKY IP+I+S RDLMACAQTGSGKT AFL+PIIK++SEN  ++ +S    PK LI+ PTRELCRQIFT A  LC+ S++KC+Y YGG+EM  S   ++   CDILV+TPGRL+  LE   +SL  +++ VLDEADR+L ++ F ES+  +Y ++   G D+   +SMFSATFP EIQ L  +LL ++LF+AVG+VG+AN+D+KQ ++Q +  +K+N ++EY+      KTL+FV++KR ADF+GI+L  L   ATTIHGDR+Q  RE ALNDFKSGRVNF+VAT+VA+RGLDIPKVD VINIDMP+ +D Y+HRIGRTGRCGN G ++SFFDE KDI LA  LV  L E+ QECPDWL +LC  SG R   + R   D R+NV+SS +++
Sbjct:   77 VQRVNYIPDDNAEDYQLHVNSGINFDNYDNVQVHVTGRNIPEAITSIEDFQIPEFLRLNIKSSDYKKLTPVQKYTIPMINSDRDLMACAQTGSGKTMAFLVPIIKNISEN-PDTSSSGKNSPKCLIVVPTRELCRQIFTVAHRLCKDSSVKCSYSYGGVEMRTSM--MKLYKCDILVSTPGRLVANLESAAISLDKIRYLVLDEADRLLQNEKFMESIKLVYEKSKLVGVDK-FHVSMFSATFPAEIQQLGESLLSDHLFVAVGLVGAANTDIKQTVLQVNSHDKLNASLEYLTNNKTGKTLVFVQAKRFADFLGIRLIDLNLLATTIHGDRDQAARESALNDFKSGRVNFLVATDVASRGLDIPKVDTVINIDMPEDMDVYIHRIGRTGRCGNPGLSVSFFDEEKDIALAPRLVKILNESGQECPDWLHSLC--SGYRPFEHGRNRKDYRQNVESSTFVE 531          
BLAST of VASA-1 vs. Ensembl Cavefish
Match: ddx4 (DEAD-box helicase 4 [Source:NCBI gene;Acc:103041190])

HSP 1 Score: 402.519 bits (1033), Expect = 1.008e-127
Identity = 212/417 (50.84%), Postives = 272/417 (65.23%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTE-SPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRAL 2684
            H  +GINFD YD I V+V+G + P A+ TF    L E L+ NV    Y K TPVQKY IPII +KRDLMACAQTGSGKTAAFL+PI++ L  +G   S  S V  P+A+I+APTREL  QI+  AR    G+ ++   +YGGI    + R +   GC++L  TPGRL+  +    + L  L++ VLDEADRMLD  GF   + K+ +       +   Q  MFSAT+P +IQ LA + LK +YLFLAVGVVG A SDV+Q IIQ DQ  K    +E +KT   E+T++FVE+KR ADF+   L       T+IHGDREQ +RE AL+DF++G+   +VAT+VAARGLDI  V +V+N D+P+ I+ YVHRIGRTGRCGN GRA+SFF    D  LA+ LV  L  A QE P WL  +
Sbjct:  188 HYETGINFDKYDDILVDVSGSNPPKAIMTFEEAGLCETLSRNVAKSGYVKPTPVQKYGIPIISAKRDLMACAQTGSGKTAAFLLPILQQLMADGVAASKFSEVQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREV-LKGCNVLCGTPGRLLDIIGRGKVGLSKLRYLVLDEADRMLDM-GFEPDMRKLVSSPGMPAKEER-QTLMFSATYPEDIQRLAADFLKVDYLFLAVGVVGGACSDVEQHIIQVDQYSKREQLLELLKTTGTERTMVFVETKRSADFIATFLCQEKVPTTSIHGDREQREREKALSDFRTGQCPVLVATSVAARGLDIEHVQHVVNFDLPNNIEEYVHRIGRTGRCGNTGRAVSFFYPESDTPLARSLVKVLTGAQQEVPPWLEEI 601          
BLAST of VASA-1 vs. Ensembl Cavefish
Match: ddx4 (DEAD-box helicase 4 [Source:NCBI gene;Acc:103041190])

HSP 1 Score: 403.29 bits (1035), Expect = 1.011e-127
Identity = 212/417 (50.84%), Postives = 272/417 (65.23%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTE-SPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRAL 2684
            H  +GINFD YD I V+V+G + P A+ TF    L E L+ NV    Y K TPVQKY IPII +KRDLMACAQTGSGKTAAFL+PI++ L  +G   S  S V  P+A+I+APTREL  QI+  AR    G+ ++   +YGGI    + R +   GC++L  TPGRL+  +    + L  L++ VLDEADRMLD  GF   + K+ +       +   Q  MFSAT+P +IQ LA + LK +YLFLAVGVVG A SDV+Q IIQ DQ  K    +E +KT   E+T++FVE+KR ADF+   L       T+IHGDREQ +RE AL+DF++G+   +VAT+VAARGLDI  V +V+N D+P+ I+ YVHRIGRTGRCGN GRA+SFF    D  LA+ LV  L  A QE P WL  +
Sbjct:  209 HYETGINFDKYDDILVDVSGSNPPKAIMTFEEAGLCETLSRNVAKSGYVKPTPVQKYGIPIISAKRDLMACAQTGSGKTAAFLLPILQQLMADGVAASKFSEVQEPEAIIVAPTRELINQIYLEARKFAYGTCVRPVVVYGGINTGYTIREV-LKGCNVLCGTPGRLLDIIGRGKVGLSKLRYLVLDEADRMLDM-GFEPDMRKLVSSPGMPAKEER-QTLMFSATYPEDIQRLAADFLKVDYLFLAVGVVGGACSDVEQHIIQVDQYSKREQLLELLKTTGTERTMVFVETKRSADFIATFLCQEKVPTTSIHGDREQREREKALSDFRTGQCPVLVATSVAARGLDIEHVQHVVNFDLPNNIEEYVHRIGRTGRCGNTGRAVSFFYPESDTPLARSLVKVLTGAQQEVPPWLEEI 622          
BLAST of VASA-1 vs. Ensembl Cavefish
Match: ddx3xb (DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZDB-GENE-980526-150])

HSP 1 Score: 374.4 bits (960), Expect = 1.348e-117
Identity = 198/426 (46.48%), Postives = 275/426 (64.55%), Query Frame = 3
Query: 1446 NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVA-----------FPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYI-KTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC 2687
            N+GINF+ YD IPVE TG + PP +++F  + + E +  N+   +YT+ TPVQK+AIPII +KRDLMACAQTGSGKTAAFL+P+   LS+  T+ P  A+            +P +L++APTREL  QI+  AR     S ++   +YGG ++ +  R+++  GC +LVATPGRL+  +E   + L Y  + VLDEADRMLD  GF   + +I  +          Q  MFSATFP EIQ LAR+ L++Y+FLAVG VGS + ++ Q+++  ++ +K +  ++ +  T  D  TL+FVE+K+ AD +   L   G+  T+IHGDR Q  RE ALN F+SGR   +VAT VAARGLDI  V +VIN D+P  I+ YVHRIGRTGR GN+G A SFF++ K+  + + L+  L EA QE P WL +L 
Sbjct:  113 NTGINFEKYDDIPVEATGHNSPPHIDSFHDVEMGEIIMGNIALSRYTRPTPVQKHAIPIIKTKRDLMACAQTGSGKTAAFLLPV---LSQIYTDGPGEALQAENGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLE-RGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDM-GFEPQIRRIVEQDTMPPKGLR-QTMMFSATFPKEIQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALNQFRSGRCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFND-KNSNITKDLLDILVEAKQEVPSWLESLA 531          
BLAST of VASA-1 vs. Ensembl Cavefish
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:103040126])

HSP 1 Score: 367.081 bits (941), Expect = 3.068e-113
Identity = 203/461 (44.03%), Postives = 286/461 (62.04%), Query Frame = 3
Query: 1410 PDDNQEDYELHV--NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVA-----------------FPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYI-KTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMANYSRDTR 2732
            P + + ++EL    N+GINF+ YD IPVE TG++ P  +  F  + + E +  N+   +YT+ TPVQK+AIPII +KRDLMACAQTGSGKTAAFL+P+   LS+  T+ P  A+                  +P +L++APTREL  QI+  AR     S ++   +YGG ++ +  R+++  GC +LVATPGRL+  +E   + L Y  + VLDEADRMLD  GF   + +I  E +      + Q  MFSATFP EIQ LAR+ L+ Y+FLAVG VGS + ++ Q+++  ++ +K +  ++ +  T  D  TL+FVE+K+ AD +   L   G+  T+IHGDR Q  RE AL+ F+SGR   MVAT VAARGLDI  V +VIN D+P  I+ YVHRIGRTGR GN+G A SF+++ K+  + + L+  L EA QE P WL +L      + +N  R  R
Sbjct:  229 PPNERVEHELFSASNTGINFEKYDDIPVEATGNNCPGPIENFHDVDMGEIIMGNITLSRYTRPTPVQKHAIPIIKAKRDLMACAQTGSGKTAAFLLPV---LSQIYTDGPGEALQASKASGQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLE-RGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDM-GFEPQIRRIV-EQDTMPPKGARQTMMFSATFPKEIQILARDFLEEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFYND-KNSNITKDLLDILVEAKQEVPSWLESLAFEHQHKNSNRGRSKR 682          
BLAST of VASA-1 vs. Ensembl Cavefish
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:103040126])

HSP 1 Score: 367.081 bits (941), Expect = 6.475e-113
Identity = 203/461 (44.03%), Postives = 286/461 (62.04%), Query Frame = 3
Query: 1410 PDDNQEDYELHV--NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVA-----------------FPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYI-KTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMANYSRDTR 2732
            P + + ++EL    N+GINF+ YD IPVE TG++ P  +  F  + + E +  N+   +YT+ TPVQK+AIPII +KRDLMACAQTGSGKTAAFL+P+   LS+  T+ P  A+                  +P +L++APTREL  QI+  AR     S ++   +YGG ++ +  R+++  GC +LVATPGRL+  +E   + L Y  + VLDEADRMLD  GF   + +I  E +      + Q  MFSATFP EIQ LAR+ L+ Y+FLAVG VGS + ++ Q+++  ++ +K +  ++ +  T  D  TL+FVE+K+ AD +   L   G+  T+IHGDR Q  RE AL+ F+SGR   MVAT VAARGLDI  V +VIN D+P  I+ YVHRIGRTGR GN+G A SF+++ K+  + + L+  L EA QE P WL +L      + +N  R  R
Sbjct:  258 PPNERVEHELFSASNTGINFEKYDDIPVEATGNNCPGPIENFHDVDMGEIIMGNITLSRYTRPTPVQKHAIPIIKAKRDLMACAQTGSGKTAAFLLPV---LSQIYTDGPGEALQASKASGQENGKYGRRKQYPISLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRDLE-RGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDM-GFEPQIRRIV-EQDTMPPKGARQTMMFSATFPKEIQILARDFLEEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGRCPIMVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFYND-KNSNITKDLLDILVEAKQEVPSWLESLAFEHQHKNSNRGRSKR 711          
BLAST of VASA-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 375.941 bits (964), Expect = 9.539e-120
Identity = 205/446 (45.96%), Postives = 285/446 (63.90%), Query Frame = 3
Query: 1407 IPDDNQEDYELHV--NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAV----------------AFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANF-SGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYI-KTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRAL 2684
            +P +++ + EL    N+GINF+ YD IPVE TG+D PP + +F  L L E + S+V   +Y + TPVQKYAIPII +KRDLMACAQTGSGKTAAFL+PI+  +   G   P   V                 +P +L++APTREL  QI+  AR     S ++   +YGG ++    R +Q  GC +LVATPGRL+  +E   + L + ++ VLDEADRMLD  GF   + +I  +    +  DR  Q  MFSATFP EIQ LAR+ L++Y+FLAVG VGSA+ ++ Q+++  ++ +K +  ++ +  T  D  TL+FVE+K+ AD +   L   G+  T+IHGDR Q  RE AL+ F++GR   +VAT VAARGLDIP V +VIN D+P  I+ YVHRIGRTGR GN+G+A SF++E K+  + + L+  L EA+QE P WL  +
Sbjct:   19 LPRNDRIEKELFAGSNTGINFEKYDDIPVEATGNDCPPHIESFHELELGEIIMSSVTLCRYERPTPVQKYAIPIIKAKRDLMACAQTGSGKTAAFLLPILSQIYSGG---PGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEARKFAYRSCVRPCVVYGGADIGNQVRELQ-KGCHLLVATPGRLVDMMERGKVGLDHCRYLVLDEADRMLDM-GFEPQIRRIVEQDVMPTKGDR--QTLMFSATFPKEIQILARDFLEDYIFLAVGRVGSASENITQKVVWVEEMDKRSFLLDLLNATGRDSLTLVFVETKKGADALQGFLCSEGYSCTSIHGDRSQRDREEALSLFRTGRRPILVATAVAARGLDIPNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGQATSFYNE-KNENMTRELLHLLVEAHQEVPSWLETM 456          
BLAST of VASA-1 vs. Ensembl Sea Lamprey
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 236.498 bits (602), Expect = 2.572e-66
Identity = 153/446 (34.30%), Postives = 230/446 (51.57%), Query Frame = 3
Query: 1338 GQKQPEQTNQNDDAIPIVKRAT--FIPDDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEI-IQSDQREKVNTAIEY-IKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQEC 2663
            G   P + N+  D +P +  +   + P D     E    S +      ++  +V+G   P   ++F      E L + +   ++T+ TP+Q   IPI  S RD++  A+TGSGKTA+F+ P++  +       P      P  LI  PTRELC+QI    +   +  N+    +YGG  M +  + +Q  G +I+V TPGRLI  ++    +L+ + + V DEADRM D  GF   V  I   AN    DR  Q  ++SATF   ++ LAR++L + + +  G +G AN DV Q + I S+   K N    + ++       LIFV  K  ++ +   L   GF+   +HGD +Q +R   ++DFK   +  MVAT+VAARGLDIP +  V+N D+   IDT+ HR+GRTGR G  G A +     KD+  A  LV  L+ ANQ  
Sbjct:  186 GNPIPPEKNKVIDPLPSIDHSEIEYEPFDKNFYVEHEEISSLGASEAHELKAQVSGAAPPKPCSSFGHFGFDEQLLNLIRKSEFTQPTPIQCQGIPIALSGRDIIGIAKTGSGKTASFIWPMLVHIMAQKELKPGDG---PIGLICVPTRELCQQINVECKRFGKAYNLHSVAVYGGGSMWEQAKALQ-EGAEIVVCTPGRLIDHVKKKATNLQRVTYLVFDEADRMFDM-GFEYQVRSI---ANHVRPDR--QTMLYSATFRMRVEKLARDILIDPIRVVQGDIGEANEDVTQRVEIFSNGAAKWNWLCSHLVEFTSSGSVLIFVTRKDNSEELSNDLEQEGFQVGLLHGDMDQSERNKVISDFKKKVIPIMVATDVAARGLDIPSIKTVVNYDVARDIDTHTHRVGRTGRAGEKGTAFTLMTH-KDMNFAGDLVRNLEGANQHV 620          
BLAST of VASA-1 vs. Ensembl Sea Lamprey
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 236.113 bits (601), Expect = 3.352e-66
Identity = 141/392 (35.97%), Postives = 203/392 (51.79%), Query Frame = 3
Query: 1485 VEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSE-NGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNE--------------------ANF-SGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFF 2594
            +   G  +P  +  +    LP  +   +E   Y   TP+Q+ AIPI    RD++  A+TGSGKTAAFLIP++  ++     +        P A+I+APTREL +QI        +   I+   + GGI        ++  GC I++ATPGRLI  LE  +L L    + VLDEADRM+D  GF   V +I                       ANF SG  +  Q  MF+AT P  ++ LAR+ L+    + +G VG     V+Q +    + EK    +E +    +   +IFV  K+  D +   L  +GF A T+HG + QEQRE AL++ K+G  + +VAT+VA RG+DI  V  V+N DM   I+ Y HRIGRTGR G  G +++F 
Sbjct:  308 ITTKGGKIPNPIRLWKESILPSHIREVIEKCGYKDPTPIQRQAIPIGLQNRDIIGIAETGSGKTAAFLIPLLVWITTLPKIDRIEDTDQGPYAVILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLR-MGCKIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDM-GFEPDVQRILEHMPVSNQKPDTDDAEDPDKMTANFESGRHKYRQTVMFTATMPAAVERLARSYLRRPAVVYIGSVGKPIERVEQRVFIMGESEKRKKLLELLSRGFEPPIIIFVNQKKGCDVLAKSLEKMGFNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVSMVLNYDMAKNIEDYTHRIGRTGRAGKSGVSVTFL 697          
BLAST of VASA-1 vs. Ensembl Sea Lamprey
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 216.468 bits (550), Expect = 2.695e-58
Identity = 133/374 (35.56%), Postives = 198/374 (52.94%), Query Frame = 3
Query: 1485 VEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLEL---VWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDE-KTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFF 2594
            V V G   P  + T+    +   + + ++   Y K TP+Q  AIP I S RDL+  A+TGSGKT  FL+P+ + + +   + P      P  +IM PTREL  QI    R   +   ++   +YGG  +++    ++  G +I+V TPGR+I  L        + R   + VLDEADRM D  GF   V +I      S  DR  Q  MFSATFP  ++ LAR +L   + + VG      SDV+Q +I  ++  K    +E +    ++   ++FV+ +  AD +   L    +   ++HG  +Q  R+  +NDFKSG    MVAT+VAARGLD+  +  V+N D P+  + YVHR+GRTGR GN G + +F 
Sbjct:  357 VMVKGKGCPKPIKTWVQCGISMKILNTLKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIGFLLPMFRHVMD---QRPLEEGEGPIGVIMTPTRELALQIAKECRKFTKQLALRVVCVYGGTGISEQIAELK-RGAEIIVCTPGRMIDMLAANSGRVTNFRRATYMVLDEADRMFDM-GFEPQVMRIIET---SRPDR--QTVMFSATFPRAMEALARRILNKPVEVQVGGRSVVCSDVEQHVIVIEEDTKFYKLLELLGLYQEKGAVIVFVDKQEHADTLLKDLMKASYPCLSLHGGIDQYDRDSIINDFKSGVCRLMVATSVAARGLDVKHLIMVVNYDCPNHYEDYVHRVGRTGRAGNKGYSYTFI 720          
BLAST of VASA-1 vs. Ensembl Sea Lamprey
Match: ddx27 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:ZFIN;Acc:ZDB-GENE-031001-8])

HSP 1 Score: 206.068 bits (523), Expect = 1.053e-55
Identity = 133/378 (35.19%), Postives = 206/378 (54.50%), Query Frame = 3
Query: 1524 TFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLI-HFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDV----KQEIIQ-----SDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDE-----MKDI 2612
            TF  ++L   L   + ++ + + TP+QK  IP+    +D+ ACA TG+GKTAAF++P+++ L     ++P + V     L++ PTREL  Q+ +  R L +  N++ +   GG+++      ++A G DIL+ATPGRLI H        L  ++  +LDEADRMLD + F E + +I  + +        Q  +FSAT  +++Q LA   LK+     V +  ++N+DV    +QE ++        RE + +A+   +T  D   +       +   +G+++G L       HG+  Q QR  AL  FK  +++ +VAT+VAARGLDI  V  VIN  MP TI  YVHR+GRT R G  GR+IS   E     +KDI
Sbjct:  220 TFPDMNLSRPLLKAISSMGFQQPTPIQKSCIPVGLLGKDICACAATGTGKTAAFMLPVLERLVYKPRQAPVTRV-----LVLVPTRELGIQVHSVTRQLSQFCNVQTSLAVGGLDIKTQEAALRA-GPDILIATPGRLIDHLQNCPSFDLSSIEILILDEADRMLD-EYFEEQMKEIIRQCSHQR-----QTMLFSATMTDQVQDLAAVSLKH----PVKIFVNSNTDVAPYLRQEFVRIRPNREGDREAIVSAL-LTRTFQDHVMVFTHRLHILLGLLGLRVGEL-------HGNLSQTQRLEALRRFKDDQIDILVATDVAARGLDIEGVKTVINFTMPSTIKHYVHRVGRTARAGRAGRSISLVGETERRVLKDI 573          
BLAST of VASA-1 vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 374.4 bits (960), Expect = 1.521e-118
Identity = 203/430 (47.21%), Postives = 276/430 (64.19%), Query Frame = 3
Query: 1446 NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPII-KSLSENGTESPASA------VAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFS--GDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLR-ALCDGSGSR 2705
            +SGINFDNYD IPV+ +G DVP  +  F+S  L   L  N++  ++TK TPVQKY++PI+ + RDLMACAQTGSGKT  FL P++ +S     +  P S        A+P A+IMAPTREL  QIF  A+     S +K   +YGG  +    R I+  GCD+LVATPGRL   LE   +SL  +++ VLDEADRMLD  GF   +  I  + + +  G+ +++   MFSATFP +IQ LAR+ L +Y+FL+VG VGS + ++ Q+++  + ++K +  ++ +    D  TLIFVE+KRMAD +   L    F+AT IHGDR Q +RE AL  F+SG    +VAT VAARGLDIP V +VIN D+P  +D YVHRIGRTGR GN G A +FF+  ++  + +GL   L EANQE P +L+ A+    GSR
Sbjct:  117 SSGINFDNYDDIPVDASGKDVPEPITEFTSPPLDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQLREIE-RGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDM-GFEPQIRHIVEDCDMTPVGERQTL---MFSATFPADIQHLARDFLSDYIFLSVGRVGSTSENITQKVLYVENQDKKSALLDLLSASTDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATAVAARGLDIPNVTHVINYDLPSDVDDYVHRIGRTGRAGNTGLATAFFNS-ENSNIVKGLHEILTEANQEVPSFLKDAMMSAPGSR 540          
BLAST of VASA-1 vs. Ensembl Yeast
Match: DBP1 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs; protein abundance increases in response to DNA replication stress; DBP1 has a paralog, DED1, that arose from the whole genome duplication [Source:SGD;Acc:S000006040])

HSP 1 Score: 373.629 bits (958), Expect = 4.287e-118
Identity = 233/545 (42.75%), Postives = 305/545 (55.96%), Query Frame = 3
Query: 1077 DRRSEFQRDQRINNDSFARATKENGANNFESKKFRGNNDANNGFRNDEFDGNFQGKRNGNSNDFSTEFDRTVTLEENPAYSSKTFVRGQKQPEQTNQNDDAIPIVKRATFIPDDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG-TESPASAVAF------PKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANF-SGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC 2687
            +R +  Q D+    D F RA ++ G           NN    GF  +   G       G S+++ +  +R              +V G+  P   N   +A         + DD   DY    +SGI FDNYD IPV+ +G DVP  +  FSS  L E L  N++   +TK TPVQKY+IPI+   RDLMACAQTGSGKT  FL P+   L  +G +  P  A +F      P AL++APTREL  QIF  AR     S ++   +YGG  +    R +   GCD+LVATPGRL   LE   +SL  +++ VLDEADRMLD  GF   +  I  E +  S ++R  Q  MFSATFP +IQ LAR+ L NY+FL+VG VGS + ++ Q I+  D  +K +  ++ +       TLIFVE+KRMAD +   L    FKAT IHGDR Q +RE AL+ FK+   + +VAT VAARGLDIP V +VIN D+P  ID YVHRIGRTGR GN G A SFF+   +  + +GL+  L EANQE P +L  L 
Sbjct:   41 ERSTPKQEDKVTGGDFFRRAGRQTG-----------NNGGFFGFSKERNGGTSANYNRGGSSNYKSSGNR--------------WVNGKHIPGPKNAKLEA-----ELFGVHDD--PDYH---SSGIKFDNYDNIPVDASGKDVPEPILDFSSPPLDELLMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREVD-RGCDLLVATPGRLNDLLERGKVSLANIKYLVLDEADRMLDM-GFEPQIRHIVEECDMPSVENR--QTLMFSATFPVDIQHLARDFLDNYIFLSVGRVGSTSENITQRILYVDDMDKKSALLDLLSAEHKGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPNVTHVINYDLPSDIDDYVHRIGRTGRAGNTGVATSFFNS-NNQNIVKGLMEILNEANQEVPTFLSDLS 545          
BLAST of VASA-1 vs. Ensembl Yeast
Match: DBP2 (ATP-dependent RNA helicase of the DEAD-box protein family; has strong preference for dsRNA; interacts with YRA1; required for assembly of Yra1p, Nab2p and Mex67p onto mRNA and formation of nuclear mRNP; involved in mRNA decay and rRNA processing; may be involved in suppression of transcription from cryptic initiation sites [Source:SGD;Acc:S000005056])

HSP 1 Score: 265.774 bits (678), Expect = 9.671e-79
Identity = 154/398 (38.69%), Postives = 238/398 (59.80%), Query Frame = 3
Query: 1485 VEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVG-SANSDVKQ--EIIQS-DQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECP 2666
            + ++G D+P  + TF     P+++ + V+   + K T +Q    P+  S RD++  A TGSGKT ++ +P I  ++     +P      P  L++APTREL  QI T        S I+   +YGG+  ++  R++ + G +I++ATPGRLI  LE+   +L+ + + VLDEADRMLD  GF   + KI ++      DR  Q  M+SAT+P E++ LA + L + + + VG +  SA+ ++ Q  E++   ++R+++N  +E      + KTLIF  +KRM D +   L   G+ A  IHGD++Q +R+  L +F++GR   MVAT+VAARG+D+  ++ VIN DMP  I+ YVHRIGRTGR G  G AISFF E ++ GL   L+S ++EANQ  P
Sbjct:  101 MTISGHDIPKPITTFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAPGDG---PIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDL-SRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDM-GFEPQIRKIVDQIR---PDR--QTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLETASQDNEYKTLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGINYVINYDMPGNIEDYVHRIGRTGRAGATGTAISFFTE-QNKGLGAKLISIMREANQNIP 487          
BLAST of VASA-1 vs. Ensembl Yeast
Match: DBP3 (RNA-Dependent ATPase, member of DExD/H-box family; involved in cleavage of site A3 within the ITS1 spacer during rRNA processing; not essential for growth, but deletion causes severe slow-growth phenotype [Source:SGD;Acc:S000003046])

HSP 1 Score: 244.202 bits (622), Expect = 3.359e-71
Identity = 158/416 (37.98%), Postives = 229/416 (55.05%), Query Frame = 3
Query: 1458 NFDNY---DKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVG--SANSDVKQEIIQSDQREKVNTAIEYIKTI-----PDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWL 2675
            + D Y   ++I VE + D     L +F  L L   + + +   K+ K TP+Q  A P + S +D++  A+TGSGKT AF +P I  L  +  +         + L+++PTREL  QI+     L     ++C  +YGG+  ++ R  IQ     ++VATPGRL+  L+   + L  + + VLDEADRML+  GF E +  I  E + S      Q  MF+AT+P E++ LA   + N + +++G     +AN  + Q +   D R K    +E +K        +EK LIF   K+ A  +   L Y G+    IHGD  Q+QR  ALN+FKSG+ N ++AT+VAARGLDIP V  VIN+  P T++ YVHRIGRTGR G  G A + F E ++  LA GLV+ L  ANQ  P+ L
Sbjct:   90 DIDEYFKENEIAVEDSLDLALRPLLSFDYLSLDSSIQAEIS--KFPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMNDQKKRGI------QVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQR--IQLKKSQVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEK-GFEEDIKNIIRETDASKR----QTLMFTATWPKEVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKKYHSGPKKNEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTVINLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTE-QEKHLAGGLVNVLNGANQPVPEDL 489          
BLAST of VASA-1 vs. Ensembl Yeast
Match: PRP28 (RNA binding protein; involved in RNA isomerization at the 5' splice site and for exchange of U6 for U1 snRNA at the 5' splice site; similar to the RNA helicases of the DEAD-box family [Source:SGD;Acc:S000002651])

HSP 1 Score: 228.794 bits (582), Expect = 4.908e-65
Identity = 138/373 (37.00%), Postives = 208/373 (55.76%), Query Frame = 3
Query: 1548 EFLTSNVENLKYTKLTPVQKYAIPII---DSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVA-FPKALIMAPTRELCRQIFTAARHLCR----GSNIKCAYI--YGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDR-SIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGY-LGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGL 2630
            + L   ++ L++   TP+Q+  IP +      RD +  A TGSGKT AF+IPI+  +S +    P+  +   PKALI+APTREL +QI    + + +     SN  C  I   GG  + +   ++ + GCDILVATPGRLI  LE   L ++ ++  VLDEAD+M+D  GF + VT I  + + + D   + Q  MF+AT    I+ +A   ++  ++  +GV   +   ++Q +  +D  E     ++ I    D   +IF+  K+ AD++  K       K T +HG + QEQRE +L  F++ +V  M+ATNVAARGLDIP V  V+N  +   +D Y+HRIGRTGR  N G A+SF    +D  L + L
Sbjct:  183 DLLRVIIQELRFPSPTPIQRITIPNVCNMKQYRDFLGVASTGSGKTLAFVIPILIKMSRSPPRPPSLKIIDGPKALILAPTRELVQQIQKETQKVTKIWSKESNYDCKVISIVGGHSLEEISFSL-SEGCDILVATPGRLIDSLENHLLVMKQVETLVLDEADKMIDL-GFEDQVTNILTKVDINADSAVNRQTLMFTATMTPVIEKIAAGYMQKPVYATIGVETGSEPLIQQVVEYADNDEDKFKKLKPIVAKYDPPIIIFINYKQTADWLAEKFQKETNMKVTILHGSKSQEQREHSLQLFRTNKVQIMIATNVAARGLDIPNVSLVVNFQISKKMDDYIHRIGRTGRAANEGTAVSFVSAAEDESLIREL 553          
BLAST of VASA-1 vs. Ensembl Nematostella
Match: PL10 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM49])

HSP 1 Score: 364.385 bits (934), Expect = 1.743e-113
Identity = 195/421 (46.32%), Postives = 264/421 (62.71%), Query Frame = 3
Query: 1446 NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAV------AFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYI-KTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC 2687
            N+GINF+ YD IPVE TG + P  +  F  + L E L  NV    Y K TPVQKYAIPI+  KRDLMACAQTGSGKTAAFLIPI+  +   G  +P           +P  L++APTREL  QIF  AR     S  +   +YGG ++    R +    C +LVATPGRL+  ++   + L  ++F VLDEADRMLD  GF   + +I ++ +        Q  MFSATFP EIQ LAR+ L+NY+FLAVG VGS + ++ Q+++  D+ +K +  ++ +  + P + TL+FVE+K+ AD + + L   G+  T+IHGDR Q +RE AL  F+ G    +VAT VAARGLDIP V +VIN D+P  I+ YVHRIGRTGR G+ G A SFF+  K+  +A+ L+  L+E+ QE P WL ++ 
Sbjct:  167 NTGINFEKYDDIPVEATGQECPKNIELFEDVDLGEILLHNVGLAGYKKPTPVQKYAIPIVKGKRDLMACAQTGSGKTAAFLIPILSRIYMEGPPAPPDIKHAGRRRQYPICLVLAPTRELAVQIFDEARKFSYRSLCRPCVVYGGADIGSQLRELDRN-CHLLVATPGRLVDMMDRGRVGLDSIRFLVLDEADRMLDM-GFEPQIRRIVDQDSMPKTGIR-QTLMFSATFPKEIQMLARDFLENYIFLAVGKVGSTSENITQKVVWVDEFDKRSFLLDLLNASGPQQLTLVFVETKKGADALEMFLAKDGYYCTSIHGDRSQREREEALRTFRCGDTPILVATAVAARGLDIPNVKHVINFDLPTDIEEYVHRIGRTGRVGHTGLATSFFNH-KNKNVAKELMDILEESKQEIPSWLESMA 583          
BLAST of VASA-1 vs. Ensembl Nematostella
Match: VAS1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJG3])

HSP 1 Score: 306.605 bits (784), Expect = 7.769e-96
Identity = 166/345 (48.12%), Postives = 219/345 (63.48%), Query Frame = 3
Query: 1644 MACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWL 2675
            MACAQTGSGKTAA+++P++ SL + G  +P  +   P AL +APTREL +QI+  AR     + IK    YGG+ +      ++  GC  LV TPGRL  F+    + L  +Q  +LDEADRMLD  GF   + K+  E+N +  + S Q  MFSATFP+EIQ LA + LK +YLFLAVG VG  N D+ Q +I  +  EK +   E +     ++TL+FVE KR+ADF+   L    F  T+I  DR Q +RE AL DF+ GR N +VAT+VAARGLDIP V +VIN D+P  I+ YVHR+GRTGR GN G+A +F++  +D  LA+ LV  L EA QE P WL
Sbjct:    1 MACAQTGSGKTAAYMLPVLTSLIKQGLNAPPRS---PLALCVAPTRELAKQIYIEARKFSDHTPIKVCVCYGGVSVPYQASQLE-RGCHFLVGTPGRLQDFVSREKIYLGSIQHLILDEADRMLDL-GFGPDIHKLIEESNMTAKE-SRQTLMFSATFPDEIQHLAGSFLKPDYLFLAVGRVGGTNLDITQHVITVNGSEKRDKLHEILSATGTDRTLVFVELKRVADFLAAWLSQNNFPTTSISSDRCQSEREAALRDFRDGRANILVATSVAARGLDIPNVKHVINYDLPQDIEEYVHRVGRTGRIGNEGKATAFYEVGRDDRLARSLVKVLSEALQEVPAWL 339          
BLAST of VASA-1 vs. Ensembl Nematostella
Match: EDO27708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8H9])

HSP 1 Score: 313.923 bits (803), Expect = 3.031e-95
Identity = 193/477 (40.46%), Postives = 273/477 (57.23%), Query Frame = 3
Query: 1350 PEQTNQNDDAIPIVKRATFIP----DDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELV----WLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDG--------SGSRMANYSRDTR 2732
            P ++   ++ IP  K  T++P    +D +E +   +  GINF+ YD+I V V+G++    +N+F   +L E   +NV   +Y K TPVQKY+IPI+ + RD+MACAQTGSGKT  F    I ++  +        +A  K +++     +    F+    L     +   +++       ++R    T C  +V +      F+ L+     +SL+ LQF +LDEADRMLD  GF  ++ +I        D    Q  MFSATFP EIQ LA + L +YLFL VG VG   SD++Q +I+    EK +   + +     ++TL+FVESKR ADF+ I L   GF  T+IHGDR Q++RE AL+DF+ GR   ++ATNVAARGLDI  V +VIN D+P  ID YVHRIGRTGR GN G+A +FF   +D  +A+GLV  L EANQE P+WL  + +G        +G R    SRDTR
Sbjct:  163 PNESAAGENGIP--KPVTYVPPTPTEDEEEMFRSTIQQGINFEKYDQIEVLVSGNNPVRHINSFEEANLYEAFLNNVRKAQYKKPTPVQKYSIPIVIAGRDVMACAQTGSGKTYWFSKYCIATIFISRQRQTFLNLAQFKCVLVISYPSIIHSYFSGLSELVV-IVMSAPFLHNTASTCGNKR----TAC--MVISFLNFSGFISLIEQNSTVSLKGLQFLILDEADRMLDM-GFEPAIRRIVESMGMP-DKSERQTLMFSATFPEEIQRLAGDFLNDYLFLTVGRVGGTTSDIEQTVIEVTDNEKRDRLTQILGDA--DRTLVFVESKRSADFLAIFLSGEGFPTTSIHGDRLQQEREEALDDFRKGRCPVLIATNVAARGLDIDDVKHVINFDLPSDIDEYVHRIGRTGRIGNKGKATTFFLRGRDDKVARGLVKVLSEANQEVPEWLEEIAEGAIGTDYGPAGGRFG--SRDTR 624          
BLAST of VASA-1 vs. Ensembl Nematostella
Match: VAS2 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNU5])

HSP 1 Score: 250.366 bits (638), Expect = 6.146e-76
Identity = 134/285 (47.02%), Postives = 181/285 (63.51%), Query Frame = 3
Query: 1677 AAFLIPIIKSLSENG-TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTID 2528
            AAFL+P++ S+   G T S  S    P+A+ +APTREL  QI+  AR    G+ ++    YGG+ ++   R +Q +GC++LV TPGRL  F+E   +SL+ LQF +LDEADRMLD  GF  ++ +I        D    Q  MFSATFP EIQ LA + L +YLFL VG VG   SD++Q +I+    EK +   + +     ++TL+FVESKR ADF+ I L   GF  T+IHGDR Q++RE AL+DF+ GR   ++ATNVAARGLDI  V +VIN D+P  ID
Sbjct:    4 AAFLLPVMTSMMNAGLTSSSFSETQTPQAMCIAPTRELANQIYLEARKFAHGTMLRPVVCYGGVSVSHQLRQLQ-SGCNLLVGTPGRLTDFIEKGKVSLKGLQFLILDEADRMLDM-GFEPAIRRIVESMGMP-DKSERQTLMFSATFPEEIQRLAGDFLNDYLFLTVGRVGGTTSDIEQTVIEVTDNEKRDRLTQILGDAGTDRTLVFVESKRSADFLAIFLSGEGFPTTSIHGDRLQQEREEALDDFRKGRCPVLIATNVAARGLDIDDVKHVINFDLPSDID 285          
BLAST of VASA-1 vs. Ensembl Nematostella
Match: EDO38061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX5])

HSP 1 Score: 246.899 bits (629), Expect = 1.536e-72
Identity = 149/396 (37.63%), Postives = 222/396 (56.06%), Query Frame = 3
Query: 1485 VEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVG-SANSDVKQEIIQSDQREKVNTAIEYIKTIPDEK---TLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQE 2660
            + V G +VP  + TF     P+++ S  +   +T+ T +Q    P+  + R+L+  AQTGSGKT +F++P I  ++      P      P  L++ PTREL +Q+   A  + +   ++   IYGG       R ++  G +I +ATPGRLI  LE    +LR   + VLDEADRMLD  GF   +  I ++      DR  Q  M+SAT+P E+Q LA + L +Y+ + VG +G +AN  + Q +   +  EK +  ++ ++ I  EK   TLIF E+KR AD +  KL   G+ A  IHGD+ Q +R+  L++F+ G    +VAT+VA+RGLDI  +  VIN D P+  + YVHRIGRT R    G + +FF  + +   A+ LVS LQEA Q 
Sbjct:   46 LTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQGWPVALTGRNLVGIAQTGSGKTLSFILPGIVHINHQPLLQPGDG---PIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELE-RGVEICIATPGRLIDMLESRKTNLRRCTYLVLDEADRMLDM-GFEPQIRTIIDQIR---PDR--QTLMWSATWPKEVQGLAHDFLSDYVHITVGSLGLTANHKILQIVDVCEDHEKEHKLLKLLEEIMGEKENKTLIFTETKRRADELTRKLRSDGWPAMCIHGDKAQPERDWVLSEFRKGHAPILVATDVASRGLDISDIKFVINFDFPNCTEDYVHRIGRTARSDRTGTSYTFFT-VNNAKQAKELVSVLQEAKQH 430          
BLAST of VASA-1 vs. Ensembl Medaka
Match: ddx4 (DEAD-box helicase 4 [Source:NCBI gene;Acc:100049226])

HSP 1 Score: 397.897 bits (1021), Expect = 1.895e-126
Identity = 219/468 (46.79%), Postives = 292/468 (62.39%), Query Frame = 3
Query: 1368 NDDAIPIVKRATFIPDDNQEDYEL---HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTE-SPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGS-GSRMANYSRDTRKNVKSSK 2753
            +D A P   + T+IP    ED +    H   GINFD YD I V+V+G ++P A+ TF    L E L +N+    Y K TPVQKY +PII + RDLMACAQTGSGKTAAFL+PI++ L  +G   S  S +  P+A+I+APTREL  QI+  AR    G+ ++   +YGG+      R I+  GC++L  TPGRL+  +    + L  ++  VLDEADRMLD  GF   + ++         +   Q  MFSATFP +IQ LA + LK +YLF+AVGVVG A +DV+Q  +Q  +  K    ++ ++TI  E+T++FVE+KR ADF+   L       T+IHGDREQ +RE AL DF+SG+   +VAT+VA+RGLDIP V +V+N D+P+TID YVHRIGRTGRCGN GRA+SF+D   D  LA+ LV  L +A QE P WL     G+ GS   N S  T  +  S K
Sbjct:  127 SDAADPERPKVTYIPPSLPEDEDSIFSHYKMGINFDKYDDILVDVSGTNLPAAIMTFEEAKLCESLKNNISRSGYVKPTPVQKYGLPIISAGRDLMACAQTGSGKTAAFLLPILQQLMADGVAASRFSEIQEPEAVIVAPTRELINQIYQEARKFSFGTCVRPVVVYGGVNTGYQMREIE-KGCNVLCGTPGRLLDMIGRGKVGLSKVRHLVLDEADRMLDM-GFEPDMRRLVGSPGMPSKEER-QTLMFSATFPEDIQRLAADFLKVDYLFVAVGVVGGACTDVEQTFLQVTKFNKREQLLDLLRTIGSERTMVFVETKRQADFIAAFLCQEKVPTTSIHGDREQREREKALADFRSGKCPVLVATSVASRGLDIPDVQHVVNFDLPNTIDDYVHRIGRTGRCGNTGRAVSFYDPDVDSQLARSLVGILAKAQQEVPSWLEESAFGAHGSAAFNPSGRTFASTDSRK 591          
BLAST of VASA-1 vs. Ensembl Medaka
Match: ddx4 (DEAD-box helicase 4 [Source:NCBI gene;Acc:100049226])

HSP 1 Score: 397.512 bits (1020), Expect = 6.943e-125
Identity = 219/468 (46.79%), Postives = 292/468 (62.39%), Query Frame = 3
Query: 1368 NDDAIPIVKRATFIPDDNQEDYEL---HVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTE-SPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLK-NYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGS-GSRMANYSRDTRKNVKSSK 2753
            +D A P   + T+IP    ED +    H   GINFD YD I V+V+G ++P A+ TF    L E L +N+    Y K TPVQKY +PII + RDLMACAQTGSGKTAAFL+PI++ L  +G   S  S +  P+A+I+APTREL  QI+  AR    G+ ++   +YGG+      R I+  GC++L  TPGRL+  +    + L  ++  VLDEADRMLD  GF   + ++         +   Q  MFSATFP +IQ LA + LK +YLF+AVGVVG A +DV+Q  +Q  +  K    ++ ++TI  E+T++FVE+KR ADF+   L       T+IHGDREQ +RE AL DF+SG+   +VAT+VA+RGLDIP V +V+N D+P+TID YVHRIGRTGRCGN GRA+SF+D   D  LA+ LV  L +A QE P WL     G+ GS   N S  T  +  S K
Sbjct:  237 SDAADPERPKVTYIPPSLPEDEDSIFSHYKMGINFDKYDDILVDVSGTNLPAAIMTFEEAKLCESLKNNISRSGYVKPTPVQKYGLPIISAGRDLMACAQTGSGKTAAFLLPILQQLMADGVAASRFSEIQEPEAVIVAPTRELINQIYQEARKFSFGTCVRPVVVYGGVNTGYQMREIE-KGCNVLCGTPGRLLDMIGRGKVGLSKVRHLVLDEADRMLDM-GFEPDMRRLVGSPGMPSKEER-QTLMFSATFPEDIQRLAADFLKVDYLFVAVGVVGGACTDVEQTFLQVTKFNKREQLLDLLRTIGSERTMVFVETKRQADFIAAFLCQEKVPTTSIHGDREQREREKALADFRSGKCPVLVATSVASRGLDIPDVQHVVNFDLPNTIDDYVHRIGRTGRCGNTGRAVSFYDPDVDSQLARSLVGILAKAQQEVPSWLEESAFGAHGSAAFNPSGRTFASTDSRK 701          
BLAST of VASA-1 vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 365.54 bits (937), Expect = 4.028e-114
Identity = 195/426 (45.77%), Postives = 271/426 (63.62%), Query Frame = 3
Query: 1446 NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVA-----------FPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSI-QISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYI-KTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRAL 2684
            N+GINF+ YD IPVE TG + PP + +F  + + E +  N+   +Y + TPVQKYAIPII +KRDLMACAQTGSGKTAAFL+P++  +  +G   P  A+            +P +L++APTREL  QI+  AR     S ++   +YGG ++ +  R ++  GC +LVATPGRL+  +E   + L Y  + VLDEADRMLD  GF   + +I  +       + I Q  MFSATFP EIQ LAR+ L++Y+FLAVG VGS + ++ Q+++  +  +K +  ++ +  T  D  TL+FVE+K+ AD +   L   G+  T+IHGDR Q  RE AL+ F+SG    +VAT VAARGLDI  V +VIN D+P  I+ YVHRIGRTGR GN+G A SFF++ K+  + + L+  L EA QE P WL +L
Sbjct:  124 NTGINFEKYDDIPVEATGSNCPPHIESFHDVDMGEIVMGNIALTRYDRPTPVQKYAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYSDG---PGDALQADNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELE-RGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDM-GFEPQIRRIVEQDTMP--PKGIRQTMMFSATFPKEIQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEDNDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFND-KNSNITKDLLDILVEAKQEVPSWLESL 541          
BLAST of VASA-1 vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 367.851 bits (943), Expect = 6.308e-114
Identity = 223/551 (40.47%), Postives = 314/551 (56.99%), Query Frame = 3
Query: 1119 DSFARATKENGANNFESKKFRGNND-ANNGFRNDEFDGNFQGKRNGNSNDFSTEFDRTVT--LEENPAYSSKTFVRGQ-------KQPEQTNQNDDAIPIVKRATFIPDDNQEDYELHV--NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVA--------------FPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSI-QISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYI-KTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC 2687
            + F     +N AN     +    ND A  G+ N E  G++ G    + N F    DRT +    +  A S   + RG        +  E T ++D + P        P++  E  EL    N+GINF+ YD IPVE TG + PP + +F  + + E +  N+   +Y + TPVQKYAIPII +KRDLMACAQTGSGKTAAFL+P++  +  +G      A                +P +L++APTREL  QI+  AR     S ++   +YGG ++ +  R ++  GC +LVATPGRL+  +E   + L Y  + VLDEADRMLD  GF   + +I  +       + I Q  MFSATFP EIQ LAR+ L++Y+FLAVG VGS + ++ Q+++  +  +K +  ++ +  T  D  TL+FVE+K+ AD +   L   G+  T+IHGDR Q  RE AL+ F+SG    +VAT VAARGLDI  V +VIN D+P  I+ YVHRIGRTGR GN+G A SFF++ K+  + + L+  L EA QE P WL +L 
Sbjct:   96 NGFVNGYHDNRANGGFGGRGSSRNDRAFGGYENKE--GSWGGASRDSYNSFGGRNDRTKSSFFNDRGAGSRGRYERGGFSGGGSSRWGEDTREDDWSKPTA------PNERLEQ-ELFSGGNTGINFEKYDDIPVEATGSNCPPHIESFHDVDMGEIVMGNIALTRYDRPTPVQKYAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQAAKNNGQDNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELE-RGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDM-GFEPQIRRIVEQDTMP--PKGIRQTMMFSATFPKEIQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEDNDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFND-KNSNITKDLLDILVEAKQEVPSWLESLA 632          
BLAST of VASA-1 vs. Ensembl Medaka
Match: ddx3xa (DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc:101158982])

HSP 1 Score: 365.54 bits (937), Expect = 1.597e-113
Identity = 194/430 (45.12%), Postives = 269/430 (62.56%), Query Frame = 3
Query: 1446 NSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVA--------------FPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSI-QISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYI-KTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALC 2687
            N+GINF+ YD IPVE TG + PP + +F  + + E +  N+   +Y + TPVQKYAIPII +KRDLMACAQTGSGKTAAFL+P++  +  +G      A                +P +L++APTREL  QI+  AR     S ++   +YGG ++ +  R ++  GC +LVATPGRL+  +E   + L Y  + VLDEADRMLD  GF   + +I  +       + I Q  MFSATFP EIQ LAR+ L++Y+FLAVG VGS + ++ Q+++  +  +K +  ++ +  T  D  TL+FVE+K+ AD +   L   G+  T+IHGDR Q  RE AL+ F+SG    +VAT VAARGLDI  V +VIN D+P  I+ YVHRIGRTGR GN+G A SFF++ K+  + + L+  L EA QE P WL +L 
Sbjct:  172 NTGINFEKYDDIPVEATGSNCPPHIESFHDVDMGEIVMGNIALTRYDRPTPVQKYAIPIIKTKRDLMACAQTGSGKTAAFLLPVLSQIYSDGPGDALQAAKNNGQDNGRYGRRKQYPLSLVLAPTRELALQIYDEARKFAYRSRVRPCVVYGGADIGQQIRELE-RGCHLLVATPGRLVDMMERGKIGLDYCNYLVLDEADRMLDM-GFEPQIRRIVEQDTMP--PKGIRQTMMFSATFPKEIQILARDFLEDYIFLAVGRVGSTSENITQKVVWVEDNDKRSFLLDLLNATGKDSLTLVFVETKKGADALEDFLYREGYACTSIHGDRSQRDREEALHQFRSGHCPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFND-KNSNITKDLLDILVEAKQEVPSWLESLA 596          
BLAST of VASA-1 vs. Planmine SMEST
Match: SMESG000067941.1 (SMESG000067941.1)

HSP 1 Score: 1290.4 bits (3338), Expect = 0.000e+0
Identity = 669/669 (100.00%), Postives = 669/669 (100.00%), Query Frame = 3
Query:  837 MDRRKPRDDSRDHKKYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQENRTRNRKEEFKRDESWEDRRSEFQRDQRINNDSFARATKENGANNFESKKFRGNNDANNGFRNDEFDGNFQGKRNGNSNDFSTEFDRTVTLEENPAYSSKTFVRGQKQPEQTNQNDDAIPIVKRATFIPDDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMANYSRDTRKNVKSSKYIDNPTDDGFMKGTNIDYDDVKPTSEWLED 2843
            MDRRKPRDDSRDHKKYRDDSRDKRNNLKRRDDSYDNNDRNRRPDRRNRDDSRENRKKRDDSQENRTRNRKEEFKRDESWEDRRSEFQRDQRINNDSFARATKENGANNFESKKFRGNNDANNGFRNDEFDGNFQGKRNGNSNDFSTEFDRTVTLEENPAYSSKTFVRGQKQPEQTNQNDDAIPIVKRATFIPDDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMANYSRDTRKNVKSSKYIDNPTDDGFMKGTNIDYDDVKPTSEWLED
Sbjct:  276 MDRRKPRDDSRDHKKYRDDSRDKRNNLKRRDDSYDNNDRNRRPDRRNRDDSRENRKKRDDSQENRTRNRKEEFKRDESWEDRRSEFQRDQRINNDSFARATKENGANNFESKKFRGNNDANNGFRNDEFDGNFQGKRNGNSNDFSTEFDRTVTLEENPAYSSKTFVRGQKQPEQTNQNDDAIPIVKRATFIPDDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMANYSRDTRKNVKSSKYIDNPTDDGFMKGTNIDYDDVKPTSEWLED 944          

HSP 2 Score: 346.665 bits (888), Expect = 6.704e-104
Identity = 188/189 (99.47%), Postives = 189/189 (100.00%), Query Frame = 3
Query:   72 MSVNDGLSDEEWGAWGQTSVVTENISTQKNNSKPQNGFGSDDEVIINTDTSNVQAISKFSVNSYNKENNLNGGSYEKXXXXXXXXXXXXXATRKVESEDKNETNGDRNYNRNGYSNDRDTKPNYQNNRNSEFKRNGNEQNNYPNDRNFNKRDNSPGDKNQYANKRNDSRERSRNNGLFDDSRERKTPRG 638
            MSVNDGLSDEEWGAWGQTSVVTENISTQKNNSKPQNGFGSDDEVIINTDTSNVQAISKFSVNSYNKENNLNGGSYEKRGGFNGNRGTNRFATRKVESEDKNETNGDRNYNRNGYSNDRDTKPNYQNNRNSEFKRNGNEQNNYPNDRNFNKRDNSPGDKNQYAN+RNDSRERSRNNGLFDDSRERKTPRG
Sbjct:    1 MSVNDGLSDEEWGAWGQTSVVTENISTQKNNSKPQNGFGSDDEVIINTDTSNVQAISKFSVNSYNKENNLNGGSYEKRGGFNGNRGTNRFATRKVESEDKNETNGDRNYNRNGYSNDRDTKPNYQNNRNSEFKRNGNEQNNYPNDRNFNKRDNSPGDKNQYANERNDSRERSRNNGLFDDSRERKTPRG 189          
BLAST of VASA-1 vs. Planmine SMEST
Match: SMESG000049071.1 (SMESG000049071.1)

HSP 1 Score: 550.821 bits (1418), Expect = 0.000e+0
Identity = 264/461 (57.27%), Postives = 345/461 (74.84%), Query Frame = 3
Query: 1389 VKRATFIPDDNQEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCDGSGSRMANYSR---DTRKNVKSSKYID 2762
            V+R  +IPDDN EDY+LHVNSGINFDNYD + V VTG ++P A+ +     +PEFL  N+++  Y KLTPVQKY IP+I+S RDLMACAQTGSGKT AFL+PIIK++SEN  ++ +S    PK LI+ PTRELCRQIFT A  LC+ S++KC+Y YGG+EM  S   ++   CDILV+TPGRL+  LE   +SL  +++ VLDEADR+L ++ F ES+  +Y ++   G D+   +SMFSATFP EIQ L  +LL ++LF+AVG+VG+AN+D+KQ ++Q +  +K+N ++EY+      KTL+FV++KR ADF+GI+L  L   ATTIHGDR+Q  RE ALNDFKSGRVNF+VAT+VA+RGLDIPKVD VINIDMP+ +D Y+HRIGRTGRCGN G ++SFFDE KDI LA  LV  L E+ QECPDWL +LC  SG R   + R   D R+NV+SS +++
Sbjct:   77 VQRVNYIPDDNAEDYQLHVNSGINFDNYDNVQVHVTGRNIPEAITSIEDFQIPEFLRLNIKSSDYKKLTPVQKYTIPMINSGRDLMACAQTGSGKTMAFLVPIIKNISEN-PDTSSSGKNSPKCLIVVPTRELCRQIFTVAHRLCKDSSVKCSYSYGGVEMRTSM--MKLYKCDILVSTPGRLVANLESAAISLDKIRYLVLDEADRLLQNEKFMESIKLVYEKSKLVGVDK-FHVSMFSATFPAEIQQLGESLLSDHLFVAVGLVGAANTDIKQTVLQVNSHDKLNASLEYLTNNKTGKTLVFVQAKRFADFLGIRLIDLNLLATTIHGDRDQAARESALNDFKSGRVNFLVATDVASRGLDIPKVDTVINIDMPEDMDVYIHRIGRTGRCGNPGLSVSFFDEEKDIALAPRLVKILNESGQECPDWLHSLC--SGYRPFEHGRNRKDYRQNVESSTFVE 531          
BLAST of VASA-1 vs. Planmine SMEST
Match: SMESG000013025.1 (SMESG000013025.1)

HSP 1 Score: 377.481 bits (968), Expect = 9.792e-117
Identity = 229/502 (45.62%), Postives = 297/502 (59.16%), Query Frame = 3
Query: 1443 VNSGINFDNYDKIPVEVTGDDVPPALNT--FSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSL-SENGTESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANF-SGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTI-----PDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLRALCD--------GSGSRMANY---------SRDTRKNVKSSKYIDNPTDDGFMKGTNIDYDDVKPTSEWLED*NIFIRANK 2870
            + S INFD YD IPV VTG D   A+N   F  L L   + +N+    Y + TP+QK AIP I   RD+MACAQTGSGKTAAFLIPII  L S++ +    +  A+PK LI+APTREL  QI + ++     + ++   +YGG + +   R +Q  GC +LVATPGRL+ F+E   +SL   ++ VLDEADRMLD  GF   + KI  E+N  SG +R  Q  MFSATFP EIQ LA + L NY+F+ VG VGS +  +KQEII     EK+N    Y+K I     P+   LIFVE+K+ AD +   L   G+  ++IHGDR Q +RE ALN F++G+   +VAT VAARGLDIP V +VIN D+P  I+ YVHRIGRTGR GN GRA SF+ + K+  +A  LV  L+EANQ  P WL AL D        GS ++  N           RD R+   S     N   D F+ G+      V P    L + N F R+N+
Sbjct:  158 LTSAINFDKYDAIPVSVTGPDYS-AINVENFDELKLNPIIRNNILLASYQRPTPIQKNAIPAILEHRDIMACAQTGSGKTAAFLIPIINHLISQDLSPQRYTKTAYPKCLILAPTRELAIQILSESQKFSLNTQMRSCVVYGGADTHSQIREVQ-IGCHLLVATPGRLVDFIEKNKISLEMCKYIVLDEADRMLDM-GFEPQIRKIIEESNMPSGINR--QTLMFSATFPKEIQKLAADFLYNYIFMTVGRVGSTSDSIKQEIIYMTDVEKLN----YLKNIFNTTAPNTLILIFVETKKGADSLARFLLSKGYPVSSIHGDRNQGEREHALNMFRNGQCPILVATAVAARGLDIPNVKHVINYDLPSDIEEYVHRIGRTGRLGNHGRATSFYVD-KNNNIAIDLVDLLKEANQIVPQWLSALADELKRNSVIGSNNKRHNQRRFKNGNFGGRDYRQGTTSVNMNSNVNQDYFISGS------VAPRHAKLNNGNYFSRSNE 643          
BLAST of VASA-1 vs. Planmine SMEST
Match: SMESG000019837.1 (SMESG000019837.1)

HSP 1 Score: 374.4 bits (960), Expect = 1.436e-116
Identity = 226/542 (41.70%), Postives = 313/542 (57.75%), Query Frame = 3
Query: 1155 NNFESKKFRGNNDANNGFRND---EFDGNFQGKRNGNSNDFSTEF-------------DRTVTLEENPAYSSKTFVRGQKQPEQTNQNDD-------AIPIVKRATFIPDDNQEDYELHV--NSGINFDNYDKIPVEVTG----DDVPPALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENGTESPASAVAF----PKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEK-TLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWLR 2678
            NN E++ F  N ++   +RN       GN +G+   +S D S  +             +R ++ E N +Y ++    G  +  + + +D+       +I  +      P + + + EL V  NSGINFD YD IPV  TG     D    + +FS L L   +  N+   +Y++ TPVQ+YA+PII  +RDLMACAQTGSGKTAAFLIP++  +  +G  +  S   +    P ALI+APTREL  QI+  AR     S ++   +YGG ++     ++ + GC++LVATPGRL   LE   + L  +++ VLDEADRMLD  GF   + KI  + N        Q  MFSATFP EIQ LA + L++YLFL VG VGS + ++ Q I+  D+ EK +  ++ +  I  E   L+FVE+KR AD +   L   GF+  +IHGDR Q  RE+AL  F+ GR   +VAT VAARGLDIP V  VIN D+P  I+ YVHRIGRTGR GN+G AISF+ + K+  +A+ LV  L EANQ  PDWLR
Sbjct:   58 NNCETRSFGDNRNSQGNWRNGPKATTRGNTRGRGGQHSFDRSNSYQESEWGRNQKDKVNRAISSEINKSYGTQRSFEGPSRSTRFDSDDNFHKSNFSSIAEISWDIQQPANPKLEKELFVGHNSGINFDQYDNIPVNTTGPQWQHDKYTGVTSFSELKLHPIIAHNIGLTQYSRPTPVQRYAVPIIVQRRDLMACAQTGSGKTAAFLIPLLNMMYNDGPGNSLSRTGYKKEYPVALILAPTRELALQIYEEARKFSYRSLVRPCVVYGGADIRNQLHDL-SQGCNMLVATPGRLSDMLERCRIGLDCIRYLVLDEADRMLDM-GFEPQIRKIVEQTNMPPPGNR-QTLMFSATFPKEIQMLASDFLQDYLFLRVGKVGSTSQNITQRIVYVDENEKRDHLLDILADIDSESLILVFVETKRGADALEGFLHGEGFRVASIHGDRSQSDRELALQCFRDGRTPILVATAVAARGLDIPNVKFVINYDLPTDIEEYVHRIGRTGRVGNLGEAISFYTD-KNNNVARELVDILLEANQTVPDWLR 595          
BLAST of VASA-1 vs. Planmine SMEST
Match: SMESG000064743.1 (SMESG000064743.1)

HSP 1 Score: 355.14 bits (910), Expect = 2.703e-111
Identity = 192/423 (45.39%), Postives = 275/423 (65.01%), Query Frame = 3
Query: 1440 HVNSGINFDNYDKIPVEVTGDDVP----PALNTFSSLHLPEFLTSNVENLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG---TESPAS-AVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEMNKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDSDGFYESVTKIYNEAN--FSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFLAVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTI-PDEKTLIFVESKRMADFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARGLDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLAQGLVSKLQEANQECPDWL 2675
            H   G+NFD+YD IP+  TG D        +  F  L + + +  N+  L Y K TPVQK+AIPII  +RDLMACAQTGSGKTAAFLIPI+  +   G   ++ P +    +P ALI+APTREL  QI+   R     S ++   +YGG +++K   N+ + GC++LVATPGRLI  L+   + L+++++ VLDEADRMLD  GF   + +I  +++  + GD +++   MFSATFP EIQ LA + L  Y+FLAVG+VGS++ ++ Q I   ++  K N  ++ +  + P++  LIFVE+K+ A  +   L    F  T+IHGDR+Q +RE AL  FK+G +  +VAT VAARGLDIP V  VIN D+P  I+ YVHRIGRTGR G++G ++SFF++  ++ + +GL++ L+EA QE P WL
Sbjct:   81 HQEPGVNFDDYDDIPILTTGPDFDHDNYQGIFGFEGLKMTKIMRDNISLLNYHKPTPVQKFAIPIILQRRDLMACAQTGSGKTAAFLIPILNMIYVEGPGDSQIPGNYEKQYPVALILAPTRELACQIYEEIRKFSYRSQVRSCVVYGGADISKQINNL-SRGCNLLVATPGRLIDMLKRDKIGLQFIRYLVLDEADRMLDM-GFEPQLRQIVEDSDMPYVGDRQTL---MFSATFPKEIQHLAADFLNYYIFLAVGIVGSSSHNITQHIFYIEEFRKRNHLLQILNKLEPEDLVLIFVETKKGARQLENFLMQRDFPVTSIHGDRKQVERETALKCFKNGSLPILVATAVAARGLDIPNVKLVINFDLPSDIEEYVHRIGRTGRVGHLGESVSFFND-NNVNVVKGLINVLEEAQQEVPVWL 497          
The following BLAST results are available for this feature:
BLAST of VASA-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX43.191e-13349.68DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
DDX41.337e-13149.68DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
DDX41.337e-13149.68DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
DDX42.385e-13149.68DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
DDX43.977e-13149.68DEAD-box helicase 4 [Source:HGNC Symbol;Acc:HGNC:1... [more]
back to top
BLAST of VASA-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
laf-14.768e-11545.86ATP-dependent RNA helicase laf-1 [Source:UniProtK... [more]
laf-11.555e-11445.86ATP-dependent RNA helicase laf-1 [Source:UniProtK... [more]
vbh-11.698e-10745.18Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
vbh-11.698e-10745.18Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
vbh-11.698e-10745.18Vasa-and Belle-like Helicase [Source:UniProtKB/Tr... [more]
back to top
BLAST of VASA-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vas1.057e-11746.29gene:FBgn0283442 transcript:FBtr0445187[more]
vas1.057e-11746.29gene:FBgn0283442 transcript:FBtr0445185[more]
vas1.057e-11746.29gene:FBgn0283442 transcript:FBtr0445186[more]
bel1.119e-10745.60gene:FBgn0263231 transcript:FBtr0081888[more]
bel1.277e-10745.60gene:FBgn0263231 transcript:FBtr0334319[more]
back to top
BLAST of VASA-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx46.660e-12349.04DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
ddx41.342e-12249.04DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
ddx41.858e-12249.04DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
ddx41.910e-12249.04DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
ddx43.443e-12249.04DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:Z... [more]
back to top
BLAST of VASA-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
polg26.427e-12942.25polymerase (DNA directed), gamma 2, accessory subu... [more]
polg21.883e-12746.01polymerase (DNA directed), gamma 2, accessory subu... [more]
polg22.617e-12746.01polymerase (DNA directed), gamma 2, accessory subu... [more]
polg22.802e-12746.01polymerase (DNA directed), gamma 2, accessory subu... [more]
polg29.957e-12746.01polymerase (DNA directed), gamma 2, accessory subu... [more]
back to top
BLAST of VASA-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx42.140e-13048.30DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
Ddx43.996e-13048.30DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 [Source:M... [more]
Ddx3x6.344e-11745.77DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 3, X-... [more]
D1Pas14.124e-11645.41DNA segment, Chr 1, Pasteur Institute 1 [Source:MG... [more]
Ddx3y6.871e-11545.31DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked... [more]
back to top
BLAST of VASA-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5W5U4|DDX4_BOVIN2.609e-13149.79Probable ATP-dependent RNA helicase DDX4 OS=Bos ta... [more]
sp|Q9NQI0|DDX4_HUMAN1.910e-13049.68Probable ATP-dependent RNA helicase DDX4 OS=Homo s... [more]
sp|Q4R5S7|DDX4_MACFA2.503e-13049.46Probable ATP-dependent RNA helicase DDX4 OS=Macaca... [more]
sp|Q3MSQ8|DDX4_PELLE3.711e-13049.13Probable ATP-dependent RNA helicase DDX4 OS=Peloph... [more]
sp|Q6GWX0|DDX4_PIG1.256e-12949.68Probable ATP-dependent RNA helicase DDX4 OS=Sus sc... [more]
back to top
BLAST of VASA-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXT73.158e-101100.00VASA 1 protein OS=Schmidtea mediterranea OX=79327 ... [more]
D5JG810.000e+073.86Vasa PlVAS1-like protein (Fragment) OS=Dugesia jap... [more]
Q9GV070.000e+070.73Vasa-related protein PlVAS1 (Fragment) OS=Girardia... [more]
A0A172RVY90.000e+057.27VASA 2 protein (Fragment) OS=Schmidtea mediterrane... [more]
H9CXT80.000e+057.27VASA-2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=... [more]
back to top
BLAST of VASA-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx41.008e-12750.84DEAD-box helicase 4 [Source:NCBI gene;Acc:10304119... [more]
ddx41.011e-12750.84DEAD-box helicase 4 [Source:NCBI gene;Acc:10304119... [more]
ddx3xb1.348e-11746.48DEAD-box helicase 3 X-linked b [Source:ZFIN;Acc:ZD... [more]
ddx3xa3.068e-11344.03DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa6.475e-11344.03DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
back to top
BLAST of VASA-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000003898.19.539e-12045.96pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
ddx422.572e-6634.30DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
ddx233.352e-6635.97DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ddx462.695e-5835.56DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
ddx271.053e-5535.19DEAD (Asp-Glu-Ala-Asp) box polypeptide 27 [Source:... [more]
back to top
BLAST of VASA-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DED11.521e-11847.21ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
DBP14.287e-11842.75Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
DBP29.671e-7938.69ATP-dependent RNA helicase of the DEAD-box protein... [more]
DBP33.359e-7137.98RNA-Dependent ATPase, member of DExD/H-box family;... [more]
PRP284.908e-6537.00RNA binding protein; involved in RNA isomerization... [more]
back to top
BLAST of VASA-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
PL101.743e-11346.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
VAS17.769e-9648.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO277083.031e-9540.46Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
VAS26.146e-7647.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380611.536e-7237.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of VASA-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx41.895e-12646.79DEAD-box helicase 4 [Source:NCBI gene;Acc:10004922... [more]
ddx46.943e-12546.79DEAD-box helicase 4 [Source:NCBI gene;Acc:10004922... [more]
ddx3xa4.028e-11445.77DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa6.308e-11440.47DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
ddx3xa1.597e-11345.12DEAD-box helicase 3 X-linked [Source:NCBI gene;Acc... [more]
back to top
BLAST of VASA-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067941.16.704e-104100.00SMESG000067941.1[more]
SMESG000049071.10.000e+057.27SMESG000049071.1[more]
SMESG000013025.19.792e-11745.62SMESG000013025.1[more]
SMESG000019837.11.436e-11641.70SMESG000019837.1[more]
SMESG000064743.12.703e-11145.39SMESG000064743.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30031463
GenBankAFD29608.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031463 ID=SMED30031463|Name=VASA-1|organism=Schmidtea mediterranea sexual|type=transcript|length=2964bp
GTAGACATCAAACAAATACAAATTCATTTGTTTAAATCTATCTACAACCT
TTGTCATTATAAAAAAAAATCATGTCGGTTAATGATGGATTAAGTGATGA
AGAATGGGGAGCATGGGGACAAACTTCTGTAGTCACAGAAAACATAAGTA
CTCAAAAAAATAATTCAAAACCTCAAAATGGCTTTGGCAGTGATGATGAA
GTAATTATCAATACTGACACCTCAAATGTTCAAGCAATCTCAAAGTTTAG
TGTAAATAGTTATAACAAAGAAAATAATTTAAATGGCGGATCTTATGAAA
AAAGAGGAGGTTTTAATGGAAATAGGGGAACTAACAGATTTGCTACCAGA
AAAGTAGAATCAGAGGACAAGAATGAAACTAATGGTGATAGAAATTATAA
CAGGAATGGTTACTCTAATGATAGAGATACTAAACCGAACTATCAGAATA
ACAGAAACTCAGAATTTAAAAGGAACGGAAATGAACAAAATAATTATCCA
AATGATAGAAATTTTAATAAACGAGATAATAGTCCCGGTGATAAAAATCA
GTATGCGAATAAAAGGAATGATTCTAGAGAACGCTCGCGTAATAATGGAT
TGTTTGATGATTCAAGAGAACGTAAAACTCCTCGTGGTGACAAACGTGAT
GATTCAAGAGATCGTAAAATAAACCGAGACGATTCGAGGGATCGTAGAAA
GTATCGTGATGATTCCAGAGATCGTAGAAAGTATCGTGACGATTCCAGAG
ATCGTAAAAAATATCGAGACGATTCAAGGGATCGCAAGAAGTATCGTGAT
GATTCAAACGATCGTAAAAAGTATCGTGATAGCTCGATGGATCGTAGAAA
ACCTCGTGATGATTCCAGGGATCATAAAAAGTATCGTGACGATTCTAGAG
ATAAACGAAACAATTTAAAGCGCCGTGATGATTCCTATGATAATAATGAT
AGAAATCGAAGACCAGATAGAAGAAATCGAGATGATTCTCGCGAAAATCG
AAAGAAAAGGGACGATTCGCAAGAAAATCGAACACGAAATAGAAAAGAGG
AATTTAAACGTGATGAATCCTGGGAAGACCGTAGATCCGAATTCCAACGA
GATCAGAGAATAAATAATGATAGTTTTGCTAGAGCAACGAAAGAAAATGG
AGCTAACAATTTTGAATCGAAAAAGTTCCGTGGAAATAACGATGCAAATA
ATGGATTTAGAAACGACGAATTTGATGGCAATTTCCAAGGAAAACGTAAT
GGAAATTCCAACGATTTTTCCACTGAATTCGATAGAACTGTGACTTTGGA
AGAAAATCCTGCCTATTCATCGAAAACATTTGTTCGTGGTCAAAAGCAGC
CGGAACAAACCAATCAAAATGATGATGCTATTCCAATCGTTAAAAGAGCG
ACATTTATCCCCGATGATAATCAAGAAGATTACGAACTCCATGTAAATTC
AGGAATTAATTTCGATAATTACGACAAAATCCCGGTTGAGGTTACAGGCG
ATGATGTTCCGCCGGCCTTGAACACGTTTTCCAGTCTTCATCTCCCGGAA
TTTCTCACATCGAATGTTGAAAATCTCAAATATACAAAATTGACCCCAGT
GCAAAAATATGCAATTCCGATTATCGATTCCAAACGCGACCTCATGGCAT
GCGCACAAACCGGTTCTGGCAAAACTGCGGCTTTTCTAATCCCGATAATC
AAATCTCTCAGTGAGAATGGGACGGAATCTCCAGCATCGGCAGTCGCGTT
TCCGAAAGCTTTAATAATGGCTCCAACTAGGGAGTTGTGTCGTCAGATAT
TCACTGCTGCGCGTCATCTCTGTCGCGGTTCCAATATCAAATGTGCCTAT
ATTTACGGTGGAATTGAAATGAACAAATCCCGACGTAATATACAAGCAAC
CGGTTGCGATATCCTCGTGGCGACTCCAGGCCGATTGATTCATTTCCTGG
AATTAGTTTGGCTCTCTTTGAGATATTTGCAGTTTTTTGTGCTCGATGAG
GCCGATCGAATGCTCGATTCCGATGGATTTTATGAAAGCGTTACGAAAAT
CTACAACGAGGCCAATTTTAGTGGAGACGATCGATCGATCCAAATTTCGA
TGTTTAGTGCAACTTTCCCCAATGAAATTCAAACTTTAGCGAGAAATCTC
CTGAAAAATTATCTATTTCTAGCTGTTGGAGTTGTTGGCTCAGCAAATAG
TGACGTAAAGCAGGAGATTATCCAATCGGATCAAAGGGAGAAAGTCAATA
CTGCAATTGAATATATAAAAACTATTCCCGATGAGAAAACTCTGATTTTC
GTTGAGAGCAAAAGAATGGCCGATTTCATGGGAATAAAGCTCGGATATTT
GGGATTTAAAGCGACGACAATTCACGGTGATCGGGAACAGGAACAGAGAG
AAATCGCTCTTAATGATTTCAAAAGTGGCCGAGTTAATTTCATGGTTGCC
ACTAATGTTGCCGCTCGAGGTCTCGATATTCCGAAAGTCGATAATGTAAT
CAATATCGACATGCCTGACACAATCGATACGTATGTTCATCGAATCGGTA
GAACCGGTCGTTGTGGAAATGTTGGACGTGCAATTAGCTTTTTCGATGAA
ATGAAGGATATTGGATTGGCACAAGGGCTTGTTAGTAAGCTGCAAGAAGC
CAATCAGGAGTGTCCTGATTGGTTGAGAGCACTATGTGACGGATCCGGTT
CCAGGATGGCCAATTACTCGAGAGACACTAGAAAAAATGTTAAAAGCTCT
AAATATATTGACAACCCTACCGATGACGGATTTATGAAGGGTACAAATAT
TGATTATGATGACGTGAAGCCGACTTCTGAATGGCTCGAAGATTAGAATA
TTTTTATAAGAGCTAATAAAGAAAATTTGTATTCTATGTTATTTGTGACG
ATCTTCTATGTTCCATTTTTGTAAATAATTGCATTTAATAAACATTTTTT
GTTTTAAAAAAAAA
back to top

protein sequence of SMED30031463-orf-1

>SMED30031463-orf-1 ID=SMED30031463-orf-1|Name=SMED30031463-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=925bp
MSVNDGLSDEEWGAWGQTSVVTENISTQKNNSKPQNGFGSDDEVIINTDT
SNVQAISKFSVNSYNKENNLNGGSYEKRGGFNGNRGTNRFATRKVESEDK
NETNGDRNYNRNGYSNDRDTKPNYQNNRNSEFKRNGNEQNNYPNDRNFNK
RDNSPGDKNQYANKRNDSRERSRNNGLFDDSRERKTPRGDKRDDSRDRKI
NRDDSRDRRKYRDDSRDRRKYRDDSRDRKKYRDDSRDRKKYRDDSNDRKK
YRDSSMDRRKPRDDSRDHKKYRDDSRDKRNNLKRRDDSYDNNDRNRRPDR
RNRDDSRENRKKRDDSQENRTRNRKEEFKRDESWEDRRSEFQRDQRINND
SFARATKENGANNFESKKFRGNNDANNGFRNDEFDGNFQGKRNGNSNDFS
TEFDRTVTLEENPAYSSKTFVRGQKQPEQTNQNDDAIPIVKRATFIPDDN
QEDYELHVNSGINFDNYDKIPVEVTGDDVPPALNTFSSLHLPEFLTSNVE
NLKYTKLTPVQKYAIPIIDSKRDLMACAQTGSGKTAAFLIPIIKSLSENG
TESPASAVAFPKALIMAPTRELCRQIFTAARHLCRGSNIKCAYIYGGIEM
NKSRRNIQATGCDILVATPGRLIHFLELVWLSLRYLQFFVLDEADRMLDS
DGFYESVTKIYNEANFSGDDRSIQISMFSATFPNEIQTLARNLLKNYLFL
AVGVVGSANSDVKQEIIQSDQREKVNTAIEYIKTIPDEKTLIFVESKRMA
DFMGIKLGYLGFKATTIHGDREQEQREIALNDFKSGRVNFMVATNVAARG
LDIPKVDNVINIDMPDTIDTYVHRIGRTGRCGNVGRAISFFDEMKDIGLA
QGLVSKLQEANQECPDWLRALCDGSGSRMANYSRDTRKNVKSSKYIDNPT
DDGFMKGTNIDYDDVKPTSEWLED*
back to top
Aliases
The feature 'VASA-1' has the following synonyms
Synonym
VASA-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003724RNA helicase activity
GO:0005524ATP binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0003743translation initiation factor activity
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000208testis
PLANA:0000228male germ cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0006413translational initiation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 751..832
e-value: 7.9E-33
score: 125.1
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 724..832
e-value: 1.6E-29
score: 102.4
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 724..872
score: 22.893
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 503..715
e-value: 4.7E-53
score: 192.2
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 515..700
score: 27.994
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 441..702
e-value: 1.4E-74
score: 252.5
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 703..874
e-value: 1.9E-51
score: 175.8
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 107..161
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 162..351
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 91..106
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..45
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 352..398
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 15..45
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 61..398
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 388..869
NoneNo IPR availablePANTHERPTHR24031:SF704ATP-DEPENDENT RNA HELICASE DDX4coord: 388..869
NoneNo IPR availableCDDcd18052DEADc_DDX4coord: 447..706
e-value: 3.54876E-104
score: 322.302
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 712..841
e-value: 4.05504E-54
score: 181.937
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 508..688
e-value: 4.8E-43
score: 146.9
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 640..648
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 484..512
score: 10.233
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 562..843