Phosphatidylinositol 4-phosphate 5-kinase 2

Overview
NamePhosphatidylinositol 4-phosphate 5-kinase 2
Smed IDSMED30031461
Uniprot Best hitMORN repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=MORN1 PE=2 SV=2 (E=1.90561e-69)
Length (bp)1608
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatidylinositol 4-phosphate 5-kinase 2 (SMED30031461) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatidylinositol 4-phosphate 5-kinase 2 (SMED30031461) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatidylinositol 4-phosphate 5-kinase 2 (SMED30031461) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatidylinositol 4-phosphate 5-kinase 2 (SMED30031461) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031461

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031461SMESG000012434.1 dd_Smed_v4_9195_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30031461SMESG000012434.1 dd_Smed_v4_9195_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031461SMESG000012434.1 dd_Smed_v4_9195_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30031461SMESG000012434.1 dd_Smed_v4_9195_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30031461SMESG000012434.1 dd_Smed_v4_9195_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031461SMESG000012434.1 dd_Smed_v4_9195_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30031461SMESG000012434.1 dd_Smed_v4_9195_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Human
Match: MORN1 (MORN repeat containing 1 [Source:HGNC Symbol;Acc:HGNC:25852])

HSP 1 Score: 234.572 bits (597), Expect = 3.968e-70
Identity = 141/444 (31.76%), Postives = 225/444 (50.68%), Query Frame = 1
Query:  130 GFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMK-LTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVNDNNSL-FELIEQIDSKPVETTYYPVLLVPLTDKPPQW----VQSLENASHNKIRLPHL-FESDESNSQPPESTETDLTD---APLCNDLCLDPVIQETKNGSVDFINLFIQQPKLAAGSCLQSDSASEFINSASV-------SATSIKQNKDQSLSEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQI 1410
            G+GVYVY N FF+YEGEW+ G+KHGHG+ +  DGS+YEG F +GEI G+G R+W  +G+ + G+F  GE  G G+M Y  G  Y G+     REG+G L   +G VY+G F+ +K HG G M   NG  Y G W+   + GHG +   DGS Y+GQ++ ++F G G++ H  G+ Y GLW    P +  T++  L  ++++  QG  F +++ L+ D+GEI   ESGR L+++AGV+Y  ++  + + F  +++ + + +  T +    +P     P       ++ +  +   + LP    E         E T   L     AP C   C     Q  + G  +F ++ +  P       L  DS  +     S        +  + ++    S  E     ++        LGEYVL+I D+T  PF+  RL   +  +++
Sbjct:   26 GYGVYVYPNSFFRYEGEWKAGRKHGHGKLLFKDGSYYEGAFVDGEITGEGRRHWAWSGDTFSGQFVLGEPQGYGVMEYKAGGCYEGEVSHGMREGHGFLVDRDGQVYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQGHGVLRCADGSTYKGQWHSDVFSGLGSMAHCSGVTYYGLWINGHPAEQATRIVILGPEVMEVAQGSPFSVNVQLLQDHGEIAKSESGRVLQISAGVRYVQLSAYSEVNFFKVDRDNQETLIQTPFGFECIPYPVSSPAAGVPGPRAAKGGAEADVPLPRGDLELHLGALHGQEDTPGGLLARGHAPHCPGAC-----QRVEQGCAEFTDVLLGPPPPGYHPFLFLDSLHKKAGGRSRGGLHPRGTPPTAQEPPGGSRPEGRATEEQA---AAAHLGEYVLMIRDVTTPPFLGRRLPPAFKHLRV 461          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Human
Match: MORN1 (MORN repeat containing 1 [Source:HGNC Symbol;Acc:HGNC:25852])

HSP 1 Score: 213.386 bits (542), Expect = 9.236e-64
Identity = 104/238 (43.70%), Postives = 152/238 (63.87%), Query Frame = 1
Query:  130 GFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMK-LTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKY 840
            G+GVYVY N FF+YEGEW+ G+KHGHG+ +  DGS+YEG F +GEI G+G R+W  +G+ + G+F  GE  G G+M Y  G  Y G+     REG+G L   +G VY+G F+ +K HG G M   NG  Y G W+   + GHG +   DGS Y+GQ++ ++F G G++ H  G+ Y GLW    P +  T++  L  ++++  QG  F +++ L+ D+GEI   ESGR L+++AGV+Y
Sbjct:   26 GYGVYVYPNSFFRYEGEWKAGRKHGHGKLLFKDGSYYEGAFVDGEITGEGRRHWAWSGDTFSGQFVLGEPQGYGVMEYKAGGCYEGEVSHGMREGHGFLVDRDGQVYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQGHGVLRCADGSTYKGQWHSDVFSGLGSMAHCSGVTYYGLWINGHPAEQATRIVILGPEVMEVAQGSPFSVNVQLLQDHGEIAKSESGRVLQISAGVRY 263          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Human
Match: MORN1 (MORN repeat containing 1 [Source:HGNC Symbol;Acc:HGNC:25852])

HSP 1 Score: 105.145 bits (261), Expect = 6.538e-26
Identity = 56/130 (43.08%), Postives = 77/130 (59.23%), Query Frame = 1
Query:  202 GHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYE 591
            GHG+ +  DGS+YEG F +GEI G+G R+W  +G+ + G+F  GE  G G+M Y  G  Y G+     REG+G L   +G VY+G F+ +K HG G M   NG  Y G W+   + GHG +   DGS Y+
Sbjct:   26 GHGKLLFKDGSYYEGAFVDGEITGEGRRHWAWSGDTFSGQFVLGEPQGYGVMEYKAGGCYEGEVSHGMREGHGFLVDRDGQVYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQGHGVLRCADGSTYK 155          

HSP 2 Score: 57.3806 bits (137), Expect = 3.107e-9
Identity = 35/95 (36.84%), Postives = 53/95 (55.79%), Query Frame = 1
Query:  169 YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYE 453
            + G++  G+  G+G      G  YEGE  +G   G G     + G VY+G FH+ +  G G M + NGD+Y GDW+ + R+G+G L  A+G  Y+
Sbjct:   62 FSGQFVLGEPQGYGVMEYKAGGCYEGEVSHGMREGHGFLV-DRDGQVYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQGHGVLRCADGSTYK 155          

HSP 3 Score: 57.3806 bits (137), Expect = 3.837e-9
Identity = 40/139 (28.78%), Postives = 64/139 (46.04%), Query Frame = 1
Query:  343 GTGIMFYGNGDEYHGDWISNSREGNGQLTYA-NGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDILDCFQGHTFQI 756
            G G + + +G  Y G ++     G G+  +A +GD + G+F   +  G G+M    G  Y G    G + GHG +   DG VY+G F+ N  HG G +    G  Y G W ++         +    +L C  G T+++
Sbjct:   26 GHGKLLFKDGSYYEGAFVDGEITGEGRRHWAWSGDTFSGQFVLGEPQGYGVMEYKAGGCYEGEVSHGMREGHGFLVDRDGQVYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRD--------RRQGHGVLRCADGSTYKL 156          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Human
Match: AC084018.3 (MORN repeat-containing protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q6PF18])

HSP 1 Score: 99.7525 bits (247), Expect = 4.528e-23
Identity = 61/175 (34.86%), Postives = 96/175 (54.86%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPD-GSVYEGQFNYNL 612
            ++Y+GE    ++ G G  V++ K   YEG+W+ GK+ G+G   + D           +  GK  R       VY G +   + +G GI F+G  + Y GDW  + R G G++ Y+NGD+YEG++   K +GEG++RL NG+ Y G W  G K+G G+    D G ++EG +  N+
Sbjct:   36 DYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPD-----------QQTGKCRR-------VYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNM 192          

HSP 2 Score: 55.0694 bits (131), Expect = 8.518e-8
Identity = 40/138 (28.99%), Postives = 64/138 (46.38%), Query Frame = 1
Query:  295 KTGNVYRGEFHNGEMTGTGIMFYG-NGDEYHGDWISNSREGNG-QLTYANGDVYEGEFYKHKIHGEGIMRLMN------GSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLP 684
            K+ ++++G     +  G     Y  NGD Y G+W  N + G G Q+    G +YEG++   K  G G + L +        +YSG+W    K G+G         YEG +  +   G G +++  G +Y G WE + P
Sbjct:    9 KSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKP 146          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Human
Match: AC084018.3 (MORN repeat-containing protein 3 [Source:UniProtKB/Swiss-Prot;Acc:Q6PF18])

HSP 1 Score: 99.7525 bits (247), Expect = 4.528e-23
Identity = 61/175 (34.86%), Postives = 96/175 (54.86%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPD-GSVYEGQFNYNL 612
            ++Y+GE    ++ G G  V++ K   YEG+W+ GK+ G+G   + D           +  GK  R       VY G +   + +G GI F+G  + Y GDW  + R G G++ Y+NGD+YEG++   K +GEG++RL NG+ Y G W  G K+G G+    D G ++EG +  N+
Sbjct:   36 DYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPD-----------QQTGKCRR-------VYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKPNGEGMLRLKNGNRYEGCWERGMKNGAGRFFHLDHGQLFEGFWVDNM 192          

HSP 2 Score: 55.0694 bits (131), Expect = 8.518e-8
Identity = 40/138 (28.99%), Postives = 64/138 (46.38%), Query Frame = 1
Query:  295 KTGNVYRGEFHNGEMTGTGIMFYG-NGDEYHGDWISNSREGNG-QLTYANGDVYEGEFYKHKIHGEGIMRLMN------GSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLP 684
            K+ ++++G     +  G     Y  NGD Y G+W  N + G G Q+    G +YEG++   K  G G + L +        +YSG+W    K G+G         YEG +  +   G G +++  G +Y G WE + P
Sbjct:    9 KSESLWKGWDRKAQRNGLRSQVYAVNGDYYVGEWKDNVKHGKGTQVWKKKGAIYEGDWKFGKRDGYGTLSLPDQQTGKCRRVYSGWWKGDKKSGYGIQFFGPKEYYEGDWCGSQRSGWGRMYYSNGDIYEGQWENDKP 146          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Celegans
Match: jph-1 (JunctoPHilin [Source:UniProtKB/TrEMBL;Acc:Q22667])

HSP 1 Score: 50.8322 bits (120), Expect = 2.187e-6
Identity = 41/141 (29.08%), Postives = 64/141 (45.39%), Query Frame = 1
Query:  208 GRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNG-SIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEG 627
            GRF   DG  Y G ++ G+  G G    P+    Y G +H G    +G+  + +G+ Y G W +  R G G +      +Y+GE+ +      G+ +  N  + Y G W  G   G+G     D   Y+GQ+   + HG G
Sbjct:    4 GRFDFDDGGTYVGGWEEGKAHGHGVCTGPQAKGEYAGAWHYG-FEVSGVYTWPSGNTYQGQWQNGKRHGLG-IEQRGRWLYKGEWTQGYKGRYGVRQSANSQARYQGTWSAGFHDGYGTEIYVDSGSYQGQWLRGMRHGYG 142          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Fly
Match: CG30429 (gene:FBgn0050429 transcript:FBtr0072450)

HSP 1 Score: 73.9442 bits (180), Expect = 3.291e-14
Identity = 45/134 (33.58%), Postives = 71/134 (52.99%), Query Frame = 1
Query:  292 PKTGNVYRGEFHNGEMTGTGIMFYGNGDE----YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHI-CGILYTGLWEQN 678
            P+   +Y G++   +  G G M    G E    Y G W  + + G G+  Y++G VY G++ K++ HG GI    +G+IY+G W    +HG G M   +G+ YEG F     +GEG  +H+  G +  G+WE +
Sbjct:   63 PEGQLIYEGDWVMNKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYNDGNIYAGEWETDFRHGLGVMFYANGNRYEGHFARGYKNGEGVFYHMHTGQIQKGMWEND 196          

HSP 2 Score: 51.6026 bits (122), Expect = 7.353e-7
Identity = 41/129 (31.78%), Postives = 55/129 (42.64%), Query Frame = 1
Query:  349 GIMFYGNGDEYHGDWISNSREGNG---------QLTYANGD-----VYEGEFYKHKIHGEGIMRLMNGS----IYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNL 681
               +Y  G  Y G W+ N  +G G         Q  Y         +YEG++  +K  G G M    G+    IYSG W    K G GK    DG VY G++  N  HG G  ++  G +Y G WE + 
Sbjct:   22 ATFYYPGGGSYSGYWLCNKHQGWGVKKTAKRTCQYFYGKKHPEGQLIYEGDWVMNKRQGVGSMLRKRGTEVQLIYSGRWYDDMKCGEGKQFYSDGCVYFGKWIKNRRHGLGIQWYNDGNIYAGEWETDF 150          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Fly
Match: CG5458 (gene:FBgn0032478 transcript:FBtr0080437)

HSP 1 Score: 73.9442 bits (180), Expect = 5.874e-14
Identity = 46/140 (32.86%), Postives = 69/140 (49.29%), Query Frame = 1
Query:   94 FYIGETNKM-LREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNG 510
             YIG  N    R+G G  +  N   +Y+G ++KG++HG G +V  DGS Y G+++ G+ CG+                        GI  Y +G  Y G+W  N + G G+  Y NGD Y G+++K + HG GI    +G
Sbjct:   26 LYIGGRNAAGQRQGRGWAILPNGD-QYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGR------------------------GIFIYPDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQRHGVGIYHFNSG 140          

HSP 2 Score: 73.559 bits (179), Expect = 7.376e-14
Identity = 37/91 (40.66%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  397 SNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLW 669
            +  R+G G     NGD Y+G + K + HG G+    +GS Y G + CG + G G    PDGSVYEG +  NL HG+G   ++ G  Y+G W
Sbjct:   34 AGQRQGRGWAILPNGDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIYPDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDW 124          

HSP 3 Score: 67.0106 bits (162), Expect = 9.633e-12
Identity = 49/163 (30.06%), Postives = 73/163 (44.79%), Query Frame = 1
Query:  229 GSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGS-------VYEGQFNYNLFHGEGTLF----HICGILYTGLWEQNLP 684
            G +  G    G+  G+G    P  G+ Y G +  G   G G+  + +G  Y+G +    R G G   Y +G VYEG + K+  HG+G  + +NG  YSG W  G +HG G      G          +  +N N+  G   L+      C IL+ G+W+   P
Sbjct:   25 GLYIGGRNAAGQRQGRGWAILP-NGDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIYPDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQRHGVGIYHFNSGKDGCCLSVRMKATWNSNMRTGPFELYIGNEDKCTILH-GIWDNLYP 185          

HSP 4 Score: 57.3806 bits (137), Expect = 1.307e-8
Identity = 37/117 (31.62%), Postives = 52/117 (44.44%), Query Frame = 1
Query:  292 PKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHI 642
            P  G    G    G+  G G     NGD+Y G++    R G G   + +G  Y G++   K  G GI    +GS+Y G W    KHG G+    +G  Y G +     HG G ++H 
Sbjct:   22 PNIGLYIGGRNAAGQRQGRGWAILPNGDQYDGNYRKGRRHGIGVYVFKDGSRYYGQYRCGKRCGRGIFIYPDGSVYEGNWRKNLKHGKGRYKYVNGDNYSGDWFKGQRHGVG-IYHF 137          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Fly
Match: CG14490 (gene:FBgn0034281 transcript:FBtr0086801)

HSP 1 Score: 68.9366 bits (167), Expect = 3.738e-13
Identity = 47/143 (32.87%), Postives = 72/143 (50.35%), Query Frame = 1
Query:  130 GFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHG 558
            GFGV    +    YEG WQKG++HG             G  +  E+ G+ ER       +Y G++   + +G G  FY +G  Y G W+++ R G G L  A+G +Y GE+ + K+H +G++    G+ Y G +  G K G G
Sbjct:   33 GFGVKQTSSGLV-YEGHWQKGQRHG------------IGSLRRKELDGRMER-------IYVGQWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQFEGGCKSGSG 155          

HSP 2 Score: 66.2402 bits (160), Expect = 3.467e-12
Identity = 52/177 (29.38%), Postives = 78/177 (44.07%), Query Frame = 1
Query:  166 KYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICG--ILYTGLWEQNLPCK 690
            +Y+G+W   + HG G    + G  YEG +Q G+  G         G++ R E  +G M             Y G W  N R G G+  Y +G VY G++   +  GEGI+   +G IY G W+    H  G +    G+ Y GQF      G G  +H      +  G W +++ C+
Sbjct:   21 QYQGKWLGQQPHGFGVKQTSSGLVYEGHWQKGQRHG--------IGSLRRKEL-DGRMERI----------YVGQWRENKRSGEGKQFYPDGSVYFGQWLADQRSGEGILWQADGGIYVGEWLRDKMHEKGLLFTATGNRYVGQFEGGCKSGSGVFYHASNGQRIQHGFWSKDI-CR 177          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Fly
Match: Als2 (gene:FBgn0037116 transcript:FBtr0078462)

HSP 1 Score: 65.855 bits (159), Expect = 6.962e-11
Identity = 53/173 (30.64%), Postives = 73/173 (42.20%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVM-----ADGSFYEGEFQNGEICGKG----ERYWPKTGNVYRGEFHNGEMTGTGIMF-YGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDG 579
            + Y GE    + EGFG  V       Y G ++ G+ HGHG + M      +   YEG F  G   G G     RY      +Y GE+     +G G++    +GD+Y G +  N R G G      GD +EG F    + G G+    N   Y G       +G G+  MP G
Sbjct:  764 SVYCGELQHGIIEGFGKMVIPTTGL-YVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFCEGLFHGHGVMRNNRY------IYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGSCITNRGDYFEGSFSGDDLTGSGVAVFENDYYYEGELTLLGPNGRGEYYMPSG 929          

HSP 2 Score: 60.8474 bits (146), Expect = 2.430e-9
Identity = 53/153 (34.64%), Postives = 69/153 (45.10%), Query Frame = 1
Query:  175 GEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKM-TMPDGSVYEGQFNYNLFHGEGT 630
            G W+KG  HG+      DGS Y GE Q+G I G G+   P TG +Y G F  G   G G+       E H     +S E          +VYEG F +   HG G+MR  N  IY G +    + G+G +  +  G  Y G F  N   G G+
Sbjct:  745 GTWRKGVLHGNCYLEYPDGSVYCGELQHGIIEGFGKMVIPTTG-LYVGNFKGGRFHGHGVY------EMH---CKDSPE---------SEVYEGNFCEGLFHGHGVMR-NNRYIYVGEYQANARSGYGVIEDLVSGDKYMGMFADNKRSGIGS 877          

HSP 3 Score: 54.299 bits (129), Expect = 2.611e-7
Identity = 34/88 (38.64%), Postives = 40/88 (45.45%), Query Frame = 1
Query:  385 GDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTM-----PDGSVYEGQFNYNLFHGEGTL 633
            G W      GN  L Y +G VY GE     I G G M +    +Y G +  G  HGHG   M     P+  VYEG F   LFHG G +
Sbjct:  745 GTWRKGVLHGNCYLEYPDGSVYCGELQHGIIEGFGKMVIPTTGLYVGNFKGGRFHGHGVYEMHCKDSPESEVYEGNFCEGLFHGHGVM 832          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Fly
Match: jp (gene:FBgn0032129 transcript:FBtr0079861)

HSP 1 Score: 50.8322 bits (120), Expect = 3.237e-6
Identity = 46/143 (32.17%), Postives = 66/143 (46.15%), Query Frame = 1
Query:  208 GRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNG-EMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMR--LMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEG 627
            GRF   DG  Y G +  G+  G G    PK    Y G ++ G E++G+ I  + +G  Y G W +  R G G +      +Y GE+ K    G   +R   ++ + Y G W  G + G G  T  DG  Y+GQ+     HG G
Sbjct:   50 GRFDFEDGGTYCGGWDEGKAHGHGVCTGPKHQGAYAGAWNYGFEVSGSYI--WPSGSHYEGQWQNGRRHGLG-VEQIGRQIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYG 189          

HSP 2 Score: 50.447 bits (119), Expect = 4.151e-6
Identity = 41/138 (29.71%), Postives = 62/138 (44.93%), Query Frame = 1
Query:  169 YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICG---KGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGN--GQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMT 567
            Y G W +GK HGHG   +  G  ++G +      G    G   WP +G+ Y G++ NG   G G+   G    Y G+W  +  +G    + +  +   YEG + +    G G     +G  Y G W  G +HG+G  T
Sbjct:   60 YCGGWDEGKAHGHG---VCTGPKHQGAYAGAWNYGFEVSGSYIWP-SGSHYEGQWQNGRRHGLGVEQIGR-QIYRGEWSKDGHKGRYGVRESTVSTAKYEGTWNEGYQDGSGCETYADGGKYQGQWQEGKRHGYGIRT 192          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Zebrafish
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:767792])

HSP 1 Score: 115.546 bits (288), Expect = 1.187e-26
Identity = 73/207 (35.27%), Postives = 107/207 (51.69%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE--YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMN-GSIYSGYWICGNKHGHGKMT----------MPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWE 672
            + Y G  +  L  G+G Y++ +   KY+G+++     GHG +   +GS YEGE   G   G G     KT  VYRG+++ G+  G G MFY       Y G+W++N +EG G+  Y +G+VYEG++  +  HGEG MR ++    YSG WI G + G G  T           P  + Y G F   + HG+G   +  G LY G W+
Sbjct:  107 HVYKGSFSHGLMHGYGEYIWSDGL-KYQGDFKVNVPMGHGTYTWLNGSTYEGEVHQGIRHGVGMYKCVKTLTVYRGQWYLGKRQGQGEMFYNQEATSWYKGEWVNNCKEGWGKRCYPSGNVYEGQWRNNVRHGEGTMRWIDLDQQYSGQWINGTQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLYASGALYCGQWK 312          

HSP 2 Score: 98.5969 bits (244), Expect = 3.339e-21
Identity = 62/182 (34.07%), Postives = 93/182 (51.10%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFV--MADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE-YHGDWISNSREGNGQLT----------YANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFN 603
            Y GE ++ +R G G+Y        Y G+W  GK+ G G         S+Y+GE+ N    G G+R +P +GNVY G++ N    G G M + + D+ Y G WI+ ++EG G  T          Y   + Y G+F +   HG+G     +G++Y G W    KHG G+    +G VYEG+F+
Sbjct:  155 YEGEVHQGIRHGVGMYKCVKTLTVYRGQWYLGKRQGQGEMFYNQEATSWYKGEWVNNCKEGWGKRCYP-SGNVYEGQWRNNVRHGEGTMRWIDLDQQYSGQWINGTQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLYASGALYCGQWKYDKKHGQGRYIFENGRVYEGEFS 335          

HSP 3 Score: 66.6254 bits (161), Expect = 4.765e-11
Identity = 47/142 (33.10%), Postives = 68/142 (47.89%), Query Frame = 1
Query:   79 KDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHG--RFVMADGSFYEGEFQNGEICGKGERYW----------PKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYK 468
            ++  ++Y GE     +EG+G   Y +    YEG+W+   +HG G  R++  D   Y G++ NG   GKG   W          P+  N Y G+F      G G   Y +G  Y G W  + + G G+  + NG VYEGEF K
Sbjct:  198 QEATSWYKGEWVNNCKEGWGKRCYPSGNV-YEGQWRNNVRHGEGTMRWIDLDQQ-YSGQWINGTQEGKGTHTWFRKRAPSSQYPRM-NEYTGDFVQAMRHGQGQFLYASGALYCGQWKYDKKHGQGRYIFENGRVYEGEFSK 336          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Zebrafish
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:767792])

HSP 1 Score: 115.546 bits (288), Expect = 1.311e-26
Identity = 73/207 (35.27%), Postives = 107/207 (51.69%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGN--GDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMN-GSIYSGYWICGNKHGHGKMT----------MPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWE 672
            + Y G  +  L  G+G Y++ +   KY+G+++     GHG +   +GS YEGE   G   G G     KT  VYRG+++ G+  G G MFY       Y G+W++N +EG G+  Y +G+VYEG++  +  HGEG MR ++    YSG WI G + G G  T           P  + Y G F   + HG+G   +  G LY G W+
Sbjct:  107 HVYKGSFSHGLMHGYGEYIWSDGL-KYQGDFKVNVPMGHGTYTWLNGSTYEGEVHQGIRHGVGMYKCVKTLTVYRGQWYLGKRQGQGEMFYNQEATSWYKGEWVNNCKEGWGKRCYPSGNVYEGQWRNNVRHGEGTMRWIDLDQQYSGQWINGTQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLYASGALYCGQWK 312          

HSP 2 Score: 98.5969 bits (244), Expect = 3.490e-21
Identity = 62/182 (34.07%), Postives = 93/182 (51.10%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFV--MADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE-YHGDWISNSREGNGQLT----------YANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFN 603
            Y GE ++ +R G G+Y        Y G+W  GK+ G G         S+Y+GE+ N    G G+R +P +GNVY G++ N    G G M + + D+ Y G WI+ ++EG G  T          Y   + Y G+F +   HG+G     +G++Y G W    KHG G+    +G VYEG+F+
Sbjct:  155 YEGEVHQGIRHGVGMYKCVKTLTVYRGQWYLGKRQGQGEMFYNQEATSWYKGEWVNNCKEGWGKRCYP-SGNVYEGQWRNNVRHGEGTMRWIDLDQQYSGQWINGTQEGKGTHTWFRKRAPSSQYPRMNEYTGDFVQAMRHGQGQFLYASGALYCGQWKYDKKHGQGRYIFENGRVYEGEFS 335          

HSP 3 Score: 66.6254 bits (161), Expect = 4.933e-11
Identity = 47/142 (33.10%), Postives = 68/142 (47.89%), Query Frame = 1
Query:   79 KDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHG--RFVMADGSFYEGEFQNGEICGKGERYW----------PKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYK 468
            ++  ++Y GE     +EG+G   Y +    YEG+W+   +HG G  R++  D   Y G++ NG   GKG   W          P+  N Y G+F      G G   Y +G  Y G W  + + G G+  + NG VYEGEF K
Sbjct:  198 QEATSWYKGEWVNNCKEGWGKRCYPSGNV-YEGQWRNNVRHGEGTMRWIDLDQQ-YSGQWINGTQEGKGTHTWFRKRAPSSQYPRM-NEYTGDFVQAMRHGQGQFLYASGALYCGQWKYDKKHGQGRYIFENGRVYEGEFSK 336          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Zebrafish
Match: morn3 (MORN repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE-050417-152])

HSP 1 Score: 96.2857 bits (238), Expect = 5.156e-22
Identity = 62/157 (39.49%), Postives = 87/157 (55.41%), Query Frame = 1
Query:  145 VYENKFFKYEGEWQKGKKHGHGRFVMAD-GSFYEGEFQNGEICGKG--ERYWPKTG---NVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPD-GSVYEG 594
            VY     +Y GEW   KKHG G+ V    G  Y+G+++ G+  G G   R  P+T     VY G + N +  G G  FY     Y G W  + R G G++ Y NG++YEGE+ + K HGEG++ L NG+ + G W  G K+GHG++   D G +YEG
Sbjct:   30 VYSVNGDQYTGEWMDNKKHGKGKQVWKRAGIVYDGDWRCGKRDGFGTLSRMDPETKEYTRVYVGSWRNDKKEGAGSYFYSASAFYEGQWSGDERSGWGRMQYENGELYEGEWLRDKHHGEGLILLANGNRFVGTWSDGKKNGHGQLFFLDRGQLYEG 186          

HSP 2 Score: 77.7962 bits (190), Expect = 1.230e-15
Identity = 51/174 (29.31%), Postives = 88/174 (50.57%), Query Frame = 1
Query:  184 QKGKKHG-HGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE------YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHI-CGILYTGLWEQNL 681
            +K +K+G H      +G  Y GE+ + +  GKG++ W + G VY G++  G+  G G +   + +       Y G W ++ +EG G   Y+    YEG++   +  G G M+  NG +Y G W+    HG G + + +G+ + G ++    +G G LF +  G LY G W  ++
Sbjct:   19 RKAQKYGLHHTVYSVNGDQYTGEWMDNKKHGKGKQVWKRAGIVYDGDWRCGKRDGFGTLSRMDPETKEYTRVYVGSWRNDKKEGAGSYFYSASAFYEGQWSGDERSGWGRMQYENGELYEGEWLRDKHHGEGLILLANGNRFVGTWSDGKKNGHGQLFFLDRGQLYEGFWVDDV 192          

HSP 3 Score: 53.5286 bits (127), Expect = 1.983e-7
Identity = 45/177 (25.42%), Postives = 68/177 (38.42%), Query Frame = 1
Query:   73 EIKDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWI-----CGNKHGHGKMTMPDGSVY 588
            E K+    Y+G      +EG G Y Y    F YEG+W   ++ G GR    +G  YEGE+   +                    H+GE    G++   NG+ + G W    + G+GQL +                      L  G +Y G+W+     CG+    G+ T    +VY
Sbjct:   83 ETKEYTRVYVGSWRNDKKEGAGSYFYSASAF-YEGQWSGDERSGWGRMQYENGELYEGEWLRDK--------------------HHGE----GLILLANGNRFVGTWSDGKKNGHGQLFF----------------------LDRGQLYEGFWVDDVAKCGSISDFGRETAVRPTVY 212          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Zebrafish
Match: morn3 (MORN repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE-050417-152])

HSP 1 Score: 95.9005 bits (237), Expect = 6.619e-22
Identity = 62/157 (39.49%), Postives = 87/157 (55.41%), Query Frame = 1
Query:  145 VYENKFFKYEGEWQKGKKHGHGRFVMAD-GSFYEGEFQNGEICGKG--ERYWPKTG---NVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPD-GSVYEG 594
            VY     +Y GEW   KKHG G+ V    G  Y+G+++ G+  G G   R  P+T     VY G + N +  G G  FY     Y G W  + R G G++ Y NG++YEGE+ + K HGEG++ L NG+ + G W  G K+GHG++   D G +YEG
Sbjct:   30 VYSVNGDQYTGEWMDNKKHGKGKQVWKRAGIVYDGDWRCGKRDGFGTLSRMDPETKEYTRVYVGTWRNDKKEGAGSYFYSASAFYEGQWSGDERSGWGRMQYENGELYEGEWLRDKHHGEGLILLANGNRFVGTWSDGKKNGHGQLFFLDRGQLYEG 186          

HSP 2 Score: 77.411 bits (189), Expect = 1.663e-15
Identity = 51/174 (29.31%), Postives = 88/174 (50.57%), Query Frame = 1
Query:  184 QKGKKHG-HGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE------YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHI-CGILYTGLWEQNL 681
            +K +K+G H      +G  Y GE+ + +  GKG++ W + G VY G++  G+  G G +   + +       Y G W ++ +EG G   Y+    YEG++   +  G G M+  NG +Y G W+    HG G + + +G+ + G ++    +G G LF +  G LY G W  ++
Sbjct:   19 RKAQKYGLHHTVYSVNGDQYTGEWMDNKKHGKGKQVWKRAGIVYDGDWRCGKRDGFGTLSRMDPETKEYTRVYVGTWRNDKKEGAGSYFYSASAFYEGQWSGDERSGWGRMQYENGELYEGEWLRDKHHGEGLILLANGNRFVGTWSDGKKNGHGQLFFLDRGQLYEGFWVDDV 192          

HSP 3 Score: 53.1434 bits (126), Expect = 2.517e-7
Identity = 45/177 (25.42%), Postives = 68/177 (38.42%), Query Frame = 1
Query:   73 EIKDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWI-----CGNKHGHGKMTMPDGSVY 588
            E K+    Y+G      +EG G Y Y    F YEG+W   ++ G GR    +G  YEGE+   +                    H+GE    G++   NG+ + G W    + G+GQL +                      L  G +Y G+W+     CG+    G+ T    +VY
Sbjct:   83 ETKEYTRVYVGTWRNDKKEGAGSYFYSASAF-YEGQWSGDERSGWGRMQYENGELYEGEWLRDK--------------------HHGE----GLILLANGNRFVGTWSDGKKNGHGQLFF----------------------LDRGQLYEGFWVDDVAKCGSISDFGRETAVRPTVY 212          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Zebrafish
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 b [Source:ZFIN;Acc:ZDB-GENE-080929-1])

HSP 1 Score: 91.2781 bits (225), Expect = 1.045e-18
Identity = 63/202 (31.19%), Postives = 95/202 (47.03%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFK----YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPK----TGNVYRGEFHNGEMTGTGIM-FYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICG-NKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGL 666
              Y G       +GFG YV  NK       Y+G+W+ GK HG G F  A G  YEG FQ+    G G     K    + +V+ G++   + +G G+      G++Y G W+ + R+GNG +    G  YEG F  +K+ G G++   + + + G ++     +G G +TMP+G   EG F              CG+  TGL
Sbjct: 1100 RMYTGTFKNGFEDGFGDYVVSNKTLNSCDHYQGQWKDGKMHGFGTFRYASGEVYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWQYDKKSGYGVFDDITRGEKYMGMWLDDQRQGNGVVVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGEFLEDWTLNGKGVLTMPNGDYIEGSF--------------CGVWGTGL 1287          

HSP 2 Score: 82.0333 bits (201), Expect = 8.805e-16
Identity = 57/170 (33.53%), Postives = 81/170 (47.65%), Query Frame = 1
Query:  157 KFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWP-KTGNV---YRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREG-----NGQLTYANGDVYEGEFYKHKIHGEGIM-RLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLF 636
            K  KY+G W  GK HG G     DG  Y G F+NG   G G+     KT N    Y+G++ +G+M G G   Y +G+ Y G +  N R G     +G+L   +  V+ G++   K  G G+   +  G  Y G W+   + G+G +    G  YEG F+ N   G G L 
Sbjct: 1075 KDAKYDGRWVSGKPHGRGVVKWPDGRMYTGTFKNGFEDGFGDYVVSNKTLNSCDHYQGQWKDGKMHGFGTFRYASGEVYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWQYDKKSGYGVFDDITRGEKYMGMWLDDQRQGNGVVVTQFGLYYEGAFSNNKMMGTGVLL 1244          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Xenopus
Match: igf2 (insulin like growth factor 2 [Source:Xenbase;Acc:XB-GENE-482586])

HSP 1 Score: 286.189 bits (731), Expect = 7.372e-90
Identity = 164/479 (34.24%), Postives = 255/479 (53.24%), Query Frame = 1
Query:   88 NNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLT-TDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVNDNNSL--FELIEQIDSKPVETTY-YPVLLVPLTDKPPQWVQSLENASHNKIRLP-------------HLFESDESNSQPPESTETDLT---------DAPLCNDLCLDPVIQETKNGSVDFINLFIQQPKLAAGSCLQSDSASEFINSASVSA-----TSIKQNK-DQSLSEKNIKHK------ELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQI 1410
            + +Y G   K LR+G+G+YVYEN FF+YEG+W+ GKKHGHG+ +  DGS+YEGEF +GEI G G RYW  +GN Y GEF  GE+ G G+M Y +G  Y G+++   +EG+G L    G  Y G F+ +K +G G M+ MNG  Y G WI   + GHG +   DGS+YEGQ+  ++F+G+G + H  G++Y GLW    P     KM +   DI++  QG    + + + T+ GE V  E+GR L+++AG+KY   N + +L   ELIE ++ KP ++ + Y  +  PLT       Q+   + H K  +P             HL E+  S      S E  L           +   +++C  P     + G   F ++ +  P  A   C ++D       +  +SA      ++ Q K + S SE +IK +      +L D    + GEY++I++D+T  PF+   L  ++ ++++
Sbjct:   11 SRYYTGGIKKQLRDGYGLYVYENSFFRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWRNDVFNGQGIMIHCSGVIYDGLWINGHPAVAAKKMVIIGEDIINFIQGSRSTVHVQIQTEEGETVKNENGRVLKISAGIKYSQPNRSQTLSFLELIEDLEEKPFQSPFGYECINYPLT-------QTASRSQHQKDTIPFNSQSGSAPFGGSHLSENSISEHGFVASQEAGLALNSSGEYPEISGTTDEMCFLPSNVRVEAGCAIFSDIMLGPPS-AKFHCDETDKNKGKKPNGKISAEKTEKMTVSQEKIEDSRSETSIKDRKVKKDNQLQDSNIVRPGEYIIIVKDVTSPPFLGYTLPPVFKRVRL 481          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Xenopus
Match: igf2 (insulin like growth factor 2 [Source:Xenbase;Acc:XB-GENE-482586])

HSP 1 Score: 249.595 bits (636), Expect = 1.872e-77
Identity = 123/281 (43.77%), Postives = 176/281 (62.63%), Query Frame = 1
Query:   88 NNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLT-TDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVNDNNSL--FELIEQIDSKPVETTYYP 921
            + +Y G   K LR+G+G+YVYEN FF+YEG+W+ GKKHGHG+ +  DGS+YEGEF +GEI G G RYW  +GN Y GEF  GE+ G G+M Y +G  Y G+++   +EG+G L    G  Y G F+ +K +G G M+ MNG  Y G WI   + GHG +   DGS+YEGQ+  ++F+G+G + H  G++Y GLW    P     KM +   DI++  QG    + + + T+ GE V  E+GR L+++AG+KY   N + +L   ELIE ++ KP +   YP
Sbjct:    5 SRYYTGGIKKQLRDGYGLYVYENSFFRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWRNDVFNGQGIMIHCSGVIYDGLWINGHPAVAAKKMVIIGEDIINFIQGSRSTVHVQIQTEEGETVKNENGRVLKISAGIKYSQPNRSQTLSFLELIEDLEEKPFQK--YP 283          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Xenopus
Match: igf2 (insulin like growth factor 2 [Source:Xenbase;Acc:XB-GENE-482586])

HSP 1 Score: 229.95 bits (585), Expect = 1.926e-70
Identity = 118/294 (40.14%), Postives = 173/294 (58.84%), Query Frame = 1
Query:  133 FGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLT-TDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVNDNNSLFELIEQIDSKPVETTYYPVLLVPLTDKPPQWVQSLENASHNKIRLPHL 1011
            +G+YVYEN FF+YEG+W+ GKKHGHG+ +  DGS+YEGEF +GEI G G RYW  +GN Y GEF  GE+ G G+M Y +G  Y G+++   +EG+G L    G  Y G F+ +K +G G M+ MNG  Y G WI   + GHG +   DGS+YEGQ+  ++F+G+G + H  G++Y GLW    P     KM +   DI++  QG    + + + T+ GE V  E+GR L+++AG+KY   N + +L E I  I  K V +  +    +P   K  + +     +  N+   P +
Sbjct:   27 YGLYVYENSFFRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWRNDVFNGQGIMIHCSGVIYDGLWINGHPAVAAKKMVIIGEDIINFIQGSRSTVHVQIQTEEGETVKNENGRVLKISAGIKYSQPNRSQTLREYI--IIVKDVTSPPFLGYTLPPVFKRVRLLHEKSKSKTNQKEAPKI 318          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Xenopus
Match: igf2 (insulin like growth factor 2 [Source:Xenbase;Acc:XB-GENE-482586])

HSP 1 Score: 201.83 bits (512), Expect = 5.090e-61
Identity = 96/213 (45.07%), Postives = 135/213 (63.38%), Query Frame = 1
Query:   88 NNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDIL 726
            + +Y G   K LR+G+G+YVYEN FF+YEG+W+ GKKHGHG+ +  DGS+YEGEF +GEI G G RYW  +GN Y GEF  GE+ G G+M Y +G  Y G+++   +EG+G L    G  Y G F+ +K +G G M+ MNG  Y G WI   + GHG +   DGS+YEGQ+  ++F+G+G + H  G++Y GLW    P  +   ++     L
Sbjct:    5 SRYYTGGIKKQLRDGYGLYVYENSFFRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWRNDVFNGQGIMIHCSGVIYDGLWINGHPAGLCAVIRKVVASL 217          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Xenopus
Match: igf2 (insulin like growth factor 2 [Source:Xenbase;Acc:XB-GENE-482586])

HSP 1 Score: 198.364 bits (503), Expect = 8.605e-60
Identity = 96/205 (46.83%), Postives = 133/205 (64.88%), Query Frame = 1
Query:   88 NNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTK 702
            + +Y G   K LR+G+G+YVYEN FF+YEG+W+ GKKHGHG+ +  DGS+YEGEF +GEI G G RYW  +GN Y GEF  GE+ G G+M Y +G  Y G+++   +EG+G L    G  Y G F+ +K +G G M+ MNG  Y G WI   + GHG +   DGS+YEGQ+  ++F+G+G + H  G++Y GLW    P  +  K
Sbjct:    5 SRYYTGGIKKQLRDGYGLYVYENSFFRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWRNDVFNGQGIMIHCSGVIYDGLWINGHPHDLWPK 209          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Mouse
Match: Morn1 (MORN repeat containing 1 [Source:MGI Symbol;Acc:MGI:1924116])

HSP 1 Score: 222.631 bits (566), Expect = 5.138e-66
Identity = 149/444 (33.56%), Postives = 229/444 (51.58%), Query Frame = 1
Query:  124 REGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMK-LTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKY--QPVNDNNSLFELIEQIDSKPVETTY------YPVLLVPLTDKPPQWVQSLENASHNKIRLPHLFESDESNSQPPESTETDLTDAPLCNDLCLDPVIQETKNGSVDFINLFI------QQPKLAAGSCLQSDSASEFINSASVSATSIKQNKDQSLSEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQI 1410
            R G+GVYVY N FF+YEGEW+ GKKHGHG+ +  DGS+YEGEF +GEI G+G ++W  +GN Y G+F  GE  G G+M Y  G  Y G+     REG G L   +G VY+G F+ +K HG G M   NG  Y G W+   + GHG +   DGS Y+GQ++ ++F G G+L H  G+ Y G++    P +   K+  L  ++L+  QG  F +S+ L  D+GE+   ESGR L+++AGV+Y   P     S F++ E     P++T +      YP L VP++   P+   ++E+A  + +    L + D        +         +       P  Q+  +G  +F+++ +       QP L     L+          +S       Q   +  +  +    E     +  LGEYVL++ D+T  PF+ +RL T +  ++I
Sbjct:   24 RNGYGVYVYPNSFFRYEGEWKGGKKHGHGKLLFKDGSYYEGEFVDGEITGEGCQHWAWSGNTYSGQFVLGEPQGHGVMKYKAGGRYEGELSQGLREGQGFLEDQDGQVYQGSFHDNKRHGRGQMIFKNGDKYEGDWVRDQRQGHGVLCCADGSTYKGQWHSDVFSGLGSLVHCSGVTYCGMFINGHPAEQAKKIVILGPEVLEVVQGSPFTLSVQLQQDDGEVAKSESGRVLKISAGVRYVQLPEYSEVSFFKMDEDYMETPIQTPFGFQCISYP-LSVPMSWG-PEPGSTVESARADLL----LSKRDSEPVLDSGAFHGQGDTLSILPARRHKPCCQQVDHGCAEFVDILLGAPPPGMQPYLFLPGTLEKTLGRPKGGPSSPEVLPTAQEPLKGTNRPDGTTVEPPTAAY--LGEYVLMVCDVTSPPFLGHRLPTTFKHLRI 459          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Mouse
Match: Morn1 (MORN repeat containing 1 [Source:MGI Symbol;Acc:MGI:1924116])

HSP 1 Score: 175.252 bits (443), Expect = 1.009e-50
Identity = 99/224 (44.20%), Postives = 138/224 (61.61%), Query Frame = 1
Query:  124 REGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMK-LTTDILDCFQGHTFQISLTLITDNGEIV 792
            R G+GVYVY N FF+YEGEW+ GKKHGHG+ +  DGS+YEGEF +GEI G+G ++W  +GN Y G+F  GE  G G+M Y  G  Y G+     REG G L   +G VY+G F+ +K HG G M   NG  Y G W+   + GHG +   DGS Y+GQ++ ++F G G+L H  G+ Y G++    P +   K+  L  ++L+  QG  F +S+ L  D+GE+ 
Sbjct:   24 RNGYGVYVYPNSFFRYEGEWKGGKKHGHGKLLFKDGSYYEGEFVDGEITGEGCQHWAWSGNTYSGQFVLGEPQGHGVMKYKAGGRYEGELSQGLREGQGFLEDQDGQVYQGSFHDNKRHGRGQMIFKNGDKYEGDWVRDQRQGHGVLCCADGSTYKGQWHSDVFSGLGSLVHCSGVTYCGMFINGHPAEQAKKIVILGPEVLEVVQGSPFTLSVQLQQDDGEVA 247          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Mouse
Match: Morn1 (MORN repeat containing 1 [Source:MGI Symbol;Acc:MGI:1924116])

HSP 1 Score: 135.576 bits (340), Expect = 1.889e-36
Identity = 80/168 (47.62%), Postives = 103/168 (61.31%), Query Frame = 1
Query:  124 REGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVY----EGQFNYNLF 615
            R G+GVYVY N FF+YEGEW+ GKKHGHG+ +  DGS+YEGEF +GEI G+G ++W  +GN Y G+F  GE  G G+M Y  G  Y G+     REG G L   +G VY+G F+ +K HG G M   NG  Y G W+   + GHG +   DGS Y    E  F Y++ 
Sbjct:   24 RNGYGVYVYPNSFFRYEGEWKGGKKHGHGKLLFKDGSYYEGEFVDGEITGEGCQHWAWSGNTYSGQFVLGEPQGHGVMKYKAGGRYEGELSQGLREGQGFLEDQDGQVYQGSFHDNKRHGRGQMIFKNGDKYEGDWVRDQRQGHGVLCCADGSTYKSAPEADFPYSVL 191          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Mouse
Match: Morn3 (MORN repeat containing 3 [Source:MGI Symbol;Acc:MGI:1922140])

HSP 1 Score: 98.5969 bits (244), Expect = 6.498e-23
Identity = 62/178 (34.83%), Postives = 93/178 (52.25%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTG---NVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPD-GSVYEGQFNYNL 612
            + Y+GE    L+ G G  V++     YEG+W+ GK+ G+G     D                     P+TG    VY G +   + +G GI F+G  + Y G+W +N R G G++ Y NGD+YEG++   K  GEG++RL NG+ Y G W  G K+GHG+    D G ++EG +  N+
Sbjct:   36 DHYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGSLSHPD---------------------PETGKLRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCNNQRSGWGRMYYNNGDIYEGQWQNDKPEGEGMLRLKNGNRYEGIWERGMKNGHGRFFHLDHGQLFEGYWVDNV 192          

HSP 2 Score: 75.0998 bits (183), Expect = 9.024e-15
Identity = 62/213 (29.11%), Postives = 99/213 (46.48%), Query Frame = 1
Query:  184 QKGKKHGHGRFVMA-DGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE------YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHI-CGILYTGLWEQNLPCKIPTKMKLTTDILDCFQGHTFQISLTLITDNGEIVHE 798
            +K +K+G    V A +G  Y GE++     GKG + W K+G VY G++  G+  G G + + + +       Y G W  + + G G   +   + YEGE+  ++  G G M   NG IY G W      G G + + +G+ YEG +   + +G G  FH+  G L+ G W  N+  K  T +    D  +  +   F I    I D   ++ E
Sbjct:   19 RKAQKNGLRHQVFAVNGDHYVGEWKGNLKHGKGTQVWKKSGAVYEGDWKFGKRDGYGSLSHPDPETGKLRRVYSGWWKGDKKSGYGIQFFGPKEYYEGEWCNNQRSGWGRMYYNNGDIYEGQWQNDKPEGEGMLRLKNGNRYEGIWERGMKNGHGRFFHLDHGQLFEGYWVDNV-AKCGTMIDFGRD--EAPEPTQFPIPKVEILDPDGVLKE 228          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Mouse
Match: Morn1 (MORN repeat containing 1 [Source:MGI Symbol;Acc:MGI:1924116])

HSP 1 Score: 89.7373 bits (221), Expect = 5.584e-21
Identity = 52/100 (52.00%), Postives = 69/100 (69.00%), Query Frame = 1
Query:  124 REGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWP---------KTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWI 396
            R G+GVYVY N FF+YEGEW+ GKKHGHG+ +  DGS+YEGEF +GEI G+G ++W          + G VY+G FH+ +  G G M + NGD+Y GDW+
Sbjct:   24 RNGYGVYVYPNSFFRYEGEWKGGKKHGHGKLLFKDGSYYEGEFVDGEITGEGCQHWAWSGQGFLEDQDGQVYQGSFHDNKRHGRGQMIFKNGDKYEGDWV 123          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. UniProt
Match: sp|Q5T089|MORN1_HUMAN (MORN repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=MORN1 PE=2 SV=2)

HSP 1 Score: 234.572 bits (597), Expect = 1.906e-69
Identity = 141/444 (31.76%), Postives = 225/444 (50.68%), Query Frame = 1
Query:  130 GFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMK-LTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVNDNNSL-FELIEQIDSKPVETTYYPVLLVPLTDKPPQW----VQSLENASHNKIRLPHL-FESDESNSQPPESTETDLTD---APLCNDLCLDPVIQETKNGSVDFINLFIQQPKLAAGSCLQSDSASEFINSASV-------SATSIKQNKDQSLSEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQI 1410
            G+GVYVY N FF+YEGEW+ G+KHGHG+ +  DGS+YEG F +GEI G+G R+W  +G+ + G+F  GE  G G+M Y  G  Y G+     REG+G L   +G VY+G F+ +K HG G M   NG  Y G W+   + GHG +   DGS Y+GQ++ ++F G G++ H  G+ Y GLW    P +  T++  L  ++++  QG  F +++ L+ D+GEI   ESGR L+++AGV+Y  ++  + + F  +++ + + +  T +    +P     P       ++ +  +   + LP    E         E T   L     AP C   C     Q  + G  +F ++ +  P       L  DS  +     S        +  + ++    S  E     ++        LGEYVL+I D+T  PF+  RL   +  +++
Sbjct:   26 GYGVYVYPNSFFRYEGEWKAGRKHGHGKLLFKDGSYYEGAFVDGEITGEGRRHWAWSGDTFSGQFVLGEPQGYGVMEYKAGGCYEGEVSHGMREGHGFLVDRDGQVYQGSFHDNKRHGPGQMLFQNGDKYDGDWVRDRRQGHGVLRCADGSTYKGQWHSDVFSGLGSMAHCSGVTYYGLWINGHPAEQATRIVILGPEVMEVAQGSPFSVNVQLLQDHGEIAKSESGRVLQISAGVRYVQLSAYSEVNFFKVDRDNQETLIQTPFGFECIPYPVSSPAAGVPGPRAAKGGAEADVPLPRGDLELHLGALHGQEDTPGGLLARGHAPHCPGAC-----QRVEQGCAEFTDVLLGPPPPGYHPFLFLDSLHKKAGGRSRGGLHPRGTPPTAQEPPGGSRPEGRATEEQA---AAAHLGEYVLMIRDVTTPPFLGRRLPPAFKHLRV 461          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. UniProt
Match: sp|Q641X6|MORN1_RAT (MORN repeat-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Morn1 PE=1 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 4.270e-66
Identity = 154/446 (34.53%), Postives = 231/446 (51.79%), Query Frame = 1
Query:  124 REGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKM-KLTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKY--QPVNDNNSLFELIEQIDSKPVETTY-YPVLLVPLTDKPPQWVQSLENASHNKIRLPHLFESDESNSQPPESTET------DLTDAPL-CNDLCLDPVIQETKNGSVDFINLFI------QQPKLAAGSCLQSDSASEFINSASVSATSIKQNKDQSLSEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQI 1410
            R G+GVYVY N FF+YEGEW+ GKKHGHG+ +  DGS+YEGEF NGEI G+G ++W  +GN Y G+F  GE  G GIM Y  G  Y G+     REG G L   +G VY+G F+ +K HG G M   NG  Y G W+   + GHG +   DGS Y+GQ++ ++F G G+L H  G+ Y G++    P     K+  L  ++L+  QG  F +S+ L  D+GE+   ESGR L+++AGV+Y   P     S F++ +     P++T + +  +  PL+     W   LE  S  +     L  S + +S+P   +E        L+  P   ++ C     Q    G  +F+++ +       QP L   S L+        + +     S  Q   +  +  +    E     +  LGEYVL++ D+T  PF+ +RL T +  ++I
Sbjct:   24 RNGYGVYVYPNSFFRYEGEWKGGKKHGHGKLLFKDGSYYEGEFVNGEITGEGYQHWAWSGNTYSGQFVLGEPQGHGIMKYKAGGHYEGELSQGLREGQGFLEDQDGQVYQGSFHDNKRHGRGQMVFKNGDKYEGDWVRDQRQGHGVLFCADGSTYKGQWHNDVFSGLGSLVHCSGVTYCGMFINGHPAAQAKKIVVLGPELLEVVQGSPFTLSVQLQQDDGEVAKSESGRVLKISAGVRYVQLPEYSEVSFFKMDDAHMETPIQTPFGFQCIPYPLSVS-TSW--GLEPGSTVESARADLLLS-KKDSEPVLDSEAFHGKGDTLSILPARRHEPCCSAAYQRVDQGCAEFVDIHLGAPPPGMQPYLFLPSMLEKAGNRPKGDRSPPEVLSTAQEPLRGTNRSDGTTAEPSTAAY--LGEYVLMVCDVTSPPFLGHRLPTTFKHLRI 463          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. UniProt
Match: sp|Q8L796|PI5K2_ARATH (Phosphatidylinositol 4-phosphate 5-kinase 2 OS=Arabidopsis thaliana OX=3702 GN=PIP5K2 PE=1 SV=2)

HSP 1 Score: 122.479 bits (306), Expect = 4.926e-28
Identity = 64/170 (37.65%), Postives = 96/170 (56.47%), Query Frame = 1
Query:  169 YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQN 678
            Y G +  G  +G G+++  DG  YEGE++ G+  GKG+  WP +G  Y GEF +G M G+G     +GD Y G W+++ ++G+GQ  YANGD YEG + ++   G G    MNG+ Y+G W  G   G G +  P+G+ YEGQ+   +  G G      G  + G W ++
Sbjct:   82 YMGTFSGGFPNGSGKYLWKDGCMYEGEWKRGKASGKGKFSWP-SGATYEGEFKSGRMEGSGTFVGVDGDTYRGSWVADRKQGHGQKRYANGDYYEGTWRRNLQDGRGRYVWMNGNQYTGEWRNGVICGKGVLAWPNGNRYEGQWENGVPKGSGVFTWADGSSWIGSWNES 250          

HSP 2 Score: 87.4261 bits (215), Expect = 1.025e-16
Identity = 43/129 (33.33%), Postives = 63/129 (48.84%), Query Frame = 1
Query:  301 GNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPC 687
            G++Y G F  G   G+G   + +G  Y G+W      G G+ ++ +G  YEGEF   ++ G G    ++G  Y G W+   K GHG+    +G  YEG +  NL  G G    + G  YTG W   + C
Sbjct:   79 GDLYMGTFSGGFPNGSGKYLWKDGCMYEGEWKRGKASGKGKFSWPSGATYEGEFKSGRMEGSGTFVGVDGDTYRGSWVADRKQGHGQKRYANGDYYEGTWRRNLQDGRGRYVWMNGNQYTGEWRNGVIC 207          

HSP 3 Score: 71.633 bits (174), Expect = 9.045e-12
Identity = 37/94 (39.36%), Postives = 56/94 (59.57%), Query Frame = 1
Query:  124 REGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNS 405
            ++G G   Y N  + YEG W++  + G GR+V  +G+ Y GE++NG ICGKG   WP  GN Y G++ NG   G+G+  + +G  + G W  +S
Sbjct:  160 KQGHGQKRYANGDY-YEGTWRRNLQDGRGRYVWMNGNQYTGEWRNGVICGKGVLAWP-NGNRYEGQWENGVPKGSGVFTWADGSSWIGSWNESS 251          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. UniProt
Match: sp|Q9SFB8|PI5K6_ARATH (Phosphatidylinositol 4-phosphate 5-kinase 6 OS=Arabidopsis thaliana OX=3702 GN=PIP5K6 PE=2 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 3.743e-27
Identity = 62/170 (36.47%), Postives = 89/170 (52.35%), Query Frame = 1
Query:  169 YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQN 678
            Y G+W+    HGHG+++  DG  Y G++  G+  GKG   WP +G  Y G+F NG M G G     +GD Y G W+ N R G G  +Y NGD Y+GE+ +    G G  +  N + Y G W  G  +G+G M   +G+ Y+G +      G GT     G  Y G+W ++
Sbjct:   32 YTGQWRDNLPHGHGKYLWTDGCMYVGDWHRGKTMGKGRFSWP-SGATYEGDFKNGYMDGKGTYIDSSGDLYRGSWVMNLRHGQGTKSYVNGDCYDGEWRRGLQDGHGRYQWKNENHYIGQWKNGLMNGNGTMIWSNGNRYDGSWEDGAPKGNGTFRWSDGSFYVGVWSKD 200          

HSP 2 Score: 102.449 bits (254), Expect = 1.394e-21
Identity = 63/182 (34.62%), Postives = 95/182 (52.20%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLF 636
            +FY G+    L  G G Y++ +    Y G+W +GK  G GRF    G+ YEG+F+NG + GKG  Y   +G++YRG +      G G   Y NGD Y G+W    ++G+G+  + N + Y G++    ++G G M   NG+ Y G W  G   G+G     DGS Y G ++ +     GT +
Sbjct:   30 DFYTGQWRDNLPHGHGKYLWTDGCM-YVGDWHRGKTMGKGRFSWPSGATYEGDFKNGYMDGKGT-YIDSSGDLYRGSWVMNLRHGQGTKSYVNGDCYDGEWRRGLQDGHGRYQWKNENHYIGQWKNGLMNGNGTMIWSNGNRYDGSWEDGAPKGNGTFRWSDGSFYVGVWSKDPKEQNGTYY 209          

HSP 3 Score: 59.6918 bits (143), Expect = 4.796e-8
Identity = 34/98 (34.69%), Postives = 45/98 (45.92%), Query Frame = 1
Query:  436 NGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDILD 729
            +GD Y G++  +  HG G     +G +Y G W  G   G G+ + P G+ YEG F      G+GT     G LY G W  NL     TK  +  D  D
Sbjct:   28 SGDFYTGQWRDNLPHGHGKYLWTDGCMYVGDWHRGKTMGKGRFSWPSGATYEGDFKNGYMDGKGTYIDSSGDLYRGSWVMNLRHGQGTKSYVNGDCYD 125          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. UniProt
Match: sp|Q56YP2|PI5K1_ARATH (Phosphatidylinositol 4-phosphate 5-kinase 1 OS=Arabidopsis thaliana OX=3702 GN=PIP5K1 PE=1 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 4.892e-26
Identity = 62/170 (36.47%), Postives = 91/170 (53.53%), Query Frame = 1
Query:  169 YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQN 678
            Y G +  G  HG G+++  DG  YEG+++ G+  GKG+  WP +G  Y GEF +G M G G     +GD Y G W+++ + G+GQ  YANGD YEG + ++   G G     NG+ Y+G W  G   G G +  P+G+ YEG +   +  G G      G    G W ++
Sbjct:   81 YIGSFSGGFPHGSGKYLWKDGCMYEGDWKRGKASGKGKFSWP-SGATYEGEFKSGRMEGFGTFTGADGDTYRGTWVADRKHGHGQKRYANGDFYEGTWRRNLQDGRGRYVWRNGNQYTGEWRSGVISGKGLLVWPNGNRYEGLWENGIPKGNGVFTWSDGSSCVGAWNES 249          

HSP 2 Score: 85.1149 bits (209), Expect = 5.331e-16
Identity = 44/127 (34.65%), Postives = 61/127 (48.03%), Query Frame = 1
Query:  301 GNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNL 681
            G++Y G F  G   G+G   + +G  Y GDW      G G+ ++ +G  YEGEF   ++ G G     +G  Y G W+   KHGHG+    +G  YEG +  NL  G G      G  YTG W   +
Sbjct:   78 GDLYIGSFSGGFPHGSGKYLWKDGCMYEGDWKRGKASGKGKFSWPSGATYEGEFKSGRMEGFGTFTGADGDTYRGTWVADRKHGHGQKRYANGDFYEGTWRRNLQDGRGRYVWRNGNQYTGEWRSGV 204          

HSP 3 Score: 75.8702 bits (185), Expect = 3.999e-13
Identity = 49/150 (32.67%), Postives = 75/150 (50.00%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNK 546
            Y GE      EGFG +   +    Y G W   +KHGHG+   A+G FYEG ++     G+G   W + GN Y GE+ +G ++G G++ + NG+ Y G W +   +GNG  T+++G    G +     +   IMR     +     I GN+
Sbjct:  127 YEGEFKSGRMEGFGTFTGADGD-TYRGTWVADRKHGHGQKRYANGDFYEGTWRRNLQDGRGRYVW-RNGNQYTGEWRSGVISGKGLLVWPNGNRYEGLWENGIPKGNGVFTWSDGSSCVGAW-----NESNIMRSFFNGVEKNDLIVGNR 269          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|20339576 (tr|A0A1S3IRS7|A0A1S3IRS7_LINUN MORN repeat-containing protein 1-like OS=Lingula unguis OX=7574 GN=LOC106166676 PE=4 SV=1)

HSP 1 Score: 292.738 bits (748), Expect = 2.161e-89
Identity = 169/466 (36.27%), Postives = 252/466 (54.08%), Query Frame = 1
Query:  130 GFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTT----DILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVNDNN----SLFELIEQIDSKPVETTY-YPVLLVPLTDKPPQWVQSLENA----------SHNKIRL----PHLFESD-ESNSQPPESTETDLTDAP---LCNDLCLDPVIQE----------------TKNGSVDFINLFIQQPKLAAGSCLQSDSASEFINSASVSATSIKQNKDQS-LSEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLY 1395
            GFGVY YENKFF+YEG+W++GKKHGHG+ VMADGS+YEG F+NGEI G G RYW  TGN YRG+FH GE+ G G+M Y +G  Y GDW  N R+G G +  + G+VY+G F++HK HGEG M  +NG +Y G W+   + GHG++   D S+Y+GQF  +LF+GEGT++H  G +Y GLW    P ++ TK+ L      + ++  QG TF + +   TD GE+V E+ GR L++ AGV++QP  +N     S+ E +E+++   V T + + V   P+T++    V+ +E+A          + N I      P   E D E + +  E   T +   P      DL  +  + E                T+ G+  + NL++          L  D A+  ++ A  S +      D S    K+     +      + G+YV+ + D+T  P+ +  LE  Y
Sbjct:    3 GFGVYNYENKFFRYEGQWREGKKHGHGKLVMADGSYYEGSFENGEIEGHGFRYWSSTGNTYRGQFHLGELHGQGVMNYSDGAVYKGDWFRNKRQGYGSIADSMGNVYQGYFHEHKKHGEGTMTYVNGDVYEGDWVMDKRQGHGQVKFADTSIYDGQFRNDLFNGEGTMYHCSGFVYEGLWINGEPAQLATKIVLVGTEEGNTIEITQGETFALQIECRTDEGEVV-EDQGRELQVIAGVRFQPPKENTPSGTSILETLEEMEEATVPTPFGFDVASYPITEQEASLVKDMESALSLQKSNTALTENTINEQDEDPEAGERDKEVDGEAGEGGSTHVQSRPESIAPEDLGANEEVSEEALEGSPEPPRITNVKTEKGTAKWDNLYLPPAPPGYRPFLVLDGAT--VDGAKKSKSRASSRGDGSGPGTKSKSRMSVTPGDLVRPGDYVIAVHDVTMPPWQDKPLEPAY 465          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|18895546 (tr|A0A1W5BI91|A0A1W5BI91_CIOIN MORN repeat-containing protein 1-like isoform X2 OS=Ciona intestinalis OX=7719 GN=LOC100176954 PE=4 SV=1)

HSP 1 Score: 291.582 bits (745), Expect = 9.575e-89
Identity = 169/487 (34.70%), Postives = 265/487 (54.41%), Query Frame = 1
Query:   64 LKMEIKDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPC----KIPTKMKLTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVND--NNSLFELIEQIDSKPVETTY-YPVLLVPL------TDKPPQWVQSLENASHNKIRL-------------PHLFE-----------SDESNSQPPESTETDLTDAPLCNDLCLDPVIQETK-NGSVDFINLFIQQPKLAAGSCLQSDSASEFINSASVSATSIKQNKDQSLSEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQI 1410
            + + I ++ N+Y+GETN  LREG+GVY Y NKFF+YEGEW KGKKHGHG+ +M DGS+YEGEF++GEI G G R W +TG+ Y GEF  GE+ G G+M Y +G +Y G++ +N R G G LT  +G+ YEG +YK+K HG+G+    NG  Y G W+ G +HGHG++   DGS+YEGQ+  N+F+GEG++ H  G+ Y GLW    P     +I  ++      ++  QG  F +   ++  N E V    GR  R+TAG +Y P +   N S+ ELIE ++ KP+ T + Y VL  PL      +++  + +++    S    R+             PH  E           SD  + Q       ++ D  +   +   P  Q +  +GSV+F +L++          L  +      +  + +A++   + ++S   K  K K   +E+  K GEY++I+ ++T  PF+ + L   +  +++
Sbjct:    1 MDVTIAEKRNYYVGETNNQLREGYGVYCYANKFFRYEGEWLKGKKHGHGKLLMGDGSYYEGEFKDGEIDGHGYRKWERTGDDYSGEFLKGELHGHGVMNYNDGSQYRGEFCNNQRHGTGVLTDRDGNEYEGAWYKNKKHGQGVQTYFNGDEYEGEWVEGARHGHGELNCVDGSIYEGQWRANMFNGEGSMVHASGVTYEGLWINGKPAAEGKEIVVRLPTNQTHIEVPQGKKFSLQFEIVDVNKEPVVGVHGREFRITAGYRYLPPSKQGNQSILELIEDMEEKPITTPFGYDVLPYPLLENVGVSEETDEIIKNKHRMSPVNARIFGEETIHETHSTEPHKNEDEVEPDDGSIISDNRHIQSEVMLSVEVDDVDVTFSINPPPAPQRSAPDGSVEFKDLYLPSAPPTYRPLLLDEGKRSKGSRNTSAASTSSTSVNESKPGKAGKAKNE-EERGAKPGEYLMIVTEVTNPPFLGDNLPPAFVVVKV 486          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|18908591 (tr|A0A1W5BE42|A0A1W5BE42_CIOIN MORN repeat-containing protein 1-like isoform X1 OS=Ciona intestinalis OX=7719 GN=LOC100176954 PE=4 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 9.260e-87
Identity = 174/512 (33.98%), Postives = 270/512 (52.73%), Query Frame = 1
Query:   64 LKMEIKDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPC----KIPTKMKLTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVND--NNSLFELIEQIDSKPVETTY-YPVLLVPL------TDKPPQWVQSLENASHNKIRL-------------PHLFE-----------SDESNSQPPESTETDLTDAPLCNDLCLDPVIQETK-NGSVDFINLFIQ------QPKLAAGSCLQSDSASEFINSASVSATSIKQNK-DQSLSEKN----------IKHKELG--------DEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQI 1410
            + + I ++ N+Y+GETN  LREG+GVY Y NKFF+YEGEW KGKKHGHG+ +M DGS+YEGEF++GEI G G R W +TG+ Y GEF  GE+ G G+M Y +G +Y G++ +N R G G LT  +G+ YEG +YK+K HG+G+    NG  Y G W+ G +HGHG++   DGS+YEGQ+  N+F+GEG++ H  G+ Y GLW    P     +I  ++      ++  QG  F +   ++  N E V    GR  R+TAG +Y P +   N S+ ELIE ++ KP+ T + Y VL  PL      +++  + +++    S    R+             PH  E           SD  + Q       ++ D  +   +   P  Q +  +GSV+F +L++       +P L       S  AS   +    S +S++  K  +S   +N          +   + G        +E+  K GEY++I+ ++T  PF+ + L   +  +++
Sbjct:    1 MDVTIAEKRNYYVGETNNQLREGYGVYCYANKFFRYEGEWLKGKKHGHGKLLMGDGSYYEGEFKDGEIDGHGYRKWERTGDDYSGEFLKGELHGHGVMNYNDGSQYRGEFCNNQRHGTGVLTDRDGNEYEGAWYKNKKHGQGVQTYFNGDEYEGEWVEGARHGHGELNCVDGSIYEGQWRANMFNGEGSMVHASGVTYEGLWINGKPAAEGKEIVVRLPTNQTHIEVPQGKKFSLQFEIVDVNKEPVVGVHGREFRITAGYRYLPPSKQGNQSILELIEDMEEKPITTPFGYDVLPYPLLENVGVSEETDEIIKNKHRMSPVNARIFGEETIHETHSTEPHKNEDEVEPDDGSIISDNRHIQSEVMLSVEVDDVDVTFSINPPPAPQRSAPDGSVEFKDLYLPSAPPTYRPLLLDEVTPASSVASSRRSVGQSSTSSVRSEKGKRSKGSRNTSAASTSSTSVNESKPGKAGKAKNEEERGAKPGEYLMIVTEVTNPPFLGDNLPPAFVVVKV 512          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|176482596 (tr|F6PNK8|F6PNK8_XENTR Insulin like growth factor 2 OS=Xenopus tropicalis OX=8364 GN=igf2 PE=4 SV=2)

HSP 1 Score: 286.189 bits (731), Expect = 1.158e-86
Identity = 164/479 (34.24%), Postives = 255/479 (53.24%), Query Frame = 1
Query:   88 NNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLT-TDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVNDNNSL--FELIEQIDSKPVETTY-YPVLLVPLTDKPPQWVQSLENASHNKIRLP-------------HLFESDESNSQPPESTETDLT---------DAPLCNDLCLDPVIQETKNGSVDFINLFIQQPKLAAGSCLQSDSASEFINSASVSA-----TSIKQNK-DQSLSEKNIKHK------ELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQI 1410
            + +Y G   K LR+G+G+YVYEN FF+YEG+W+ GKKHGHG+ +  DGS+YEGEF +GEI G G RYW  +GN Y GEF  GE+ G G+M Y +G  Y G+++   +EG+G L    G  Y G F+ +K +G G M+ MNG  Y G WI   + GHG +   DGS+YEGQ+  ++F+G+G + H  G++Y GLW    P     KM +   DI++  QG    + + + T+ GE V  E+GR L+++AG+KY   N + +L   ELIE ++ KP ++ + Y  +  PLT       Q+   + H K  +P             HL E+  S      S E  L           +   +++C  P     + G   F ++ +  P  A   C ++D       +  +SA      ++ Q K + S SE +IK +      +L D    + GEY++I++D+T  PF+   L  ++ ++++
Sbjct:   11 SRYYTGGIKKQLRDGYGLYVYENSFFRYEGQWKSGKKHGHGKLLFKDGSYYEGEFADGEITGNGLRYWSSSGNKYSGEFQTGEIHGHGVMQYKDGGRYEGEFVFGIKEGHGLLMDKEGQTYSGAFHNNKKYGVGQMKFMNGDHYEGDWILDQRQGHGVLQCTDGSIYEGQWRNDVFNGQGIMIHCSGVIYDGLWINGHPAVAAKKMVIIGEDIINFIQGSRSTVHVQIQTEEGETVKNENGRVLKISAGIKYSQPNRSQTLSFLELIEDLEEKPFQSPFGYECINYPLT-------QTASRSQHQKDTIPFNSQSGSAPFGGSHLSENSISEHGFVASQEAGLALNSSGEYPEISGTTDEMCFLPSNVRVEAGCAIFSDIMLGPPS-AKFHCDETDKNKGKKPNGKISAEKTEKMTVSQEKIEDSRSETSIKDRKVKKDNQLQDSNIVRPGEYIIIVKDVTSPPFLGYTLPPVFKRVRL 481          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. TrEMBL
Match: gnl|BL_ORD_ID|173830687 (tr|A0A4W5N8Y7|A0A4W5N8Y7_9TELE MORN repeat containing 1 OS=Hucho hucho OX=62062 GN=MORN1 PE=4 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.370e-82
Identity = 173/504 (34.33%), Postives = 257/504 (50.99%), Query Frame = 1
Query:   64 LKMEIKDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLT-TDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVK---YQPVNDNNSLFELIEQIDSKPVETTY-YPVLLVPLTDK-----------PPQWVQSLE----NASHNKIRLPH-LFESDESNSQPPESTET----DLTDAPLCNDLCLDPVIQETKNGSVDFINLFIQQP-----KLAAGSCLQSDSASEFINSASVSATSIKQNKDQ-------SLSEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQIHPFPISDSLQESTSKNSQ 1464
            +K +I++ + +Y+GE   + R GFGVYVY N FF YEGEW KG+KHGHG+ +M DGS+YEGEF +GEI G G R+W KTG  Y G+F  GE+ G G+M  GNG+ Y G++    R+GNG L   +G  YEG F+++K HGEG M   NG  Y G W+   + GHG M   DGSVYEGQ+  NLF+G+G + H  GI+Y G+W    P    +K+ +   D+L+ FQ   F + + L T+ GE    E+GR L+++ G++     P     SL +++E     P+ T + + V+  PL ++            P  V ++     +A  +   LP    ES   +  PP    T    D   A    D    P  Q  + G   F NL +  P            L+  +  +  N A      + Q+ +        S    NIK   + D +  + GEYV++++D+T  PF    L  ++  +++ P        ++ SKNSQ
Sbjct:    4 VKKQIRN-SRYYVGEVKNLTRNGFGVYVYPNSFFCYEGEWSKGEKHGHGKLLMKDGSYYEGEFAHGEIEGNGSRFWAKTGVSYSGQFSGGELHGCGVMQKGNGERYEGEFSYGLRDGNGFLVDKDGQAYEGSFHQNKRHGEGQMHYRNGDQYEGGWLLDQQQGHGVMHFGDGSVYEGQWRNNLFNGQGIMIHCSGIIYEGVWANGRPLGGASKVVIEGGDVLEVFQETPFCVEVQLQTEVGEKATGENGRVLQVSTGIRLCDLSPSTTPASLLKMMEDNKETPIPTPFGFQVVSYPLMERAFGSQDSIGTTAPLTVAAVAAKSGSAQADSPLLPEGECESGSGSDGPPLRGGTPSYLDGLFAGQEEDSTPPPANQRVEEGQAKFQNLLLAPPPHDFLPYQLMDELEKRNVKKPSNRAPTDRPGLSQDMNSERRSSMGSCFTSNIKKSSI-DSRSVRPGEYVIMVKDVTNPPFQGQTLPPVFALLRLFP-------AKTKSKNSQ 498          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Cavefish
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:103028242])

HSP 1 Score: 125.561 bits (314), Expect = 6.114e-30
Identity = 77/209 (36.84%), Postives = 106/209 (50.72%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE--YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMN-GSIYSGYWICGNKHGHGKMTM----------PDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQN 678
            + Y G     L  G G Y + +   KYEGE+      GHG +   DGS YEGE   G   G G  +  KT +VYRG++H G+  G GI+ Y       Y GDW +N REG G   Y +G++Y+G++     HGEG MR +     YSG W+ G +HG G  T           P  + Y+G+F   + HG+GT  +  G  Y+G W+ N
Sbjct:   90 HVYKGRFANGLMHGHGEYTWADGV-KYEGEFVLNAPVGHGIYTWLDGSIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWGVRCYPSGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTWVLRRGLGSQYPRSNEYKGEFVQGMRHGQGTFLYASGATYSGGWQHN 297          

HSP 2 Score: 101.679 bits (252), Expect = 2.964e-22
Identity = 62/183 (33.88%), Postives = 93/183 (50.82%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFV--MADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGN-GDEYHGDWISNSREGNGQLT----------YANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQF 600
            + Y GE    +R GFG Y        Y G+W +GK+HG G         S+YEG+++N    G G R +P +GN+Y+G++ N    G G M +     +Y G W++  + G G  T          Y   + Y+GEF +   HG+G     +G+ YSG W    KHG GK+T  +G ++EG+F
Sbjct:  136 SIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWGVRCYP-SGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTWVLRRGLGSQYPRSNEYKGEFVQGMRHGQGTFLYASGATYSGGWQHNKKHGQGKVTFKNGRIFEGEF 317          

HSP 3 Score: 78.1814 bits (191), Expect = 9.222e-15
Identity = 46/145 (31.72%), Postives = 76/145 (52.41%), Query Frame = 1
Query:   79 KDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHG--RFVMADGSFYEGEFQNGEICGKGERYW----------PKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKI 477
            ++R ++Y G+     REG+GV  Y +    Y+G+W+   +HG G  R++  +   Y G++  G   G+G   W          P++ N Y+GEF  G   G G   Y +G  Y G W  N + G G++T+ NG ++EGEF + ++
Sbjct:  181 RERTSWYEGDWKNNCREGWGVRCYPSGNI-YQGQWKNDARHGEGTMRWIQLNQQ-YSGQWVAGVQHGQGTHTWVLRRGLGSQYPRS-NEYKGEFVQGMRHGQGTFLYASGATYSGGWQHNKKHGQGKVTFKNGRIFEGEFIEDRM 322          

HSP 4 Score: 72.4034 bits (176), Expect = 6.431e-13
Identity = 47/150 (31.33%), Postives = 71/150 (47.33%), Query Frame = 1
Query:  301 GNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLM-NGSIYSGYWICGNKHGHGKM-------------------------TMPDGSVYEGQFNYNLFHGEGTLFHI-CGILYTGLW 669
            G+VY+G F NG M G G   + +G +Y G+++ N+  G+G  T+ +G +YEGE +    HG G        S+Y G W  G +HG G +                           P G++Y+GQ+  +  HGEGT+  I     Y+G W
Sbjct:   89 GHVYKGRFANGLMHGHGEYTWADGVKYEGEFVLNAPVGHGIYTWLDGSIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWGVRCYPSGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQW 238          

HSP 5 Score: 58.151 bits (139), Expect = 1.701e-8
Identity = 36/103 (34.95%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  373 DEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGI--LYTGLWEQ 675
            D Y G+       G G   +  G VY+G F    +HG G     +G  Y G ++     GHG  T  DGS+YEG+  Y + HG GT +H      +Y G W Q
Sbjct:   67 DRYEGERCGELFHGEGAADFLGGHVYKGRFANGLMHGHGEYTWADGVKYEGEFVLNAPVGHGIYTWLDGSIYEGEVWYGIRHGFGT-YHCAKTSSVYRGQWHQ 168          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Cavefish
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:103028242])

HSP 1 Score: 124.79 bits (312), Expect = 9.988e-30
Identity = 77/209 (36.84%), Postives = 106/209 (50.72%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE--YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMN-GSIYSGYWICGNKHGHGKMTM----------PDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQN 678
            + Y G     L  G G Y + +   KYEGE+      GHG +   DGS YEGE   G   G G  +  KT +VYRG++H G+  G GI+ Y       Y GDW +N REG G   Y +G++Y+G++     HGEG MR +     YSG W+ G +HG G  T           P  + Y+G+F   + HG+GT  +  G  Y+G W+ N
Sbjct:   90 HVYKGRFANGLMHGHGEYTWADGV-KYEGEFVLNAPVGHGIYTWLDGSIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWGVRCYPSGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTWVLRRGLGSQYPRSNEYKGEFVQGMRHGQGTFLYASGATYSGGWQHN 297          

HSP 2 Score: 101.293 bits (251), Expect = 4.174e-22
Identity = 62/183 (33.88%), Postives = 93/183 (50.82%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFV--MADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGN-GDEYHGDWISNSREGNGQLT----------YANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQF 600
            + Y GE    +R GFG Y        Y G+W +GK+HG G         S+YEG+++N    G G R +P +GN+Y+G++ N    G G M +     +Y G W++  + G G  T          Y   + Y+GEF +   HG+G     +G+ YSG W    KHG GK+T  +G ++EG+F
Sbjct:  136 SIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWGVRCYP-SGNIYQGQWKNDARHGEGTMRWIQLNQQYSGQWVAGVQHGQGTHTWVLRRGLGSQYPRSNEYKGEFVQGMRHGQGTFLYASGATYSGGWQHNKKHGQGKVTFKNGRIFEGEF 317          

HSP 3 Score: 77.7962 bits (190), Expect = 1.220e-14
Identity = 46/145 (31.72%), Postives = 76/145 (52.41%), Query Frame = 1
Query:   79 KDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHG--RFVMADGSFYEGEFQNGEICGKGERYW----------PKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKI 477
            ++R ++Y G+     REG+GV  Y +    Y+G+W+   +HG G  R++  +   Y G++  G   G+G   W          P++ N Y+GEF  G   G G   Y +G  Y G W  N + G G++T+ NG ++EGEF + ++
Sbjct:  181 RERTSWYEGDWKNNCREGWGVRCYPSGNI-YQGQWKNDARHGEGTMRWIQLNQQ-YSGQWVAGVQHGQGTHTWVLRRGLGSQYPRS-NEYKGEFVQGMRHGQGTFLYASGATYSGGWQHNKKHGQGKVTFKNGRIFEGEFIEDRM 322          

HSP 4 Score: 72.0182 bits (175), Expect = 8.165e-13
Identity = 44/129 (34.11%), Postives = 66/129 (51.16%), Query Frame = 1
Query:  301 GNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLM-NGSIYSGYWICGNKHGHGKM--TMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQN 678
            G+VY+G F NG M G G   + +G +Y G+++ N+  G+G  T+ +G +YEGE +    HG G        S+Y G W  G +HG G +       S YEG +  N   G G   +  G +Y G W+ +
Sbjct:   89 GHVYKGRFANGLMHGHGEYTWADGVKYEGEFVLNAPVGHGIYTWLDGSIYEGEVWYGIRHGFGTYHCAKTSSVYRGQWHQGKRHGKGIICYNRERTSWYEGDWKNNCREGWGVRCYPSGNIYQGQWKND 217          

HSP 5 Score: 57.7658 bits (138), Expect = 1.977e-8
Identity = 36/103 (34.95%), Postives = 48/103 (46.60%), Query Frame = 1
Query:  373 DEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGI--LYTGLWEQ 675
            D Y G+       G G   +  G VY+G F    +HG G     +G  Y G ++     GHG  T  DGS+YEG+  Y + HG GT +H      +Y G W Q
Sbjct:   67 DRYEGERCGELFHGEGAADFLGGHVYKGRFANGLMHGHGEYTWADGVKYEGEFVLNAPVGHGIYTWLDGSIYEGEVWYGIRHGFGT-YHCAKTSSVYRGQWHQ 168          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Cavefish
Match: morn3 (MORN repeat-containing protein 3 [Source:NCBI gene;Acc:103031534])

HSP 1 Score: 98.9821 bits (245), Expect = 6.006e-23
Identity = 66/171 (38.60%), Postives = 92/171 (53.80%), Query Frame = 1
Query:  103 GETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMAD-GSFYEGEFQNGEICGKG--ERYWPKTGN---VYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPD-GSVYEG 594
             E N +LR  F V        +Y GEW + +KHG G  V    G  Y+GE++ G+  G G   +  P + N   +Y GE+ N +  G G+  Y     Y G W+ + R G+G++ Y NGDVYEGE+ K K HG+G++ L NG+ Y G W  G K+G G     D G +YEG
Sbjct:   11 AEKNGVLRTVFSV-----TGDQYTGEWLQNRKHGKGTQVWKRAGVVYDGEWRFGKRDGFGTLSKQSPPSNNYEVIYSGEWKNDKKEGFGMEVYSPSSLYEGQWVEHERSGSGRMFYPNGDVYEGEWLKDKPHGQGVLTLANGNRYEGSWKDGRKNGPGCFFYLDKGQLYEG 176          

HSP 2 Score: 89.7373 bits (221), Expect = 1.056e-19
Identity = 56/174 (32.18%), Postives = 89/174 (51.15%), Query Frame = 1
Query:  184 QKGKKHGHGRFVMA-DGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE------YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHI-CGILYTGLWEQNL 681
            +K +K+G  R V +  G  Y GE+      GKG + W + G VY GE+  G+  G G +   +         Y G+W ++ +EG G   Y+   +YEG++ +H+  G G M   NG +Y G W+    HG G +T+ +G+ YEG +     +G G  F++  G LY G W  ++
Sbjct:    9 KKAEKNGVLRTVFSVTGDQYTGEWLQNRKHGKGTQVWKRAGVVYDGEWRFGKRDGFGTLSKQSPPSNNYEVIYSGEWKNDKKEGFGMEVYSPSSLYEGQWVEHERSGSGRMFYPNGDVYEGEWLKDKPHGQGVLTLANGNRYEGSWKDGRKNGPGCFFYLDKGQLYEGFWVDDV 182          

HSP 3 Score: 57.7658 bits (138), Expect = 6.770e-9
Identity = 39/118 (33.05%), Postives = 57/118 (48.31%), Query Frame = 1
Query:  352 IMFYGNGDEYHGDWISNSREGNG-QLTYANGDVYEGEFYKHKIHGEGIMRLMNGS------IYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLP 684
             +F   GD+Y G+W+ N + G G Q+    G VY+GE+   K  G G +   +        IYSG W    K G G       S+YEGQ+  +   G G +F+  G +Y G W ++ P
Sbjct:   19 TVFSVTGDQYTGEWLQNRKHGKGTQVWKRAGVVYDGEWRFGKRDGFGTLSKQSPPSNNYEVIYSGEWKNDKKEGFGMEVYSPSSLYEGQWVEHERSGSGRMFYPNGDVYEGEWLKDKP 136          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Cavefish
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 b [Source:ZFIN;Acc:ZDB-GENE-080929-1])

HSP 1 Score: 91.6633 bits (226), Expect = 6.773e-19
Identity = 58/182 (31.87%), Postives = 88/182 (48.35%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFK----YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGE----RYWPKTGNVYRGEFHNGEMTGTGIM-FYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSG----YWICGNKHGHGKMTMPDGSVYEGQFN 603
            Y G     L +G+G Y+  NK       Y+G W+ GK HG G F  A G  YEG FQ+    G G     +    + +V+ G++ + + TG G+      G++Y G W  + R+GNG +    G  YEG F  +K+ G G++   + + + G     W      G G +TMP+G   EG F+
Sbjct: 1104 YTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSDDWTLS---GKGTLTMPNGDYIEGSFS 1282          

HSP 2 Score: 81.2629 bits (199), Expect = 1.316e-15
Identity = 53/166 (31.93%), Postives = 75/166 (45.18%), Query Frame = 1
Query:  169 YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWP----KTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREG-----NGQLTYANGDVYEGEFYKHKIHGEGIM-RLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLF 636
            YEG W  GK +G G     DG  Y G F+NG   G G+   P       + Y+G + +G+M G G   Y  G+ Y G +  N R G     +G+L   +  V+ G++   K  G G+   +  G  Y G W    + G+G +    G  YEG F+ N   G G L 
Sbjct: 1081 YEGRWLAGKPNGRGVLKWPDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLL 1246          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Cavefish
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 b [Source:ZFIN;Acc:ZDB-GENE-080929-1])

HSP 1 Score: 91.6633 bits (226), Expect = 6.782e-19
Identity = 58/182 (31.87%), Postives = 88/182 (48.35%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFK----YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGE----RYWPKTGNVYRGEFHNGEMTGTGIM-FYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSG----YWICGNKHGHGKMTMPDGSVYEGQFN 603
            Y G     L +G+G Y+  NK       Y+G W+ GK HG G F  A G  YEG FQ+    G G     +    + +V+ G++ + + TG G+      G++Y G W  + R+GNG +    G  YEG F  +K+ G G++   + + + G     W      G G +TMP+G   EG F+
Sbjct: 1113 YTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLLSEDDTTFEGDFSDDWTLS---GKGTLTMPNGDYIEGSFS 1291          

HSP 2 Score: 81.2629 bits (199), Expect = 1.318e-15
Identity = 53/166 (31.93%), Postives = 75/166 (45.18%), Query Frame = 1
Query:  169 YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWP----KTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREG-----NGQLTYANGDVYEGEFYKHKIHGEGIM-RLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLF 636
            YEG W  GK +G G     DG  Y G F+NG   G G+   P       + Y+G + +G+M G G   Y  G+ Y G +  N R G     +G+L   +  V+ G++   K  G G+   +  G  Y G W    + G+G +    G  YEG F+ N   G G L 
Sbjct: 1090 YEGRWLAGKPNGRGVLKWPDGRMYTGTFKNGLEDGYGDYIVPNKNLNKSDHYQGHWKDGKMHGFGNFRYATGELYEGSFQDNMRHGHGMLRSGKLNSTSPSVFIGQWLHDKKTGYGVFDDITRGEKYMGLWQEDLRQGNGVIVTQFGLYYEGAFSNNKMMGTGVLL 1255          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Sea Lamprey
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 85.5001 bits (210), Expect = 5.756e-18
Identity = 67/227 (29.52%), Postives = 99/227 (43.61%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE--YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLM------NGSI----------------------------YSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTG 663
            N Y G     +  G G YV+ +   ++EG++      GHG +   DGS Y G  +NG   G+G     K    Y G ++  E  G GI++Y    E  Y G+W  N R G G   Y +G++YEG++  ++ HGEG MR +      NG                              Y G W  G++HG G+     G+ Y+G++  +  HG GT     G +Y G
Sbjct:    6 NVYSGSFCNNMMHGKGKYVWADGV-EFEGDFWLNAMVGHGTYQWPDGSKYTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGTFTCKSGQIYEG 231          

HSP 2 Score: 75.0998 bits (183), Expect = 1.375e-14
Identity = 56/181 (30.94%), Postives = 77/181 (42.54%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADG--SFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGN-GDEYHGDWISNSREGNGQLTYANGDV----------YEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQF 600
            Y G     +R G G       F  Y G W   ++HG G     +   S+Y GE+ +    G G R +P +GN+Y G++ N E  G G M +     EY+G W     +G G   +    V          Y GE+     HG+G     +G+ Y G W    KHG G  T   G +YEG F
Sbjct:   54 YTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYP-SGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGTFTCKSGQIYEGSF 233          

HSP 3 Score: 71.633 bits (174), Expect = 1.344e-13
Identity = 54/156 (34.62%), Postives = 76/156 (48.72%), Query Frame = 1
Query:  229 GSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDV-YEGEFYKHKIHGEGIMRL--MNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGIL-YTGLWEQNLP 684
            G+ Y G F N  + GKG+  W   G  + G+F    M G G   + +G +Y G+  +  R G G LT +   V Y G +Y  + HG+GI+       S Y G W    +HG G    P G++YEGQ+  N  HGEG +  I  +  Y G W+   P
Sbjct:    5 GNVYSGSFCNNMMHGKGKYVWAD-GVEFEGDFWLNAMVGHGTYQWPDGSKYTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKP 159          

HSP 4 Score: 68.5514 bits (166), Expect = 1.452e-12
Identity = 43/139 (30.94%), Postives = 72/139 (51.80%), Query Frame = 1
Query:   79 KDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHG--RFVMADGSFYEGEFQNGEICGKGERYW--PKTG-------NVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEF 462
            + R ++Y GE +  +R G+G+  Y +    YEG+W   ++HG G  R++      Y G++++G+  G+G   W   + G       N Y GE+  G   G G   Y +G +Y G+W  + + G+G  T  +G +YEG F
Sbjct:   97 EKRESWYCGEWHHNMRHGWGIRRYPSGNI-YEGQWLNNERHGEGCMRWITLMQE-YNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGTFTCKSGQIYEGSF 233          

HSP 5 Score: 50.8322 bits (120), Expect = 5.677e-7
Identity = 34/111 (30.63%), Postives = 58/111 (52.25%), Query Frame = 1
Query:  358 FYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSV-YEGQFNYNLFHGEGTLFH--ICGILYTGLWEQNL 681
            FY  G+ Y G + +N   G G+  +A+G  +EG+F+ + + G G  +  +GS Y+G    G +HG G +T+    V Y G +  +  HG+G +++       Y G W  N+
Sbjct:    1 FYEGGNVYSGSFCNNMMHGKGKYVWADGVEFEGDFWLNAMVGHGTYQWPDGSKYTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNM 111          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Sea Lamprey
Match: RSPH10B2 (radial spoke head 10 homolog B2 [Source:HGNC Symbol;Acc:HGNC:34385])

HSP 1 Score: 81.6481 bits (200), Expect = 1.065e-16
Identity = 58/190 (30.53%), Postives = 83/190 (43.68%), Query Frame = 1
Query:  202 GHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE--YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLM------NGSI----------------------------YSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTG 663
            GHG +   DGS Y G  +NG   G+G     K    Y G ++  E  G GI++Y    E  Y G+W  N R G G   Y +G++YEG++  ++ HGEG MR +      NG                              Y G W  G++HG G+     G+ Y+G++  +  HG GT     G +Y G
Sbjct:    3 GHGTYQWPDGSKYTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGTFTCKSGQIYEG 192          

HSP 2 Score: 77.0258 bits (188), Expect = 2.583e-15
Identity = 50/157 (31.85%), Postives = 73/157 (46.50%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFK-YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTG----------TGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWI 534
            Y G      R G G+  Y+ K    Y GEW    +HG G      G+ YEG++ N E  G+G   W      Y G++ +G+  G           G   Y   +EYHG+W +  R G G+  YA+G  Y+GE+ + + HG G     +G IY G ++
Sbjct:   39 YSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYPSGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGTFTCKSGQIYEGSFV 195          

HSP 3 Score: 77.0258 bits (188), Expect = 2.653e-15
Identity = 56/181 (30.94%), Postives = 77/181 (42.54%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADG--SFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGN-GDEYHGDWISNSREGNGQLTYANGDV----------YEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQF 600
            Y G     +R G G       F  Y G W   ++HG G     +   S+Y GE+ +    G G R +P +GN+Y G++ N E  G G M +     EY+G W     +G G   +    V          Y GE+     HG+G     +G+ Y G W    KHG G  T   G +YEG F
Sbjct:   15 YTGNVENGVRHGQGTLTVSKPFVSYSGHWYASERHGKGIVYYDEKRESWYCGEWHHNMRHGWGIRRYP-SGNIYEGQWLNNERHGEGCMRWITLMQEYNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGTFTCKSGQIYEGSF 194          

HSP 4 Score: 70.0922 bits (170), Expect = 4.411e-13
Identity = 43/139 (30.94%), Postives = 72/139 (51.80%), Query Frame = 1
Query:   79 KDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHG--RFVMADGSFYEGEFQNGEICGKGERYW--PKTG-------NVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEF 462
            + R ++Y GE +  +R G+G+  Y +    YEG+W   ++HG G  R++      Y G++++G+  G+G   W   + G       N Y GE+  G   G G   Y +G +Y G+W  + + G+G  T  +G +YEG F
Sbjct:   58 EKRESWYCGEWHHNMRHGWGIRRYPSGNI-YEGQWLNNERHGEGCMRWITLMQE-YNGQWKHGKPDGRGAHKWLVKRVGCSQYPMCNEYHGEWAAGHRHGQGEFLYASGAQYKGEWRQDRKHGSGTFTCKSGQIYEGSF 194          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Sea Lamprey
Match: morn2 (MORN repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE-060825-230])

HSP 1 Score: 62.003 bits (149), Expect = 4.664e-12
Identity = 35/88 (39.77%), Postives = 48/88 (54.55%), Query Frame = 1
Query:  430 YANGDVYEGEFYKHK-----IHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQN 678
            + NGD YEGE+ K +      HG G  R   GSIY+G W      G G++    G+VYEG F+ N++HG GT     G+ Y G ++ N
Sbjct:    4 FPNGDKYEGEYSKSEDGVMERHGTGTHRSAGGSIYTGQWKYDKMEGTGRLVYLSGAVYEGSFHDNMYHGTGTYTWPSGVKYIGSFQHN 91          

HSP 2 Score: 55.0694 bits (131), Expect = 1.285e-9
Identity = 35/120 (29.17%), Postives = 57/120 (47.50%), Query Frame = 1
Query:  367 NGDEYHGDWISNS-----REGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKL 711
            NGD+Y G++  +      R G G    A G +Y G++   K+ G G +  ++G++Y G +     HG G  T P G  Y G F +N   GEG      G  +TG++ +     +  K+ +
Sbjct:    6 NGDKYEGEYSKSEDGVMERHGTGTHRSAGGSIYTGQWKYDKMEGTGRLVYLSGAVYEGSFHDNMYHGTGTYTWPSGVKYIGSFQHNKLKGEGMFTDTEGQEWTGMFHKKAAPGLKLKLNM 125          

HSP 3 Score: 47.7506 bits (112), Expect = 4.787e-7
Identity = 37/106 (34.91%), Postives = 54/106 (50.94%), Query Frame = 1
Query:  166 KYEGEWQKGK-----KHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYK 468
            KYEGE+ K +     +HG G    A GS Y G+++  ++ G G R    +G VY G FH+    GTG   + +G +Y G +  N  +G G  T   G  + G F+K
Sbjct:    9 KYEGEYSKSEDGVMERHGTGTHRSAGGSIYTGQWKYDKMEGTG-RLVYLSGAVYEGSFHDNMYHGTGTYTWPSGVKYIGSFQHNKLKGEGMFTDTEGQEWTGMFHK 113          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003398.1 (pep scaffold:Pmarinus_7.0:GL476560:333524:339285:-1 gene:ENSPMAG00000003108.1 transcript:ENSPMAT00000003398.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 8.447e-12
Identity = 33/93 (35.48%), Postives = 55/93 (59.14%), Query Frame = 1
Query:  166 KYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGD 444
            +Y+GEW++G++HG G+    DG+ Y G+F+NG   G G   +P  G+ + GEF  G+  G G+    +G  + G++ +   EG G LT+ +G 
Sbjct:   15 EYQGEWKEGRRHGLGQLRFTDGTHYLGQFENGLFSGCGVLAFPD-GSRFEGEFSQGKFHGVGVFSRSDGMMFEGEFKNGHVEGYGLLTFPDGS 106          

HSP 2 Score: 58.5362 bits (140), Expect = 1.150e-10
Identity = 33/95 (34.74%), Postives = 52/95 (54.74%), Query Frame = 1
Query:  298 TGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGS 582
            TG  Y+GE+  G   G G + + +G  Y G + +    G G L + +G  +EGEF + K HG G+    +G ++ G +  G+  G+G +T PDGS
Sbjct:   12 TGEEYQGEWKEGRRHGLGQLRFTDGTHYLGQFENGLFSGCGVLAFPDGSRFEGEFSQGKFHGVGVFSRSDGMMFEGEFKNGHVEGYGLLTFPDGS 106          

HSP 3 Score: 58.151 bits (139), Expect = 1.449e-10
Identity = 31/83 (37.35%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  415 NGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTG 663
             G  TYA G+ Y+GE+ + + HG G +R  +G+ Y G +  G   G G +  PDGS +EG+F+   FHG G      G+++ G
Sbjct:    5 KGSFTYATGEEYQGEWKEGRRHGLGQLRFTDGTHYLGQFENGLFSGCGVLAFPDGSRFEGEFSQGKFHGVGVFSRSDGMMFEG 87          

HSP 4 Score: 57.7658 bits (138), Expect = 2.485e-10
Identity = 33/95 (34.74%), Postives = 47/95 (49.47%), Query Frame = 1
Query:  349 GIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTL 633
            G   Y  G+EY G+W    R G GQL + +G  Y G+F      G G++   +GS + G +  G  HG G  +  DG ++EG+F      G G L
Sbjct:    6 GSFTYATGEEYQGEWKEGRRHGLGQLRFTDGTHYLGQFENGLFSGCGVLAFPDGSRFEGEFSQGKFHGVGVFSRSDGMMFEGEFKNGHVEGYGLL 100          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002910.1 (pep scaffold:Pmarinus_7.0:GL480350:1227:27530:-1 gene:ENSPMAG00000002661.1 transcript:ENSPMAT00000002910.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 6.876e-11
Identity = 43/147 (29.25%), Postives = 73/147 (49.66%), Query Frame = 1
Query:  169 YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKG----ERYWPKTGNVYRGEFHNGEMTGTGIM-FYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICG-NKHGHGKMTMPDGSVYE 591
            Y G+W+  + HG G    A+G  YEG F NG   G G      +   + ++Y G++ N    G G+      G++Y G W+++ R GNG +    G  YE  F  +++ G+G++   + + Y G +      +G G +T+P+G   E
Sbjct:   27 YCGQWKAARMHGQGAIRYANGDVYEGGFSNGARHGHGVLRSGSHTSTSSSLYIGQWANDCKCGYGVFDDITRGEKYMGMWMNDCRHGNGVVVSQFGLYYECVFSSNRMVGQGVLLSEDDTRYEGEFTADLALNGKGVLTLPNGDAIE 173          

HSP 2 Score: 55.8398 bits (133), Expect = 9.814e-9
Identity = 36/122 (29.51%), Postives = 47/122 (38.52%), Query Frame = 1
Query:  358 FYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMR-----------------------------LMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLF 636
              G  D Y G W +    G G + YANGDVYEG F     HG G++R                             +  G  Y G W+   +HG+G +    G  YE  F+ N   G+G L 
Sbjct:   20 LLGKDDVYCGQWKAARMHGQGAIRYANGDVYEGGFSNGARHGHGVLRSGSHTSTSSSLYIGQWANDCKCGYGVFDDITRGEKYMGMWMNDCRHGNGVVVSQFGLYYECVFSSNRMVGQGVLL 141          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Nematostella
Match: EDO34090 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQC6])

HSP 1 Score: 218.779 bits (556), Expect = 4.644e-68
Identity = 106/222 (47.75%), Postives = 147/222 (66.22%), Query Frame = 1
Query:  130 GFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTD-ILDCFQGHTFQISLTLITDNGEIV 792
            GFGV+ YENKFF+YEGEW KGKKHGHG+ +MADGSFYEG+F +GEI G G RYW  + N Y G+F  GE+ G G+M YG+G +Y G+W++N REG+G+L   +G VYEG F++HK HGEG M  +NG +Y G W+   + GHG +   DG++Y GQ+  + FHGEG++ H  G+ Y GLW    P      +++    + +  QG  F   +   T NG+++
Sbjct:    1 GFGVFNYENKFFRYEGEWSKGKKHGHGKLLMADGSFYEGQFMDGEIQGHGFRYWASSRNEYTGQFVKGELHGNGVMKYGDGSQYEGEWMNNRREGSGKLMEKDGSVYEGSFHEHKKHGEGKMIYINGDVYEGDWVKDLRQGHGIIKQEDGTLYAGQWWGDEFHGEGSMVHCSGMAYEGLWVSGRPEMEAVVLRIVGKPVAEVAQGRPFGFEVECCTANGDVI 222          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Nematostella
Match: EDO49962 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RER8])

HSP 1 Score: 111.694 bits (278), Expect = 2.122e-27
Identity = 77/236 (32.63%), Postives = 116/236 (49.15%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENK------FFK----------------YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDILDC 732
            ++Y GE  +    G GV V+ NK      F K                Y G W K KKHG GR VMA+G  Y G F N  +CG+GE  + K G +Y+G++ N +  G G     +G  Y G+W ++  +G G++ Y N D Y+G ++++   G+GI     G IY G +    +HGHG M   DGS Y+G++  +     G++ ++ G  Y G WE      +  +  L  + L C
Sbjct:   60 DYYHGEWREGEMHGKGVIVFNNKDSLEGVFVKGDIQSEGTLKCTNGLTYVGTWHKSKKHGKGRLVMANGDTYNGNFVNDRMCGEGEMLYAKNGALYKGQWENSQRHGVGTYEAPDGTMYEGEWSADHIQGRGRMIYPNKDSYDGSWFRNMRFGKGIYCFHEG-IYEGQFEYDLRHGHGLMRYNDGSEYDGEWQNDQVKSLGSMDYLGGATYDGPWE------LDRRHGLGRETLKC 288          

HSP 2 Score: 96.6709 bits (239), Expect = 2.912e-22
Identity = 65/210 (30.95%), Postives = 104/210 (49.52%), Query Frame = 1
Query:  124 REGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE-----------------------YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEG-IMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNL 681
            R G GV  ++N+  +YEG ++  +++G G      G  Y+GE+ + + CG G   +P  G+ Y GE+  GEM G G++ + N D                        Y G W  + + G G+L  ANGD Y G F   ++ GEG ++   NG++Y G W    +HG G    PDG++YEG+++ +   G G + +     Y G W +N+
Sbjct:    2 RHGHGVLAWQNRT-RYEGHFEDNERNGIGVLTYNTGEKYDGEWLDDKQCGIGTLKYP-NGDYYHGEWREGEMHGKGVIVFNNKDSLEGVFVKGDIQSEGTLKCTNGLTYVGTWHKSKKHGKGRLVMANGDTYNGNFVNDRMCGEGEMLYAKNGALYKGQWENSQRHGVGTYEAPDGTMYEGEWSADHIQGRGRMIYPNKDSYDGSWFRNM 209          

HSP 3 Score: 96.2857 bits (238), Expect = 4.908e-22
Identity = 62/170 (36.47%), Postives = 85/170 (50.00%), Query Frame = 1
Query:  193 KKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEG-TLFHICGILYTGLWEQNLPCKIPT 699
            ++HGHG     + + YEG F++ E  G G   +  TG  Y GE+ + +  G G + Y NGD YHG+W      G G + + N D  EG F K  I  EG ++  NG  Y G W    KHG G++ M +G  Y G F  +   GEG  L+   G LY G WE +    + T
Sbjct:    1 QRHGHGVLAWQNRTRYEGHFEDNERNGIGVLTY-NTGEKYDGEWLDDKQCGIGTLKYPNGDYYHGEWREGEMHGKGVIVFNNKDSLEGVFVKGDIQSEGTLKCTNGLTYVGTWHKSKKHGKGRLVMANGDTYNGNFVNDRMCGEGEMLYAKNGALYKGQWENSQRHGVGT 169          

HSP 4 Score: 65.855 bits (159), Expect = 7.937e-12
Identity = 48/170 (28.24%), Postives = 76/170 (44.71%), Query Frame = 1
Query:  112 NKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGN---------------------VYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHG 558
            ++M  EG  +Y      +K  G+W+  ++HG G +   DG+ YEGE+    I G+G   +P   +                     +Y G+F      G G+M Y +G EY G+W ++  +  G + Y  G  Y+G +   + HG G   L  G++Y G W    K G G
Sbjct:  138 DRMCGEGEMLYAKNGALYK--GQWENSQRHGVGTYEAPDGTMYEGEWSADHIQGRGRMIYPNKDSYDGSWFRNMRFGKGIYCFHEGIYEGQFEYDLRHGHGLMRYNDGSEYDGEWQNDQVKSLGSMDYLGGATYDGPWELDRRHGLGRETLKCGTVYEGRWKEDRKCGEG 305          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Nematostella
Match: EDO30644 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T074])

HSP 1 Score: 93.9745 bits (232), Expect = 2.850e-20
Identity = 66/198 (33.33%), Postives = 98/198 (49.49%), Query Frame = 1
Query:  127 EGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGN-GDEYH-GDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMN-GSIYSGYWICGNKHGHGKMT----------MPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNL 681
            EG G YV+ N    YEG+++     G G +   DGS YEGE ++G   G+G+        VY GE+ +G+  G G++ Y   G  Y+ G W++N R G  +  Y  G+VYEG++  +  HG+G M   +    Y G W  G +HGHG+ +           P  + Y+G +   L HG G   +  G  Y G W  N+
Sbjct:   99 EGSGKYVWVNGII-YEGDFKNNVIDGKGLYTWTDGSTYEGEVESGLRHGQGDYSCSNLPAVYSGEWRHGKRHGRGVLKYDREGHSYYDGHWLNNMRHGYARRVYKGGNVYEGDWKDNLRHGDGSMHWYDRDQRYQGQWEYGVQHGHGEHSWFLRRIAGSQYPLRNYYKGNWVNGLRHGYGVFTYASGAKYVGEWASNM 295          

HSP 2 Score: 87.4261 bits (215), Expect = 3.618e-18
Identity = 59/173 (34.10%), Postives = 90/173 (52.02%), Query Frame = 1
Query:  169 YEGEW-QKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYAN-GDVYEGEFYKHKIHGEGIMRL--MNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTL-FHICGILYTGLWE 672
            YEG+  ++G  HG G      G  Y G F NG++ G G+  W   G +Y G+F N  + G G+  + +G  Y G+  S  R G G  + +N   VY GE+   K HG G+++      S Y G+W+   +HG+ +     G+VYEG +  NL HG+G++ ++     Y G WE
Sbjct:   65 YEGDKDERGFFHGTGTASFQGGHVYSGSFVNGKMEGSGKYVW-VNGIIYEGDFKNNVIDGKGLYTWTDGSTYEGEVESGLRHGQGDYSCSNLPAVYSGEWRHGKRHGRGVLKYDREGHSYYDGHWLNNMRHGYARRVYKGGNVYEGDWKDNLRHGDGSMHWYDRDQRYQGQWE 236          

HSP 3 Score: 84.7297 bits (208), Expect = 2.287e-17
Identity = 66/223 (29.60%), Postives = 98/223 (43.95%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHG--RFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIM-FYGNGDEYHGDWISNSREGNGQLT----------YANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDIL 726
            Y GE    LR G G Y   N    Y GEW+ GK+HG G  ++     S+Y+G + N    G   R + K GNVY G++ +    G G M +Y     Y G W    + G+G+ +          Y   + Y+G +     HG G+    +G+ Y G W    KHG GK    +G V+EG F  +    +   F+  G+    +    +P +  T M+  T  L
Sbjct:  135 YEGEVESGLRHGQGDYSCSNLPAVYSGEWRHGKRHGRGVLKYDREGHSYYDGHWLNNMRHGYARRVY-KGGNVYEGDWKDNLRHGDGSMHWYDRDQRYQGQWEYGVQHGHGEHSWFLRRIAGSQYPLRNYYKGNWVNGLRHGYGVFTYASGAKYVGEWASNMKHGKGKYIFKNGQVFEGTFEQDHML-DFPDFYPSGMTTPDIASAGIPLRPSTPMRAATPFL 355          

HSP 4 Score: 75.8702 bits (185), Expect = 1.634e-14
Identity = 49/130 (37.69%), Postives = 68/130 (52.31%), Query Frame = 1
Query:  301 GNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMN-GSIYSGYWICGNKHGHG--KMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNL 681
            G+VY G F NG+M G+G   + NG  Y GD+ +N  +G G  T+ +G  YEGE      HG+G     N  ++YSG W  G +HG G  K      S Y+G +  N+ HG     +  G +Y G W+ NL
Sbjct:   86 GHVYSGSFVNGKMEGSGKYVWVNGIIYEGDFKNNVIDGKGLYTWTDGSTYEGEVESGLRHGQGDYSCSNLPAVYSGEWRHGKRHGRGVLKYDREGHSYYDGHWLNNMRHGYARRVYKGGNVYEGDWKDNL 215          

HSP 5 Score: 66.2402 bits (160), Expect = 1.550e-11
Identity = 43/138 (31.16%), Postives = 68/138 (49.28%), Query Frame = 1
Query:   79 KDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMAD-GSFYEGEFQNGEICGKGERYW---------PKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEF 462
            ++ +++Y G     +R G+   VY+     YEG+W+   +HG G     D    Y+G+++ G   G GE  W             N Y+G + NG   G G+  Y +G +Y G+W SN + G G+  + NG V+EG F
Sbjct:  178 REGHSYYDGHWLNNMRHGYARRVYKGGNV-YEGDWKDNLRHGDGSMHWYDRDQRYQGQWEYGVQHGHGEHSWFLRRIAGSQYPLRNYYKGNWVNGLRHGYGVFTYASGAKYVGEWASNMKHGKGKYIFKNGQVFEGTF 314          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Nematostella
Match: EDO41170 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S530])

HSP 1 Score: 86.2705 bits (212), Expect = 3.191e-19
Identity = 62/194 (31.96%), Postives = 94/194 (48.45%), Query Frame = 1
Query:  115 KMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADG-SFYEGEFQNGEICGKGERYWPKTG---NVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLP 684
            K  ++G    VY     +Y GEW   KK+G G        + Y+G++++   CG G     +T     +Y G + N +  G G  FY   + Y G+W ++ R G G++ Y++G VYEGE+Y  K +GEG++RL N + Y G W  G KHG G                 +F+     F   G  YTG+W  ++P
Sbjct:   20 KAQKKGVHHTVYSVNGDQYTGEWNGNKKNGKGTMQWKKSKAIYDGDWKDDRRCGYGTYSIKETSGYRKIYSGGWKNDKRHGYGTNFYSPTEYYEGEWYADKRSGWGRMYYSDGAVYEGEWYDDKQNGEGMLRLANENRYEGEWKDGLKHGKG-----------------IFY-----FLDKGQKYTGVWALDIP 191          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Nematostella
Match: EDO27248 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T9S6])

HSP 1 Score: 83.1889 bits (204), Expect = 8.903e-19
Identity = 63/171 (36.84%), Postives = 89/171 (52.05%), Query Frame = 1
Query:  166 KYEGEWQK-GKKHGHGRFVMADGSFYEGEFQNGEICGKG-ERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMN-GSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLW 669
            +YEGE    G++HG+G  ++  G  Y+G + NG+  G G  R+  K    Y GE+ N +  GTG M++ +G  Y G+W +N R GNG+  YANGD YEGE+   + HG+G+    + G  Y G W  G   G G++  P   VY G F      G G      G   TG +
Sbjct:    2 RYEGERNNDGERHGYGTALLTSGDTYQGLYNNGKRHGYGIYRFVNKA--RYEGEYVNNKREGTGTMYFPDGSMYKGEWKNNKRSGNGKYKYANGDTYEGEWKLGRRHGQGVYVYKDLGISYKGNWAFGKFDGKGQVHTPY-YVYNGTFYDETPRGPGRFSFKTGCAQTGQY 169          

HSP 2 Score: 74.7146 bits (182), Expect = 8.134e-16
Identity = 55/169 (32.54%), Postives = 84/169 (49.70%), Query Frame = 1
Query:  238 YEGEFQN-GEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPD-GSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDILDCFQ 738
            YEGE  N GE  G G      +G+ Y+G ++NG+  G GI  + N   Y G++++N REG G + + +G +Y+GE+  +K  G G  +  NG  Y G W  G +HG G     D G  Y+G + +  F G+G + H    +Y G +    P + P +    T      Q
Sbjct:    3 YEGERNNDGERHGYGTALLT-SGDTYQGLYNNGKRHGYGIYRFVNKARYEGEYVNNKREGTGTMYFPDGSMYKGEWKNNKRSGNGKYKYANGDTYEGEWKLGRRHGQGVYVYKDLGISYKGNWAFGKFDGKGQV-HTPYYVYNGTFYDETP-RGPGRFSFKTGCAQTGQ 168          

HSP 3 Score: 60.8474 bits (146), Expect = 4.781e-11
Identity = 50/144 (34.72%), Postives = 70/144 (48.61%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGN-GDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSG 525
            Y G  N   R G+G+Y + NK  +YEGE+   K+ G G     DGS Y+GE++N +  G G +Y    G+ Y GE+  G   G G+  Y + G  Y G+W     +G GQ+ +    VY G FY     G G      G   +G
Sbjct:   27 YQGLYNNGKRHGYGIYRFVNKA-RYEGEYVNNKREGTGTMYFPDGSMYKGEWKNNKRSGNG-KYKYANGDTYEGEWKLGRRHGQGVYVYKDLGISYKGNWAFGKFDGKGQV-HTPYYVYNGTFYDETPRGPGRFSFKTGCAQTG 167          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Medaka
Match: rsph10b (radial spoke head 10 homolog B [Source:NCBI gene;Acc:101169070])

HSP 1 Score: 106.301 bits (264), Expect = 9.701e-24
Identity = 70/205 (34.15%), Postives = 102/205 (49.76%), Query Frame = 1
Query:  103 GETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE--YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMN-GSIYSGYWICGNKHGHGK---MTMPDGSV-------YEGQFNYNLFHGEGTLFHICGILYTGLWEQN 678
            G  +K L +G+G++ + N    YEGE+ +    G G+F   DGS Y G   +G   G G     KTG  Y GE+  G+  G G ++Y       Y GDW+ N+REG G+  Y +G+ Y GE+  +  HGEG M+ +  G  Y G W  G +HG G    +   +G +       Y G F +   HG G  ++  G +Y G W+ N
Sbjct:   60 GMFSKGLMDGWGIFTHLNGL-TYEGEFVRNIPTGRGKFTWPDGSTYSGGVVDGVRHGFGTHICAKTGVSYTGEWSRGKRHGEGTVYYNESKTSWYKGDWVMNNREGRGERCYVSGNTYSGEWKCNVRHGEGTMKWLKLGQQYVGRWCEGLQHGKGTHVWIQKREGGLQYFQNNQYHGDFLHGQRHGHGVFYYAGGAIYEGEWKNN 263          

HSP 2 Score: 90.1225 bits (222), Expect = 1.366e-18
Identity = 58/181 (32.04%), Postives = 87/181 (48.07%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGR--FVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGN-GDEYHGDWISNSREGNGQ----------LTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQF 600
            Y G     +R GFG ++       Y GEW +GK+HG G   +  +  S+Y+G++      G+GER +  +GN Y GE+      G G M +   G +Y G W    + G G           L Y   + Y G+F   + HG G+     G+IY G W    KHG GK+T  +G +++G+F
Sbjct:  104 YSGGVVDGVRHGFGTHICAKTGVSYTGEWSRGKRHGEGTVYYNESKTSWYKGDWVMNNREGRGERCYV-SGNTYSGEWKCNVRHGEGTMKWLKLGQQYVGRWCEGLQHGKGTHVWIQKREGGLQYFQNNQYHGDFLHGQRHGHGVFYYAGGAIYEGEWKNNKKHGQGKLTSKNGHIFKGEF 283          

HSP 3 Score: 80.1073 bits (196), Expect = 2.089e-15
Identity = 57/173 (32.95%), Postives = 81/173 (46.82%), Query Frame = 1
Query:   97 YIGETNKMLREGFG-VYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGI----------MFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGS 582
            Y GE ++  R G G VY  E+K   Y+G+W    + G G      G+ Y GE++     G+G   W K G  Y G +  G   G G           + Y   ++YHGD++   R G+G   YA G +YEGE+  +K HG+G +   NG I+ G      +    KM  PD S
Sbjct:  128 YTGEWSRGKRHGEGTVYYNESKTSWYKGDWVMNNREGRGERCYVSGNTYSGEWKCNVRHGEGTMKWLKLGQQYVGRWCEGLQHGKGTHVWIQKREGGLQYFQNNQYHGDFLHGQRHGHGVFYYAGGAIYEGEWKNNKKHGQGKLTSKNGHIFKG------EFKDDKMMTPDLS 294          

HSP 4 Score: 69.707 bits (169), Expect = 4.380e-12
Identity = 51/167 (30.54%), Postives = 77/167 (46.11%), Query Frame = 1
Query:  262 EICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYE------------------------GEFYKHKIHGEGIMRL--MNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHI-CGILYTGLWEQNL 681
            E  G+ E Y+ + G+V++G F  G M G GI  + NG  Y G+++ N   G G+ T+ +G  Y                         GE+ + K HGEG +       S Y G W+  N+ G G+     G+ Y G++  N+ HGEGT+  +  G  Y G W + L
Sbjct:   43 EFSGQREVYF-EGGHVHKGMFSKGLMDGWGIFTHLNGLTYEGEFVRNIPTGRGKFTWPDGSTYSGGVVDGVRHGFGTHICAKTGVSYTGEWSRGKRHGEGTVYYNESKTSWYKGDWVMNNREGRGERCYVSGNTYSGEWKCNVRHGEGTMKWLKLGQQYVGRWCEGL 208          

HSP 5 Score: 60.8474 bits (146), Expect = 2.313e-9
Identity = 41/129 (31.78%), Postives = 60/129 (46.51%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKI 477
            N Y GE    +R G G   +     +Y G W +G +HG G  V       EG  Q  +             N Y G+F +G+  G G+ +Y  G  Y G+W +N + G G+LT  NG +++GEF   K+
Sbjct:  174 NTYSGEWKCNVRHGEGTMKWLKLGQQYVGRWCEGLQHGKGTHVWIQKR--EGGLQYFQ------------NNQYHGDFLHGQRHGHGVFYYAGGAIYEGEWKNNKKHGQGKLTSKNGHIFKGEFKDDKM 288          

HSP 6 Score: 50.8322 bits (120), Expect = 3.243e-6
Identity = 35/110 (31.82%), Postives = 55/110 (50.00%), Query Frame = 1
Query:  313 RGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGK-MTMPDGSVYEGQFNYNLFHGEGTLFH 639
            R E    E +G   +++  G  + G +     +G G  T+ NG  YEGEF ++   G G     +GS YSG  + G +HG G  +    G  Y G+++    HGEGT+++
Sbjct:   36 REESCEDEFSGQREVYFEGGHVHKGMFSKGLMDGWGIFTHLNGLTYEGEFVRNIPTGRGKFTWPDGSTYSGGVVDGVRHGFGTHICAKTGVSYTGEWSRGKRHGEGTVYY 145          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Medaka
Match: RSPH1 (radial spoke head component 1 [Source:NCBI gene;Acc:101161589])

HSP 1 Score: 93.5893 bits (231), Expect = 1.378e-21
Identity = 64/175 (36.57%), Postives = 93/175 (53.14%), Query Frame = 1
Query:  157 KFFKYEGEWQ-KGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRL-MNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQ 675
            K   YEG+    G++HG GR V+ +G  Y+G +++GE  G+G  Y  K G VY GE+      G G  +Y +G +Y G W+++ R+G G  TY+NGD YEGE+  H  HG+G+    + GS Y G W+ GN    G+    +   Y+G F  N   G G      G    G ++Q
Sbjct:   15 KLANYEGDRNDAGQRHGVGRSVLPNGDIYQGRYEHGERHGQGT-YRFKNGAVYVGEYFKNLKHGQGTFYYPDGSKYEGSWVNDLRQGRGVYTYSNGDTYEGEWLNHFRHGQGVYHYHLTGSKYVGSWVNGNMQSAGEYIHAN-HKYQGNFFNNKPDGPGKFVFDFGCEQHGEFQQ 187          

HSP 2 Score: 52.7582 bits (125), Expect = 1.700e-7
Identity = 28/68 (41.18%), Postives = 38/68 (55.88%), Query Frame = 1
Query:  478 HGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNL 681
            HG G   L NG IY G +  G +HG G     +G+VY G++  NL HG+GT ++  G  Y G W  +L
Sbjct:   30 HGVGRSVLPNGDIYQGRYEHGERHGQGTYRFKNGAVYVGEYFKNLKHGQGTFYYPDGSKYEGSWVNDL 97          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Medaka
Match: ENSORLT00000030376.1 (MORN repeat containing 3 [Source:NCBI gene;Acc:101168558])

HSP 1 Score: 90.5077 bits (223), Expect = 3.506e-20
Identity = 62/153 (40.52%), Postives = 85/153 (55.56%), Query Frame = 1
Query:  121 LREGFGVYVYENKFFKYEGEWQKGKKHGHG-RFVMADGSFYEGEFQNGEICGKGERYW--PKT-GNVYR--GEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGK 561
            L+ GF   V+     KY GEWQ  +KHG G +     G+ Y GE++ G+  G G  Y   P++ G V++  GE+ NG+  G GI FY N   Y G+W    R G G++ + N D+YEGE+   K HGEG +   NGS Y G W  G ++G GK
Sbjct:   22 LKSGFRHTVFSLNGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGK 174          

HSP 2 Score: 85.8853 bits (211), Expect = 1.526e-18
Identity = 56/155 (36.13%), Postives = 83/155 (53.55%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSF------YEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEG-IMRLMNGSIYSGYWICG 540
            Y GE     + G G+ +++N    Y GEW+ GK  G+G + + D         Y+GE++NG+  G G  ++  T  VY GE+  G+ +G G MF+ N D Y G+W+ +   G G+L YANG  YEG +   K +G G       G +Y G+WI G
Sbjct:   38 YTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNTA-VYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDG 191          

HSP 3 Score: 67.0106 bits (162), Expect = 3.627e-12
Identity = 47/149 (31.54%), Postives = 68/149 (45.64%), Query Frame = 1
Query:  226 DGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWE 672
            +G  Y GE+Q+    G G + W  TG VY GE+  G+  G G  +  + +     W                  Y+GE+   K HG GI    N ++Y G W  G + G GKM   +  +YEG++  +  HGEG L +  G  Y G W+
Sbjct:   34 NGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVW-----------------KYDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWK 165          

HSP 4 Score: 51.9878 bits (123), Expect = 4.882e-7
Identity = 32/80 (40.00%), Postives = 50/80 (62.50%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGE 336
            Y GE ++  R G G   +EN+   YEGEW   K+HG G+ + A+GS+YEG +++G+  G G+ Y  + G +Y G + +GE
Sbjct:  114 YEGEWSEGQRSGRGKMFHENRDI-YEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDGE 192          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Medaka
Match: ENSORLT00000010654.2 (MORN repeat containing 3 [Source:NCBI gene;Acc:101168558])

HSP 1 Score: 89.7373 bits (221), Expect = 6.446e-20
Identity = 61/153 (39.87%), Postives = 82/153 (53.59%), Query Frame = 1
Query:  121 LREGFGVYVYENKFFKYEGEWQKGKKHGHG-RFVMADGSFYEGEFQNGEICGKGERYW--PKTGNV---YRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGK 561
            L+ GF   V+     KY GEWQ  +KHG G +     G+ Y GE++ G+  G G  Y   P++      Y GE+ NG+  G GI FY N   Y G+W    R G G++ + N D+YEGE+   K HGEG +   NGS Y G W  G ++G GK
Sbjct:   16 LKSGFRHTVFSLNGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGK 168          

HSP 2 Score: 85.5001 bits (210), Expect = 1.935e-18
Identity = 56/155 (36.13%), Postives = 83/155 (53.55%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSF------YEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEG-IMRLMNGSIYSGYWICG 540
            Y GE     + G G+ +++N    Y GEW+ GK  G+G + + D         Y+GE++NG+  G G  ++  T  VY GE+  G+ +G G MF+ N D Y G+W+ +   G G+L YANG  YEG +   K +G G       G +Y G+WI G
Sbjct:   32 YTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVWKYDGEWKNGKKHGYGIYFYNNTA-VYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDG 185          

HSP 3 Score: 65.855 bits (159), Expect = 8.580e-12
Identity = 47/149 (31.54%), Postives = 68/149 (45.64%), Query Frame = 1
Query:  226 DGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWE 672
            +G  Y GE+Q+    G G + W  TG VY GE+  G+  G G  +  + +     W                  Y+GE+   K HG GI    N ++Y G W  G + G GKM   +  +YEG++  +  HGEG L +  G  Y G W+
Sbjct:   28 NGDKYTGEWQDNRKHGIGIQMWKNTGAVYNGEWRFGKYDGYGTYYVLDPESKGYVW-----------------KYDGEWKNGKKHGYGIYFYNNTAVYEGEWSEGQRSGRGKMFHENRDIYEGEWMCDKEHGEGKLLYANGSWYEGSWK 159          

HSP 4 Score: 51.6026 bits (122), Expect = 5.802e-7
Identity = 32/80 (40.00%), Postives = 50/80 (62.50%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGE 336
            Y GE ++  R G G   +EN+   YEGEW   K+HG G+ + A+GS+YEG +++G+  G G+ Y  + G +Y G + +GE
Sbjct:  108 YEGEWSEGQRSGRGKMFHENRDI-YEGEWMCDKEHGEGKLLYANGSWYEGSWKDGKRNGSGKCYNSEKGLLYVGFWIDGE 186          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Medaka
Match: als2b (alsin Rho guanine nucleotide exchange factor ALS2 [Source:NCBI gene;Acc:101169837])

HSP 1 Score: 77.411 bits (189), Expect = 2.194e-14
Identity = 55/184 (29.89%), Postives = 86/184 (46.74%), Query Frame = 1
Query:   91 NFYIGETNKMLREGFGVYVYENKFFK----YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPK----TGNVYRGEFHNGEMTGTGIM-FYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSG----YWICGNKHGHGKMTMPDGSVYEGQFN 603
              Y G     L +GFG ++  NK       Y+G W+ GK HG G +  A G  Y+G FQ+G   G G     K    + +V+ G++   + TG G+      G+++ G W  + R+G G +    G  YEG F  +K+ G G++   + + Y G     W      G G +T+ +G   EG F+
Sbjct:  936 RIYTGTFKNGLEDGFGEFLAPNKPLNKNDCYQGHWKDGKMHGPGTYRYASGEVYDGSFQDGVRHGHGMLRSGKLNTSSPSVFIGQWLQDKKTGYGVFDDITKGEKFMGMWQDHLRQGTGVVVTQFGLYYEGAFKDNKMAGTGVLVSEDDTTYEGDFSDDWTLS---GKGVLTLANGDYLEGSFS 1116          

HSP 2 Score: 77.0258 bits (188), Expect = 2.921e-14
Identity = 53/166 (31.93%), Postives = 75/166 (45.18%), Query Frame = 1
Query:  169 YEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWP----KTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREG-----NGQLTYANGDVYEGEFYKHKIHGEGIM-RLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLF 636
            YEG W  GK HG G     DG  Y G F+NG   G GE   P       + Y+G + +G+M G G   Y +G+ Y G +    R G     +G+L  ++  V+ G++ + K  G G+   +  G  + G W    + G G +    G  YEG F  N   G G L 
Sbjct:  915 YEGGWVSGKPHGSGVLKWPDGRIYTGTFKNGLEDGFGEFLAPNKPLNKNDCYQGHWKDGKMHGPGTYRYASGEVYDGSFQDGVRHGHGMLRSGKLNTSSPSVFIGQWLQDKKTGYGVFDDITKGEKFMGMWQDHLRQGTGVVVTQFGLYYEGAFKDNKMAGTGVLV 1080          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Planmine SMEST
Match: SMESG000012434.1 (SMESG000012434.1)

HSP 1 Score: 1017.3 bits (2629), Expect = 0.000e+0
Identity = 495/499 (99.20%), Postives = 496/499 (99.40%), Query Frame = 1
Query:   70 MEIKDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVNDNNSLFELIEQIDSKPVETTYYPVLLVPLTDKPPQWVQSLENASHNKIRLPHLFESDESNSQPPESTETDLTDAPLCNDLCLDPVIQETKNGSVDFINLFIQQPKLAAGSCLQSDSASEFINSASVSATSIKQNKDQSLSEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQIHPFPISDSLQESTSKNSQKRRRSEYGVKNQIVELPNISQITNXXXXXXXDLF 1566
            MEIKDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGN+YRGEFHNGEMTGTG MFYGNGDEYHGDW SNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVNDNNSLFELIEQIDSKPVETTYYPVLLVPLTDKPPQWVQSLENASHNKIRLPHLFESDESNSQPPESTETDLTDAPLCNDLCLDPVIQETKNGSVDFINLFIQQPK AAGSCLQSDSASEFINSASVSATSIKQNKDQSLSEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQIHPFPISDSLQESTSKNSQKRRRSEYGVKNQIVELPNISQITNSSSRRSSDLF
Sbjct:    1 MEIKDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNMYRGEFHNGEMTGTGFMFYGNGDEYHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVNDNNSLFELIEQIDSKPVETTYYPVLLVPLTDKPPQWVQSLENASHNKIRLPHLFESDESNSQPPESTETDLTDAPLCNDLCLDPVIQETKNGSVDFINLFIQQPKFAAGSCLQSDSASEFINSASVSATSIKQNKDQSLSEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQIHPFPISDSLQESTSKNSQKRRRSEYGVKNQIVELPNISQITNSSSRRSSDLF 499          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Planmine SMEST
Match: SMESG000012434.1 (SMESG000012434.1)

HSP 1 Score: 983.786 bits (2542), Expect = 0.000e+0
Identity = 479/483 (99.17%), Postives = 480/483 (99.38%), Query Frame = 1
Query:  118 MLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVNDNNSLFELIEQIDSKPVETTYYPVLLVPLTDKPPQWVQSLENASHNKIRLPHLFESDESNSQPPESTETDLTDAPLCNDLCLDPVIQETKNGSVDFINLFIQQPKLAAGSCLQSDSASEFINSASVSATSIKQNKDQSLSEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQIHPFPISDSLQESTSKNSQKRRRSEYGVKNQIVELPNISQITNXXXXXXXDLF 1566
            MLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGN+YRGEFHNGEMTGTG MFYGNGDEYHGDW SNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVNDNNSLFELIEQIDSKPVETTYYPVLLVPLTDKPPQWVQSLENASHNKIRLPHLFESDESNSQPPESTETDLTDAPLCNDLCLDPVIQETKNGSVDFINLFIQQPK AAGSCLQSDSASEFINSASVSATSIKQNKDQSLSEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQIHPFPISDSLQESTSKNSQKRRRSEYGVKNQIVELPNISQITNSSSRRSSDLF
Sbjct:    1 MLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNMYRGEFHNGEMTGTGFMFYGNGDEYHGDWNSNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPCKIPTKMKLTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLRMTAGVKYQPVNDNNSLFELIEQIDSKPVETTYYPVLLVPLTDKPPQWVQSLENASHNKIRLPHLFESDESNSQPPESTETDLTDAPLCNDLCLDPVIQETKNGSVDFINLFIQQPKFAAGSCLQSDSASEFINSASVSATSIKQNKDQSLSEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQIHPFPISDSLQESTSKNSQKRRRSEYGVKNQIVELPNISQITNSSSRRSSDLF 483          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Planmine SMEST
Match: SMESG000014300.1 (SMESG000014300.1)

HSP 1 Score: 91.6633 bits (226), Expect = 4.705e-20
Identity = 63/177 (35.59%), Postives = 92/177 (51.98%), Query Frame = 1
Query:  175 GEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGI-MRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGT-LFHICGILYTGLWEQNLPCKIPT 699
            G  +K ++HG G+  + +G  YEG ++NG+  G G  Y  K G  Y GE+   +  G GI FY +G +Y G WI + R GNG+  Y NGD +EGE+  H  HG+G       GS Y G W  G  +G+G++   +   Y GQ+   + +G+G  +F       TG +       IPT
Sbjct:   23 GRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHG-TYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKGKYVFDHVKCQLTGEY-----APIPT 192          

HSP 2 Score: 77.7962 bits (190), Expect = 1.671e-15
Identity = 47/129 (36.43%), Postives = 71/129 (55.04%), Query Frame = 1
Query:  307 VYRGEFHNG-----EMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFH-ICGILYTGLWEQ 675
            +Y GE+  G     E  G+G     NGD Y G + +  R G+G   + NG  Y GE+ ++K HG GI    +GS Y G WI   ++G+GK    +G  +EG++  +L HG+GT F+   G  Y G+W++
Sbjct:   15 LYLGEYEGGRNEKDERHGSGKATLPNGDTYEGLYENGKRHGHGTYRFKNGARYIGEYSENKKHGHGIFFYPDGSKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKE 143          

HSP 3 Score: 58.151 bits (139), Expect = 5.090e-9
Identity = 35/112 (31.25%), Postives = 64/112 (57.14%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTY 432
            YIGE ++  + G G++ Y +   KYEG W   +++G+G++   +G ++EGE++N    G+G  ++  TG+ Y G +  G+M G G + + N  +Y G W +    G G+  +
Sbjct:   67 YIGEYSENKKHGHGIFFYPDG-SKYEGSWIDDQRNGNGKYYYINGDYFEGEWKNHLRHGQGTYFYDATGSKYVGVWKEGKMNGYGELVHSN-HKYVGQWKNGVMNGKGKYVF 176          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Planmine SMEST
Match: SMESG000039153.1 (SMESG000039153.1)

HSP 1 Score: 93.9745 bits (232), Expect = 5.622e-20
Identity = 57/142 (40.14%), Postives = 76/142 (53.52%), Query Frame = 1
Query:   82 DRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMAD-GSFYEGEFQNGEICGKGERYWP---------KTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKI 477
            D+ +FY G+ NK + EGFG   Y +    YEGEW +GK+HGHG     D    Y G+++NG   G G+  W             NVY GEF NG+  G G   Y +G  Y G W+SN + G G+  + NG +YEGEF   +I
Sbjct:  203 DQRSFYEGDWNKNVIEGFGFRQYRSGN-TYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKSGKGEFVFKNGRIYEGEFEDDRI 343          

HSP 2 Score: 89.3521 bits (220), Expect = 1.387e-18
Identity = 60/181 (33.15%), Postives = 92/181 (50.83%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHG--RFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIM-FYGNGDEYHGDWISNSREGNGQLT----------YANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQF 600
            Y G+    +R G G+Y + +    Y G W  G +HG+G   +     SFYEG++    I G G R + ++GN Y GE++ G+  G G+M +    ++Y G W +  + G GQ            Y+  +VYEGEF   K HG G     +G+ Y G+W+   K G G+    +G +YEG+F
Sbjct:  160 YEGDVVHGVRHGRGIYKHPSGMM-YSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQY-RSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSNRKSGKGEFVFKNGRIYEGEF 338          

HSP 3 Score: 85.8853 bits (211), Expect = 2.098e-17
Identity = 66/196 (33.67%), Postives = 98/196 (50.00%), Query Frame = 1
Query:  130 GFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE--YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMN-GSIYSGYWICGNKHGHGK----MTMPDGS------VYEGQFNYNLFHGEGTLFHICGILYTGLWEQN 678
            G G + +++    YEG++   +  G G++   DGS YEG+  +G   G+G    P +G +Y G + NG   G G + Y       Y GDW  N  EG G   Y +G+ YEGE+Y+ K HG G+M+ ++    Y+G W  G ++G G+    +   +GS      VYEG+F     HG G   +  G  Y G W  N
Sbjct:  124 GTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDVVHGVRHGRGIYKHP-SGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQGKRHGHGVMKWLDRNEQYTGQWRNGIQNGMGQHIWYVQRINGSQYSLRNVYEGEFCNGKRHGWGCFTYPSGAHYEGFWVSN 318          

HSP 4 Score: 62.7734 bits (151), Expect = 3.906e-10
Identity = 45/148 (30.41%), Postives = 67/148 (45.27%), Query Frame = 1
Query:  310 YRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDV-YEGEFYKHKI-----------------------HGEGIMRLMNGSIYSGYWICGNKHGHGKMT--MPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQ 675
            Y GE  NG   G G  F+ NG+ + G +   +  G G+  + + +  YEG+F  ++I                       HG GI +  +G +YSG W+ GN+HG+G +       S YEG +N N+  G G   +  G  Y G W Q
Sbjct:   90 YDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDVVHGVRHGRGIYKHPSGMMYSGLWVNGNRHGNGTVNYDTDQRSFYEGDWNKNVIEGFGFRQYRSGNTYEGEWYQ 237          

HSP 5 Score: 57.7658 bits (138), Expect = 1.557e-8
Identity = 34/100 (34.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  373 DEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMN-GSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLW 669
            + Y G+  +   EG G   + NG+++EG F +  +HG G     +  + Y G ++     G GK T  DGS YEG   + + HG G   H  G++Y+GLW
Sbjct:   88 ERYDGEKSNGRFEGLGTAFFVNGNIFEGMFCEGTMHGTGRFNWKSTNTSYEGDFLYNEISGKGKYTWQDGSSYEGDVVHGVRHGRGIYKHPSGMMYSGLW 187          
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Planmine SMEST
Match: SMESG000011788.1 (SMESG000011788.1)

HSP 1 Score: 80.4925 bits (197), Expect = 8.653e-17
Identity = 55/181 (30.39%), Postives = 92/181 (50.83%), Query Frame = 1
Query:  157 KFFKYEGEWQKGKKHGHGRFVMADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDE-----YHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHI-CGILYTGLWEQNL 681
            K F Y+ + +  KK  H      +G  Y G++ N    G+G  Y    G +Y G++ + +  G G++    G +     Y G W +N R G G+  Y++ + YEGE+Y+ K +G G M   +G++Y G W      G G +   +G+ YEGQ+   + +GEG  ++I  G +  G+W  N+
Sbjct:   16 KPFWYDADKKANKKGLHHTIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYIDKGQMLKGIWVNNV 196          

HSP 2 Score: 70.4774 bits (171), Expect = 1.912e-13
Identity = 48/161 (29.81%), Postives = 77/161 (47.83%), Query Frame = 1
Query:   97 YIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFVMADGS-FYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGNGDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIYSGYWICGNKHGHGKMTMPD 576
            Y+G+ N  ++ G G     ++   YEG+W+  KK+G G   +  G   YE                     +Y G + N    G G  +Y + + Y G+W    R G G++  A+G+VYEGE+   ++ G+G++R  NG+ Y G W  G ++G GK    D
Sbjct:   43 YVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYE--------------------KIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMCGQGMLRNKNGNRYEGQWKNGMRNGEGKYYYID 183          

HSP 3 Score: 60.077 bits (144), Expect = 6.343e-10
Identity = 37/118 (31.36%), Postives = 61/118 (51.69%), Query Frame = 1
Query:  352 IMFYGNGDEYHGDWISNSREGNGQLTY-ANGDVYEGEFYKHKIHGEGIMRLMNGS-----IYSGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLWEQNLPC 687
             +++ NGD+Y GDW +N + G G +   + G +YEG++   K +G G++ +  G      IYSG W    +HG G+        YEG++     +G G ++   G +Y G WE +  C
Sbjct:   34 TIYFVNGDQYVGDWNNNMKNGRGTMYLTSQGLMYEGDWKDDKKNGFGVLSVKKGKDTYEKIYSGGWKNNLRHGFGENWYSSNEFYEGEWYEGKRNGWGRMYEADGNVYEGEWENDQMC 151          
The following BLAST results are available for this feature:
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MORN13.968e-7031.76MORN repeat containing 1 [Source:HGNC Symbol;Acc:H... [more]
MORN19.236e-6443.70MORN repeat containing 1 [Source:HGNC Symbol;Acc:H... [more]
MORN16.538e-2643.08MORN repeat containing 1 [Source:HGNC Symbol;Acc:H... [more]
AC084018.34.528e-2334.86MORN repeat-containing protein 3 [Source:UniProtK... [more]
AC084018.34.528e-2334.86MORN repeat-containing protein 3 [Source:UniProtK... [more]
back to top
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
jph-12.187e-629.08JunctoPHilin [Source:UniProtKB/TrEMBL;Acc:Q22667][more]
back to top
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG304293.291e-1433.58gene:FBgn0050429 transcript:FBtr0072450[more]
CG54585.874e-1432.86gene:FBgn0032478 transcript:FBtr0080437[more]
CG144903.738e-1332.87gene:FBgn0034281 transcript:FBtr0086801[more]
Als26.962e-1130.64gene:FBgn0037116 transcript:FBtr0078462[more]
jp3.237e-632.17gene:FBgn0032129 transcript:FBtr0079861[more]
back to top
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsph10b1.187e-2635.27radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
rsph10b1.311e-2635.27radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
morn35.156e-2239.49MORN repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
morn36.619e-2239.49MORN repeat containing 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
als2b1.045e-1831.19alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
back to top
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
igf27.372e-9034.24insulin like growth factor 2 [Source:Xenbase;Acc:X... [more]
igf21.872e-7743.77insulin like growth factor 2 [Source:Xenbase;Acc:X... [more]
igf21.926e-7040.14insulin like growth factor 2 [Source:Xenbase;Acc:X... [more]
igf25.090e-6145.07insulin like growth factor 2 [Source:Xenbase;Acc:X... [more]
igf28.605e-6046.83insulin like growth factor 2 [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Morn15.138e-6633.56MORN repeat containing 1 [Source:MGI Symbol;Acc:MG... [more]
Morn11.009e-5044.20MORN repeat containing 1 [Source:MGI Symbol;Acc:MG... [more]
Morn11.889e-3647.62MORN repeat containing 1 [Source:MGI Symbol;Acc:MG... [more]
Morn36.498e-2334.83MORN repeat containing 3 [Source:MGI Symbol;Acc:MG... [more]
Morn15.584e-2152.00MORN repeat containing 1 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5T089|MORN1_HUMAN1.906e-6931.76MORN repeat-containing protein 1 OS=Homo sapiens O... [more]
sp|Q641X6|MORN1_RAT4.270e-6634.53MORN repeat-containing protein 1 OS=Rattus norvegi... [more]
sp|Q8L796|PI5K2_ARATH4.926e-2837.65Phosphatidylinositol 4-phosphate 5-kinase 2 OS=Ara... [more]
sp|Q9SFB8|PI5K6_ARATH3.743e-2736.47Phosphatidylinositol 4-phosphate 5-kinase 6 OS=Ara... [more]
sp|Q56YP2|PI5K1_ARATH4.892e-2636.47Phosphatidylinositol 4-phosphate 5-kinase 1 OS=Ara... [more]
back to top
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|203395762.161e-8936.27tr|A0A1S3IRS7|A0A1S3IRS7_LINUN MORN repeat-contain... [more]
gnl|BL_ORD_ID|188955469.575e-8934.70tr|A0A1W5BI91|A0A1W5BI91_CIOIN MORN repeat-contain... [more]
gnl|BL_ORD_ID|189085919.260e-8733.98tr|A0A1W5BE42|A0A1W5BE42_CIOIN MORN repeat-contain... [more]
gnl|BL_ORD_ID|1764825961.158e-8634.24tr|F6PNK8|F6PNK8_XENTR Insulin like growth factor ... [more]
gnl|BL_ORD_ID|1738306871.370e-8234.33tr|A0A4W5N8Y7|A0A4W5N8Y7_9TELE MORN repeat contain... [more]
back to top
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsph10b6.114e-3036.84radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
rsph10b9.988e-3036.84radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
morn36.006e-2338.60MORN repeat-containing protein 3 [Source:NCBI gene... [more]
als2b6.773e-1931.87alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
als2b6.782e-1931.87alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
back to top
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RSPH10B25.756e-1829.52radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
RSPH10B21.065e-1630.53radial spoke head 10 homolog B2 [Source:HGNC Symbo... [more]
morn24.664e-1239.77MORN repeat containing 2 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000003398.18.447e-1235.48pep scaffold:Pmarinus_7.0:GL476560:333524:339285:-... [more]
ENSPMAT00000002910.16.876e-1129.25pep scaffold:Pmarinus_7.0:GL480350:1227:27530:-1 g... [more]
back to top
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO340904.644e-6847.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO499622.122e-2732.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO306442.850e-2033.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411703.191e-1931.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO272488.903e-1936.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rsph10b9.701e-2434.15radial spoke head 10 homolog B [Source:NCBI gene;A... [more]
RSPH11.378e-2136.57radial spoke head component 1 [Source:NCBI gene;Ac... [more]
ENSORLT00000030376.13.506e-2040.52MORN repeat containing 3 [Source:NCBI gene;Acc:101... [more]
ENSORLT00000010654.26.446e-2039.87MORN repeat containing 3 [Source:NCBI gene;Acc:101... [more]
als2b2.194e-1429.89alsin Rho guanine nucleotide exchange factor ALS2 ... [more]
back to top
BLAST of Phosphatidylinositol 4-phosphate 5-kinase 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012434.10.000e+099.20SMESG000012434.1[more]
SMESG000012434.10.000e+099.17SMESG000012434.1[more]
SMESG000014300.14.705e-2035.59SMESG000014300.1[more]
SMESG000039153.15.622e-2040.14SMESG000039153.1[more]
SMESG000011788.18.653e-1730.39SMESG000011788.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031461 ID=SMED30031461|Name=Phosphatidylinositol 4-phosphate 5-kinase 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1608bp
GTTACTTTTTGATTTTAAATTGCAAAATTAATTTTAATTATAAACTAAAA
TTATTATTCTTAACTGAAAATGGAAATCAAAGACAGAAATAACTTTTATA
TTGGCGAAACGAATAAAATGTTAAGAGAAGGATTTGGAGTTTATGTTTAT
GAAAATAAATTTTTCAAATATGAAGGCGAATGGCAAAAGGGCAAAAAGCA
TGGCCATGGACGTTTCGTGATGGCTGATGGTTCTTTTTATGAAGGTGAAT
TTCAAAATGGGGAAATTTGTGGAAAAGGAGAAAGGTATTGGCCGAAAACT
GGAAATGTGTACAGAGGAGAATTCCACAATGGTGAAATGACTGGTACTGG
TATCATGTTCTATGGAAATGGGGACGAATATCACGGCGATTGGATTTCCA
ACTCTCGAGAAGGAAACGGTCAGTTAACGTATGCAAATGGTGATGTGTAT
GAGGGAGAATTCTACAAGCATAAAATCCACGGTGAAGGAATCATGCGTCT
AATGAATGGGAGTATTTACTCGGGATATTGGATCTGTGGAAATAAACACG
GACACGGTAAAATGACGATGCCTGATGGATCAGTTTATGAGGGTCAATTC
AATTACAATTTATTTCATGGAGAAGGCACTTTATTCCATATTTGTGGAAT
ATTATACACTGGATTATGGGAACAGAATTTGCCCTGTAAAATCCCTACGA
AAATGAAATTGACCACAGATATCCTCGATTGCTTTCAAGGCCATACGTTT
CAAATATCATTAACTTTAATTACGGACAATGGTGAAATTGTACATGAAGA
ATCCGGGAGGCACCTAAGGATGACAGCTGGAGTGAAATATCAACCAGTCA
ACGACAATAATTCTCTATTTGAATTAATAGAGCAGATCGACTCTAAACCT
GTAGAAACTACTTACTACCCAGTTTTACTGGTTCCTTTAACTGATAAACC
TCCACAGTGGGTTCAAAGTCTTGAAAACGCCAGCCATAACAAAATTAGGC
TTCCTCATTTGTTTGAATCAGATGAAAGTAATTCGCAACCACCAGAGTCA
ACAGAGACAGATCTCACAGATGCTCCATTATGCAATGACCTGTGTTTAGA
TCCTGTCATTCAAGAAACTAAAAATGGTTCCGTTGATTTCATCAATCTGT
TCATTCAGCAGCCTAAATTGGCAGCTGGTTCATGTTTACAAAGTGACAGT
GCAAGTGAGTTCATCAATTCAGCTTCTGTCAGTGCCACGTCAATCAAACA
AAATAAAGACCAATCTTTATCAGAAAAAAACATCAAACATAAAGAACTTG
GAGATGAAAAGTTCACCAAGCTTGGTGAATATGTTTTGATCATTGAAGAT
ATTACCGAAAATCCATTCATGGAGAACAGACTGGAAACGTTGTACACCAA
AATTCAGATTCACCCGTTTCCCATATCGGATTCTTTGCAAGAATCAACTT
CTAAAAACTCTCAAAAAAGGAGAAGGTCTGAATATGGTGTTAAAAATCAG
ATTGTGGAATTACCCAATATATCGCAAATCACTAATTCAAGTTCTCGACG
ATCAAGTGACTTATTTTAAATGGATTTTCAGCGATGTTGTTTAAATATAT
TAGTTGCG
back to top

protein sequence of SMED30031461-orf-1

>SMED30031461-orf-1 ID=SMED30031461-orf-1|Name=SMED30031461-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=500bp
MEIKDRNNFYIGETNKMLREGFGVYVYENKFFKYEGEWQKGKKHGHGRFV
MADGSFYEGEFQNGEICGKGERYWPKTGNVYRGEFHNGEMTGTGIMFYGN
GDEYHGDWISNSREGNGQLTYANGDVYEGEFYKHKIHGEGIMRLMNGSIY
SGYWICGNKHGHGKMTMPDGSVYEGQFNYNLFHGEGTLFHICGILYTGLW
EQNLPCKIPTKMKLTTDILDCFQGHTFQISLTLITDNGEIVHEESGRHLR
MTAGVKYQPVNDNNSLFELIEQIDSKPVETTYYPVLLVPLTDKPPQWVQS
LENASHNKIRLPHLFESDESNSQPPESTETDLTDAPLCNDLCLDPVIQET
KNGSVDFINLFIQQPKLAAGSCLQSDSASEFINSASVSATSIKQNKDQSL
SEKNIKHKELGDEKFTKLGEYVLIIEDITENPFMENRLETLYTKIQIHPF
PISDSLQESTSKNSQKRRRSEYGVKNQIVELPNISQITNSSSRRSSDLF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0016301kinase activity
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000018Category 4 cell
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR003409MORN
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003409MORN motifSMARTSM00698morncoord: 125..146
e-value: 0.0032
score: 26.7
coord: 8..29
e-value: 6.8
score: 7.9
coord: 148..169
e-value: 0.55
score: 16.1
coord: 102..123
e-value: 0.054
score: 22.6
coord: 32..53
e-value: 2.0E-5
score: 34.1
coord: 79..100
e-value: 0.51
score: 16.3
coord: 171..192
e-value: 2.3
score: 11.4
coord: 55..76
e-value: 0.01
score: 25.0
IPR003409MORN motifPFAMPF02493MORNcoord: 18..29
e-value: 15.0
score: 5.7
coord: 34..55
e-value: 3.8E-7
score: 29.6
coord: 104..126
e-value: 0.0014
score: 18.4
coord: 173..188
e-value: 0.021
score: 14.7
coord: 150..172
e-value: 7.3E-5
score: 22.4
coord: 81..102
e-value: 0.11
score: 12.4
coord: 57..76
e-value: 4.8E-4
score: 19.9
coord: 127..148
e-value: 0.011
score: 15.6
NoneNo IPR availableGENE3DG3DSA:2.20.110.10coord: 11..78
e-value: 6.7E-10
score: 41.0
coord: 133..212
e-value: 1.2E-13
score: 53.1
coord: 79..132
e-value: 1.8E-9
score: 39.6
NoneNo IPR availablePANTHERPTHR43215:SF8coord: 100..203
NoneNo IPR availablePANTHERPTHR43215FAMILY NOT NAMEDcoord: 100..203
NoneNo IPR availablePANTHERPTHR43215:SF8coord: 6..155
NoneNo IPR availablePANTHERPTHR43215FAMILY NOT NAMEDcoord: 6..155
NoneNo IPR availableSUPERFAMILYSSF82185Histone H3 K4-specific methyltransferase SET7/9 N-terminal domaincoord: 78..203