14-3-3 protein beta/alpha

Overview
Name14-3-3 protein beta/alpha
Smed IDSMED30031447
Length (bp)936
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of 14-3-3 protein beta/alpha (SMED30031447) t-SNE clustered cells

Violin plots show distribution of expression levels for 14-3-3 protein beta/alpha (SMED30031447) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of 14-3-3 protein beta/alpha (SMED30031447) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for 14-3-3 protein beta/alpha (SMED30031447) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031447

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30031447SMESG000067831.1 SmedASXL_019649SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30031447SMESG000067831.1 dd_Smed_v4_5419_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30031447SMESG000067831.1 dd_Smed_v6_5419_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
gutSMED30031447SMESG000067831.1 SMED30031447smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30031447SMESG000067831.1 SMED30031447smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30031447SMESG000067831.1 dd_Smed_v4_5419_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30031447SMESG000067831.1 SMED30031447smed_20140614PMID:26711341
Duncan et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
X1 cellSMED30031447SMESG000067831.1 SMED30031447smed_20140614PMID:26711341
Duncan et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
testis primordiumSMED30031447SMESG000067831.1 Contig1446_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
neoblastSMED30031447SMESG000067831.1 SMED_04917_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30031447SMESG000067831.1 SMED_04917_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Human
Match: YWHAB (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [Source:HGNC Symbol;Acc:HGNC:12849])

HSP 1 Score: 313.923 bits (803), Expect = 2.373e-107
Identity = 172/242 (71.07%), Postives = 196/242 (80.99%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + ELV  AKLAEQAERYDDMA AMK VTE+G+ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+ NEKK +   EYR KIE EL DIC DVL+LL +YLIP AT  ES VF+LKM+GDY+RYL+EVASGD K   V  S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTSE   + G+A  G+N
Sbjct:    5 KSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 246          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Human
Match: YWHAB (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [Source:HGNC Symbol;Acc:HGNC:12849])

HSP 1 Score: 313.923 bits (803), Expect = 2.373e-107
Identity = 172/242 (71.07%), Postives = 196/242 (80.99%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + ELV  AKLAEQAERYDDMA AMK VTE+G+ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+ NEKK +   EYR KIE EL DIC DVL+LL +YLIP AT  ES VF+LKM+GDY+RYL+EVASGD K   V  S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTSE   + G+A  G+N
Sbjct:    5 KSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 246          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Human
Match: YWHAZ (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta [Source:HGNC Symbol;Acc:HGNC:12855])

HSP 1 Score: 305.834 bits (782), Expect = 4.157e-104
Identity = 167/240 (69.58%), Postives = 193/240 (80.42%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPG 856
            + ELV  AKLAEQAERYDDMA  MK VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRV+SSIEQKT+G EKK + + EYR KIE EL DIC DVL LL ++LIP A+ +ES VF+LKM+GDYYRYLAEVA+GD K   V +S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+   +  EA  G
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEG 242          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Human
Match: YWHAZ (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta [Source:HGNC Symbol;Acc:HGNC:12855])

HSP 1 Score: 305.834 bits (782), Expect = 4.157e-104
Identity = 167/240 (69.58%), Postives = 193/240 (80.42%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPG 856
            + ELV  AKLAEQAERYDDMA  MK VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRV+SSIEQKT+G EKK + + EYR KIE EL DIC DVL LL ++LIP A+ +ES VF+LKM+GDYYRYLAEVA+GD K   V +S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+   +  EA  G
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEG 242          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Human
Match: YWHAZ (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta [Source:HGNC Symbol;Acc:HGNC:12855])

HSP 1 Score: 305.834 bits (782), Expect = 4.157e-104
Identity = 167/240 (69.58%), Postives = 193/240 (80.42%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPG 856
            + ELV  AKLAEQAERYDDMA  MK VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRV+SSIEQKT+G EKK + + EYR KIE EL DIC DVL LL ++LIP A+ +ES VF+LKM+GDYYRYLAEVA+GD K   V +S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+   +  EA  G
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEG 242          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Celegans
Match: ftt-2 (14-3-3-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20655])

HSP 1 Score: 308.531 bits (789), Expect = 1.540e-105
Identity = 169/244 (69.26%), Postives = 202/244 (82.79%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSE---QDAEPGEADPGD 859
            +EELV+ AKLAEQAERYDDMA +MK+VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+G+EKK + + EYR K+EKEL DIC+DVL LL ++LIPKA  +ES VF+LKM+GDYYRYLAEVASGD ++  V+KS  +YQ A   A  +++ THPIRLGLALN+SVFFYEI N P++ACQLA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTS+    D +  E + G+
Sbjct:    5 KEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANETEGGN 248          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Celegans
Match: ftt-2 (14-3-3-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20655])

HSP 1 Score: 308.531 bits (789), Expect = 1.540e-105
Identity = 169/244 (69.26%), Postives = 202/244 (82.79%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSE---QDAEPGEADPGD 859
            +EELV+ AKLAEQAERYDDMA +MK+VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+G+EKK + + EYR K+EKEL DIC+DVL LL ++LIPKA  +ES VF+LKM+GDYYRYLAEVASGD ++  V+KS  +YQ A   A  +++ THPIRLGLALN+SVFFYEI N P++ACQLA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTS+    D +  E + G+
Sbjct:    5 KEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANETEGGN 248          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Celegans
Match: ftt-2 (14-3-3-like protein 2 [Source:UniProtKB/Swiss-Prot;Acc:Q20655])

HSP 1 Score: 308.531 bits (789), Expect = 1.540e-105
Identity = 169/244 (69.26%), Postives = 202/244 (82.79%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSE---QDAEPGEADPGD 859
            +EELV+ AKLAEQAERYDDMA +MK+VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+G+EKK + + EYR K+EKEL DIC+DVL LL ++LIPKA  +ES VF+LKM+GDYYRYLAEVASGD ++  V+KS  +YQ A   A  +++ THPIRLGLALN+SVFFYEI N P++ACQLA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTS+    D +  E + G+
Sbjct:    5 KEELVNRAKLAEQAERYDDMAASMKKVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQMAKEYREKVEKELRDICQDVLNLLDKFLIPKAGAAESKVFYLKMKGDYYRYLAEVASGDDRNSVVEKSQQSYQEAFDIAKDKMQPTHPIRLGLALNFSVFFYEILNAPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDAATDDTDANETEGGN 248          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Celegans
Match: par-5 (14-3-3-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41932])

HSP 1 Score: 305.064 bits (780), Expect = 3.733e-104
Identity = 170/235 (72.34%), Postives = 197/235 (83.83%), Query Frame = 2
Query:  140 EELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGE 844
            EELV  AKLAEQAERYDDMA AMK+VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+G+EKK + + EYR+K+E+EL+DIC+DVLKLL E+LI KA  +ES VF+LKM+GDYYRYLAEVAS D +   V+KS  AYQ A   A  +++ THPIRLGLALN+SVF+YEI N PE ACQLA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTS+  AE  E
Sbjct:    6 EELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASED-RAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQE 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Celegans
Match: par-5 (14-3-3-like protein 1 [Source:UniProtKB/Swiss-Prot;Acc:P41932])

HSP 1 Score: 305.064 bits (780), Expect = 3.733e-104
Identity = 170/235 (72.34%), Postives = 197/235 (83.83%), Query Frame = 2
Query:  140 EELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGE 844
            EELV  AKLAEQAERYDDMA AMK+VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+G+EKK + + EYR+K+E+EL+DIC+DVLKLL E+LI KA  +ES VF+LKM+GDYYRYLAEVAS D +   V+KS  AYQ A   A  +++ THPIRLGLALN+SVF+YEI N PE ACQLA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTS+  AE  E
Sbjct:    6 EELVQRAKLAEQAERYDDMAAAMKKVTEQGQELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGSEKKQQLAKEYRVKVEQELNDICQDVLKLLDEFLIVKAGAAESKVFYLKMKGDYYRYLAEVASED-RAAVVEKSQKAYQEALDIAKDKMQPTHPIRLGLALNFSVFYYEILNTPEHACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDVGAEDQE 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Fly
Match: 14-3-3zeta (gene:FBgn0004907 transcript:FBtr0088413)

HSP 1 Score: 296.204 bits (757), Expect = 1.112e-100
Identity = 166/245 (67.76%), Postives = 198/245 (80.82%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADP---GDN 862
            +EELV  AKLAEQ+ERYDDMA AMK VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+ + +K + + EYR ++EKEL +IC +VL LL +YLIPKA+  ES VF+LKM+GDYYRYLAEVA+GD ++  V  S +AYQ A   A  +++ THPIRLGLALN+SVF+YEI N P++ACQLA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTS  D +  EA+P   GDN
Sbjct:    6 KEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTS--DTQGDEAEPQEGGDN 248          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Fly
Match: 14-3-3zeta (gene:FBgn0004907 transcript:FBtr0088418)

HSP 1 Score: 296.204 bits (757), Expect = 1.112e-100
Identity = 166/245 (67.76%), Postives = 198/245 (80.82%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADP---GDN 862
            +EELV  AKLAEQ+ERYDDMA AMK VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+ + +K + + EYR ++EKEL +IC +VL LL +YLIPKA+  ES VF+LKM+GDYYRYLAEVA+GD ++  V  S +AYQ A   A  +++ THPIRLGLALN+SVF+YEI N P++ACQLA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTS  D +  EA+P   GDN
Sbjct:    6 KEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTS--DTQGDEAEPQEGGDN 248          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Fly
Match: 14-3-3zeta (gene:FBgn0004907 transcript:FBtr0088417)

HSP 1 Score: 296.204 bits (757), Expect = 1.112e-100
Identity = 166/245 (67.76%), Postives = 198/245 (80.82%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADP---GDN 862
            +EELV  AKLAEQ+ERYDDMA AMK VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+ + +K + + EYR ++EKEL +IC +VL LL +YLIPKA+  ES VF+LKM+GDYYRYLAEVA+GD ++  V  S +AYQ A   A  +++ THPIRLGLALN+SVF+YEI N P++ACQLA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTS  D +  EA+P   GDN
Sbjct:    6 KEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTS--DTQGDEAEPQEGGDN 248          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Fly
Match: 14-3-3zeta (gene:FBgn0004907 transcript:FBtr0088412)

HSP 1 Score: 296.204 bits (757), Expect = 1.112e-100
Identity = 166/245 (67.76%), Postives = 198/245 (80.82%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADP---GDN 862
            +EELV  AKLAEQ+ERYDDMA AMK VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+ + +K + + EYR ++EKEL +IC +VL LL +YLIPKA+  ES VF+LKM+GDYYRYLAEVA+GD ++  V  S +AYQ A   A  +++ THPIRLGLALN+SVF+YEI N P++ACQLA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTS  D +  EA+P   GDN
Sbjct:    6 KEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTS--DTQGDEAEPQEGGDN 248          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Fly
Match: 14-3-3zeta (gene:FBgn0004907 transcript:FBtr0100182)

HSP 1 Score: 296.204 bits (757), Expect = 1.112e-100
Identity = 166/245 (67.76%), Postives = 198/245 (80.82%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADP---GDN 862
            +EELV  AKLAEQ+ERYDDMA AMK VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+ + +K + + EYR ++EKEL +IC +VL LL +YLIPKA+  ES VF+LKM+GDYYRYLAEVA+GD ++  V  S +AYQ A   A  +++ THPIRLGLALN+SVF+YEI N P++ACQLA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTS  D +  EA+P   GDN
Sbjct:    6 KEELVQKAKLAEQSERYDDMAQAMKSVTETGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEASARKQQLAREYRERVEKELREICYEVLGLLDKYLIPKASNPESKVFYLKMKGDYYRYLAEVATGDARNTVVDDSKNAYQEAFDIAKTKMQPTHPIRLGLALNFSVFYYEILNSPDKACQLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTS--DTQGDEAEPQEGGDN 248          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Zebrafish
Match: ywhaba (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide a [Source:NCBI gene;Acc:323055])

HSP 1 Score: 311.227 bits (796), Expect = 2.116e-106
Identity = 169/242 (69.83%), Postives = 198/242 (81.82%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + +LV  AKLAEQAERYDDMA +MK VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+GNEKK + + EYR KIE EL +IC DVL LL +YLIP A+ +ES VF+LKM+GDYYRYL+EVASGD K   V+ S  AYQ+A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTSE   + G+A  G+N
Sbjct:    3 KSDLVQKAKLAEQAERYDDMAASMKAVTEGGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIEAELQEICNDVLGLLEKYLIPNASQAESKVFYLKMKGDYYRYLSEVASGDSKRTTVENSQKAYQDAFEISKKEMQPTHPIRLGLALNFSVFYYEILNTPEQACSLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 244          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Zebrafish
Match: ywhabb (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide b [Source:NCBI gene;Acc:406419])

HSP 1 Score: 303.138 bits (775), Expect = 2.940e-103
Identity = 169/237 (71.31%), Postives = 194/237 (81.86%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSE-QDAEPGE 844
            + +LV  AKLAEQAERYDDMA AMK VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+GNEKK + + EYR KIE EL DIC DVL LL +YLI  A+ +ES VF+LKM+GDYYRYL+EVASG+ K   V+ S  AYQ+A   + K+++ THPIRLGLALN+SVF+YEI N PE ACQLA++AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTSE Q  E GE
Sbjct:    3 KSDLVQKAKLAEQAERYDDMAAAMKAVTEGGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIETELQDICSDVLGLLEKYLIANASQAESKVFYLKMKGDYYRYLSEVASGESKATTVENSQKAYQDAFDISKKDMQPTHPIRLGLALNFSVFYYEILNSPENACQLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGEEAGE 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Zebrafish
Match: ywhaqb (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide b [Source:ZFIN;Acc:ZDB-GENE-030131-7135])

HSP 1 Score: 300.056 bits (767), Expect = 5.506e-102
Identity = 162/229 (70.74%), Postives = 188/229 (82.10%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSE 823
            R EL+  AKLAEQAERYDDMA  MK VTE G+ELSNEERNLLSVAYKNVVG+RRS+WRVISSIEQKT+GN+KK++   EYR K+E EL DIC DVL+LL +YLI  ++  ES VF+LKM+GDYYRYLAEVA+GD K   ++ S DAYQ A   +  E++ THPIRLGLALN+SVFFYEI N PE+AC LA+ AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+
Sbjct:    3 RTELIQKAKLAEQAERYDDMASCMKSVTEAGSELSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTEGNDKKLQMVKEYREKVESELRDICNDVLELLNKYLIENSSNPESKVFYLKMKGDYYRYLAEVAAGDDKKATIENSQDAYQKAFDISKTEMQPTHPIRLGLALNFSVFFYEILNSPEKACSLAKQAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSD 231          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Zebrafish
Match: ywhaqb (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide b [Source:ZFIN;Acc:ZDB-GENE-030131-7135])

HSP 1 Score: 300.056 bits (767), Expect = 5.506e-102
Identity = 162/229 (70.74%), Postives = 188/229 (82.10%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSE 823
            R EL+  AKLAEQAERYDDMA  MK VTE G+ELSNEERNLLSVAYKNVVG+RRS+WRVISSIEQKT+GN+KK++   EYR K+E EL DIC DVL+LL +YLI  ++  ES VF+LKM+GDYYRYLAEVA+GD K   ++ S DAYQ A   +  E++ THPIRLGLALN+SVFFYEI N PE+AC LA+ AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+
Sbjct:    3 RTELIQKAKLAEQAERYDDMASCMKSVTEAGSELSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTEGNDKKLQMVKEYREKVESELRDICNDVLELLNKYLIENSSNPESKVFYLKMKGDYYRYLAEVAAGDDKKATIENSQDAYQKAFDISKTEMQPTHPIRLGLALNFSVFFYEILNSPEKACSLAKQAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSD 231          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Zebrafish
Match: ywhabl (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide like [Source:ZFIN;Acc:ZDB-GENE-030131-448])

HSP 1 Score: 295.049 bits (754), Expect = 3.886e-100
Identity = 163/240 (67.92%), Postives = 195/240 (81.25%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPG 856
            + ELV  AKLAEQAERYDDMA AMK VTE   ELSNEERNLLSVAYKNVVG+RRSSWRV+SSIEQK +G++KK +   EYR KIEKEL +IC DVL LL +YLIPKAT +ES VF+LKM+GDY+RYLAEVA G+ K+  +  S +AY++A   +  E++ THPIRLGLALN+SVF+YEI N PE+AC+LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+   E  +A+ G
Sbjct:    3 KSELVQKAKLAEQAERYDDMAAAMKAVTEGDIELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKMEGSDKKQQMVKEYREKIEKELKEICNDVLVLLDKYLIPKATPAESRVFYLKMKGDYFRYLAEVAVGEEKNSIIGNSQEAYKDAFEISKAEMQPTHPIRLGLALNFSVFYYEILNSPEQACKLAKTAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDNQGEGEDAEEG 242          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Xenopus
Match: ywhab (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [Source:NCBI gene;Acc:496529])

HSP 1 Score: 307.76 bits (787), Expect = 6.017e-105
Identity = 168/242 (69.42%), Postives = 193/242 (79.75%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + ELV  AKL+EQAERYDDMA +MK VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+GN+K+ + + EYR K+E EL DIC+DVL LL +YL+P AT  ES VF+LKM+GDYYRYL+EVASGD K E V  S  AYQ A   +  E++ THPIRLGLALN+SVF+YEI N PE+AC LA+SAFD AIA +D L EESYKDSTLIMQLLRDNLTLWTSE   E  +    DN
Sbjct:    4 KSELVQKAKLSEQAERYDDMAASMKAVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNDKRQQMAREYREKVETELQDICKDVLGLLDKYLVPNATPPESKVFYLKMKGDYYRYLSEVASGDSKQETVTCSQQAYQEAFEISKSEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKSAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGEEADNAEADN 245          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Xenopus
Match: edf1 (endothelial differentiation related factor 1 [Source:Xenbase;Acc:XB-GENE-975205])

HSP 1 Score: 300.827 bits (769), Expect = 3.422e-102
Identity = 168/242 (69.42%), Postives = 195/242 (80.58%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + ELV  AKLAEQAERYDDMA  MKRVTE+G ELSNEERNLLSVAYKNVVG+RRSSWRV+SSIEQKT+G EKK + S EYR KIE EL +IC DVL LL ++LI  A+  ES VF+LKM+GDYYRYLAEVASGD K + V +S  AYQ+A   +  E++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS  D +  EA+ G+ 
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKRVTEEGGELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQEMSREYREKIEAELREICNDVLNLLDKFLIANASQPESKVFYLKMKGDYYRYLAEVASGDAKADIVAQSQKAYQDAFDISKTEMQPTHPIRLGLALNFSVFYYEILNCPEKACSLAKAAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTS--DTQGDEAEQGEG 242          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Xenopus
Match: ywhab (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [Source:NCBI gene;Acc:496529])

HSP 1 Score: 295.434 bits (755), Expect = 3.376e-100
Identity = 161/228 (70.61%), Postives = 187/228 (82.02%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTS 820
            + ELV  AKL+EQAERYDDMA +MK VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+GN+K+ + + EYR K+E EL DIC+DVL LL +YL+P AT  ES VF+LKM+GDYYRYL+EVASGD K E V  S  AYQ A   +  E++ THPIRLGLALN+SVF+YEI N PE+AC LA+SAFD AIA +D L EESYKDSTLIMQLLRDNLT+ T+
Sbjct:    3 KSELVQKAKLSEQAERYDDMAASMKAVTELGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNDKRQQMAREYREKVETELQDICKDVLGLLDKYLVPNATPPESKVFYLKMKGDYYRYLSEVASGDSKQETVTCSQQAYQEAFEISKSEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKSAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTVTTN 230          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Xenopus
Match: edf1 (endothelial differentiation related factor 1 [Source:Xenbase;Acc:XB-GENE-975205])

HSP 1 Score: 288.115 bits (736), Expect = 1.748e-97
Identity = 161/228 (70.61%), Postives = 186/228 (81.58%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTS 820
            + ELV  AKLAEQAERYDDMA  MKRVTE+G ELSNEERNLLSVAYKNVVG+RRSSWRV+SSIEQKT+G EKK + S EYR KIE EL +IC DVL LL ++LI  A+  ES VF+LKM+GDYYRYLAEVASGD K + V +S  AYQ+A   +  E++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLT  T+
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKRVTEEGGELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQEMSREYREKIEAELREICNDVLNLLDKFLIANASQPESKVFYLKMKGDYYRYLAEVASGDAKADIVAQSQKAYQDAFDISKTEMQPTHPIRLGLALNFSVFYYEILNCPEKACSLAKAAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTGITN 230          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Xenopus
Match: edf1 (endothelial differentiation related factor 1 [Source:Xenbase;Acc:XB-GENE-975205])

HSP 1 Score: 283.878 bits (725), Expect = 9.656e-96
Identity = 159/224 (70.98%), Postives = 181/224 (80.80%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLT 808
            + ELV  AKLAEQAERYDDMA  MKRVTE+G ELSNEERNLLSVAYKNVVG+RRSSWRV+SSIEQKT+G EKK + S EYR KIE EL +IC DVL LL ++LI  A+  ES VF+LKM+GDYYRYLAEVASGD K      S  AYQ+A   +  E++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLT
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKRVTEEGGELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQEMSREYREKIEAELREICNDVLNLLDKFLIANASQPESKVFYLKMKGDYYRYLAEVASGDAKAGGFCCSQKAYQDAFDISKTEMQPTHPIRLGLALNFSVFYYEILNCPEKACSLAKAAFDEAIAELDTLSEESYKDSTLIMQLLRDNLT 226          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Mouse
Match: Ywhab (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, beta polypeptide [Source:MGI Symbol;Acc:MGI:1891917])

HSP 1 Score: 309.686 bits (792), Expect = 9.067e-106
Identity = 170/242 (70.25%), Postives = 196/242 (80.99%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + ELV  AKLAEQAERYDDMA AMK VTE+G+ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+ NEKK +   EYR KIE EL DIC DVL+LL +YLI  AT +ES VF+LKM+GDY+RYL+EVASG+ K   V  S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTSE   + G+A  G+N
Sbjct:    5 KSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLILNATQAESKVFYLKMKGDYFRYLSEVASGENKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 246          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Mouse
Match: Ywhaz (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Source:MGI Symbol;Acc:MGI:109484])

HSP 1 Score: 305.064 bits (780), Expect = 5.803e-104
Identity = 167/240 (69.58%), Postives = 192/240 (80.00%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPG 856
            + ELV  AKLAEQAERYDDMA  MK VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRV+SSIEQKT+G EKK + + EYR KIE EL DIC DVL LL ++LIP A+  ES VF+LKM+GDYYRYLAEVA+GD K   V +S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+   +  EA  G
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEG 242          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Mouse
Match: Ywhaz (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Source:MGI Symbol;Acc:MGI:109484])

HSP 1 Score: 305.064 bits (780), Expect = 5.803e-104
Identity = 167/240 (69.58%), Postives = 192/240 (80.00%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPG 856
            + ELV  AKLAEQAERYDDMA  MK VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRV+SSIEQKT+G EKK + + EYR KIE EL DIC DVL LL ++LIP A+  ES VF+LKM+GDYYRYLAEVA+GD K   V +S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+   +  EA  G
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEG 242          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Mouse
Match: Ywhaz (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, zeta polypeptide [Source:MGI Symbol;Acc:MGI:109484])

HSP 1 Score: 305.064 bits (780), Expect = 5.803e-104
Identity = 167/240 (69.58%), Postives = 192/240 (80.00%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPG 856
            + ELV  AKLAEQAERYDDMA  MK VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRV+SSIEQKT+G EKK + + EYR KIE EL DIC DVL LL ++LIP A+  ES VF+LKM+GDYYRYLAEVA+GD K   V +S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+   +  EA  G
Sbjct:    3 KNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQPESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEG 242          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Mouse
Match: Ywhaq (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein theta [Source:MGI Symbol;Acc:MGI:891963])

HSP 1 Score: 287.345 bits (734), Expect = 5.564e-97
Identity = 158/240 (65.83%), Postives = 188/240 (78.33%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPG 856
            + EL+  AKLAEQAERYDDMA  MK VTE+G ELSNEERNLLSVAYKNVVG RRS+WRVISSIEQKTD ++KK++   +YR K+E EL  IC  VL+LL +YLI  AT  ES VF+LKM+GDY+RYLAEVA GD + + ++ S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE AC LA++AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTS+   E  +A  G
Sbjct:    3 KTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWRVISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLKMKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYEILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAAEG 242          
BLAST of 14-3-3 protein beta/alpha vs. UniProt/SwissProt
Match: sp|P68250|1433B_BOVIN (14-3-3 protein beta/alpha OS=Bos taurus OX=9913 GN=YWHAB PE=1 SV=2)

HSP 1 Score: 314.694 bits (805), Expect = 5.482e-107
Identity = 172/242 (71.07%), Postives = 196/242 (80.99%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + ELV  AKLAEQAERYDDMA AMK VTE+G+ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+ NEKK +   EYR KIE EL DIC DVL+LL +YLIP AT  ES VF+LKM+GDY+RYL+EVASGD K   V  S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTSE   + G+A  G+N
Sbjct:    5 KSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLQLLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 246          
BLAST of 14-3-3 protein beta/alpha vs. UniProt/SwissProt
Match: sp|A4K2U9|1433B_PONAB (14-3-3 protein beta/alpha OS=Pongo abelii OX=9601 GN=YWHAB PE=3 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 1.140e-106
Identity = 172/242 (71.07%), Postives = 196/242 (80.99%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + ELV  AKLAEQAERYDDMA AMK VTE+G+ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+ NEKK +   EYR KIE EL DIC DVL+LL +YLIP AT  ES VF+LKM+GDY+RYL+EVASGD K   V  S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTSE   + G+A  G+N
Sbjct:    5 KSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 246          
BLAST of 14-3-3 protein beta/alpha vs. UniProt/SwissProt
Match: sp|Q4R572|1433B_MACFA (14-3-3 protein beta/alpha OS=Macaca fascicularis OX=9541 GN=YWHAB PE=2 SV=3)

HSP 1 Score: 313.923 bits (803), Expect = 1.140e-106
Identity = 172/242 (71.07%), Postives = 196/242 (80.99%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + ELV  AKLAEQAERYDDMA AMK VTE+G+ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+ NEKK +   EYR KIE EL DIC DVL+LL +YLIP AT  ES VF+LKM+GDY+RYL+EVASGD K   V  S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTSE   + G+A  G+N
Sbjct:    5 KSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 246          
BLAST of 14-3-3 protein beta/alpha vs. UniProt/SwissProt
Match: sp|P31946|1433B_HUMAN (14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3)

HSP 1 Score: 313.923 bits (803), Expect = 1.140e-106
Identity = 172/242 (71.07%), Postives = 196/242 (80.99%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + ELV  AKLAEQAERYDDMA AMK VTE+G+ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+ NEKK +   EYR KIE EL DIC DVL+LL +YLIP AT  ES VF+LKM+GDY+RYL+EVASGD K   V  S  AYQ A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTSE   + G+A  G+N
Sbjct:    5 KSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFYLKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 246          
BLAST of 14-3-3 protein beta/alpha vs. UniProt/SwissProt
Match: sp|Q6UFZ9|143B1_ONCMY (14-3-3 protein beta/alpha-1 OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 4.401e-106
Identity = 170/242 (70.25%), Postives = 197/242 (81.40%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + +LV  AKLAEQAERYDDMA AMK VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+GNEKK + + EYR KIE EL DIC+DVL LL  YLI  AT +ES VF+LKM+GDYYRYL+EVASGD K   V+ S  AYQ A   + K+++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTSE   + G+A  G+N
Sbjct:    3 KNDLVQKAKLAEQAERYDDMAAAMKAVTEQGGELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIEAELQDICKDVLALLDNYLIANATQAESKVFYLKMKGDYYRYLSEVASGDSKKTTVENSQQAYQEAFDISKKDMQPTHPIRLGLALNFSVFYYEILNSPEQACSLAKAAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 244          
BLAST of 14-3-3 protein beta/alpha vs. TrEMBL
Match: A0A1V0M3W3 (14-3-3 alpha protein OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 462.611 bits (1189), Expect = 1.198e-162
Identity = 235/260 (90.38%), Postives = 251/260 (96.54%), Query Frame = 2
Query:   83 METDSGKISWIDAVQVSVREELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            ME +SGK+SWID+ Q+  R+ELVHIAKLAEQAERYDDMA+AMKRVTEKG ELSNEERNLLSVAYKNVVGSRRSSWRVISSIEQKT+GNEKKVKFS +YRLKIE ELHDICRDVLKLL+++LIPKAT+SESVVFFLKMEGDYYRYLAEVASG++K+EAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLAR+AFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQD EPGE DPGDN
Sbjct:    1 MEAESGKVSWIDSSQIGSRDELVHIAKLAEQAERYDDMAIAMKRVTEKGFELSNEERNLLSVAYKNVVGSRRSSWRVISSIEQKTEGNEKKVKFSSDYRLKIETELHDICRDVLKLLKDHLIPKATVSESVVFFLKMEGDYYRYLAEVASGEIKEEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARTAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDTEPGETDPGDN 260          
BLAST of 14-3-3 protein beta/alpha vs. TrEMBL
Match: A0A1I8II35 (14_3_3 domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 4.615e-112
Identity = 178/246 (72.36%), Postives = 204/246 (82.93%), Query Frame = 2
Query:  107 SWIDAVQVSVREELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGE 844
             W+ +  +S RE+LVHIAKLAEQAERYDDMA AMK VTEKG EL NEERNLLSVAYKNVVG+RRSSWRVISSIE KT+G+E+K   + EYR KIE EL  IC++VL LL +YLI  A  SES VF+ KM+GDY+RYLAEVA+GD +   V  S  AY++AT HA+ EL TTHPIRLGLALNYSVFFYEIKN+PERACQLA+ AFD+AIA++DDL EESYKDSTLIMQLLRDNLTLWTSEQ  + GE
Sbjct:    7 GWLTSSNISGREDLVHIAKLAEQAERYDDMATAMKAVTEKGQELGNEERNLLSVAYKNVVGARRSSWRVISSIESKTEGSERKQSMAKEYRQKIESELQRICKEVLSLLDDYLIKNAPNSESKVFYFKMKGDYFRYLAEVATGDERKNVVDSSEGAYKSATDHAETELATTHPIRLGLALNYSVFFYEIKNDPERACQLAKKAFDNAIADLDDLAEESYKDSTLIMQLLRDNLTLWTSEQGGDDGE 252          
BLAST of 14-3-3 protein beta/alpha vs. TrEMBL
Match: G3NH36 (14_3_3 domain-containing protein OS=Gasterosteus aculeatus OX=69293 PE=3 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 1.614e-106
Identity = 172/242 (71.07%), Postives = 200/242 (82.64%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + +LV  AKLAEQAERYDDMA AMK VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+GNEKK + + EYR+KIE EL DIC+DVL LL ++LI  AT +ES VF+LKM+GDY+RYL+EVASGD K + V+ S  AYQNA   + K+++ THPIRLGLALN+SVFFYEI N PE+AC LA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTSE   + GEA  GDN
Sbjct:    4 KNDLVQKAKLAEQAERYDDMAAAMKAVTEQGLELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYRMKIETELQDICKDVLNLLDKFLIANATQAESKVFYLKMKGDYFRYLSEVASGDAKKDTVENSQQAYQNAFDISKKDMQPTHPIRLGLALNFSVFFYEILNSPEQACTLAKQAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGEAGDGDN 245          
BLAST of 14-3-3 protein beta/alpha vs. TrEMBL
Match: G3NH29 (14_3_3 domain-containing protein OS=Gasterosteus aculeatus OX=69293 PE=3 SV=1)

HSP 1 Score: 319.701 bits (818), Expect = 1.837e-106
Identity = 172/242 (71.07%), Postives = 200/242 (82.64%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + +LV  AKLAEQAERYDDMA AMK VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+GNEKK + + EYR+KIE EL DIC+DVL LL ++LI  AT +ES VF+LKM+GDY+RYL+EVASGD K + V+ S  AYQNA   + K+++ THPIRLGLALN+SVFFYEI N PE+AC LA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTSE   + GEA  GDN
Sbjct:    3 KNDLVQKAKLAEQAERYDDMAAAMKAVTEQGLELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYRMKIETELQDICKDVLNLLDKFLIANATQAESKVFYLKMKGDYFRYLSEVASGDAKKDTVENSQQAYQNAFDISKKDMQPTHPIRLGLALNFSVFFYEILNSPEQACTLAKQAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGEAGDGDN 244          
BLAST of 14-3-3 protein beta/alpha vs. TrEMBL
Match: A0A3Q3X8J3 (14_3_3 domain-containing protein OS=Mola mola OX=94237 PE=3 SV=1)

HSP 1 Score: 317.775 bits (813), Expect = 9.460e-106
Identity = 171/242 (70.66%), Postives = 200/242 (82.64%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + +LV  AKL+EQAERYDDMA AMK VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+ NEKK + S EYR+KIE EL +IC+DVL LL E+LIPKAT +ES VF+LKM+GDYYRYL+EVASGD K + V+ S  AYQ+A   + K+++ THPIRLGLALN+SVF+YEI N PE+AC LA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTSE   + GE   GDN
Sbjct:    3 KNDLVQKAKLSEQAERYDDMAAAMKAVTEQGLELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEANEKKQQMSREYRVKIEAELQEICQDVLNLLSEFLIPKATQAESKVFYLKMKGDYYRYLSEVASGDSKKDTVENSQQAYQDAFNISKKDMQPTHPIRLGLALNFSVFYYEILNSPEQACSLAKQAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGETGDGDN 244          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Cavefish
Match: ywhaba (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [Source:NCBI gene;Acc:103026368])

HSP 1 Score: 310.071 bits (793), Expect = 4.688e-106
Identity = 169/242 (69.83%), Postives = 197/242 (81.40%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + +LV  AKLAEQAERYDDMA +MK VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+GNEKK + + EYR KIE EL DIC DVL LL +YLIP A+ +ES VF+LKM+GDYYRYL+EVASG+ K   V  S  AYQ+A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTSE   + G+A  G+N
Sbjct:    3 KSDLVQKAKLAEQAERYDDMAASMKAVTEGGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIETELQDICNDVLGLLEKYLIPNASQAESKVFYLKMKGDYYRYLSEVASGESKRTTVDNSQKAYQDAFEISKKEMQPTHPIRLGLALNFSVFYYEILNTPEQACSLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 244          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Cavefish
Match: ywhaba (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta [Source:NCBI gene;Acc:103026368])

HSP 1 Score: 309.301 bits (791), Expect = 1.163e-105
Identity = 169/240 (70.42%), Postives = 196/240 (81.67%), Query Frame = 2
Query:  143 ELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            +LV  AKLAEQAERYDDMA +MK VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+GNEKK + + EYR KIE EL DIC DVL LL +YLIP A+ +ES VF+LKM+GDYYRYL+EVASG+ K   V  S  AYQ+A   + KE++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTSE   + G+A  G+N
Sbjct:   14 DLVQKAKLAEQAERYDDMAASMKAVTEGGVELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIETELQDICNDVLGLLEKYLIPNASQAESKVFYLKMKGDYYRYLSEVASGESKRTTVDNSQKAYQDAFEISKKEMQPTHPIRLGLALNFSVFYYEILNTPEQACSLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEGDAGEGEN 253          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Cavefish
Match: ywhabb (14-3-3 protein beta/alpha-A-like [Source:NCBI gene;Acc:103023259])

HSP 1 Score: 305.834 bits (782), Expect = 2.028e-104
Identity = 166/242 (68.60%), Postives = 196/242 (80.99%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + +LV  AKLAEQAERYDDMA AMK VTE G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+GNEKK + + EYR KIE EL +IC DVL LL ++LIP A+ +ES VF+LKM+GDYYRYL+EVASG+ K   V  S  AYQ+A   + K+++ THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTSE   +  +A  G+N
Sbjct:    3 KSDLVQKAKLAEQAERYDDMATAMKAVTEGGMELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKQQMAREYREKIESELQEICNDVLGLLEKFLIPNASQAESKVFYLKMKGDYYRYLSEVASGESKTTTVDNSQKAYQDAFEISKKDMQPTHPIRLGLALNFSVFYYEILNSPEKACNLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEADAGEGEN 244          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Cavefish
Match: ywhaqb (14-3-3 protein beta/alpha-like [Source:NCBI gene;Acc:107197738])

HSP 1 Score: 301.982 bits (772), Expect = 8.136e-103
Identity = 164/232 (70.69%), Postives = 189/232 (81.47%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDA 832
            R EL+  AKLAEQAERYDDMA +MK VTE G ELSNEERNLLSVAYKNVVG+RRS+WRVISSIEQKT+GN+KK++   EYR K+E EL +IC DVL+LL +YLI  +T  ES VF+LKM+GDYYRYLAEVASGD K   ++ S DAYQ A   +  E++ THPIRLGLALN+SVFFYEI N PE+AC LA+ AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+  A
Sbjct:    3 RTELIQKAKLAEQAERYDDMAASMKEVTEAGTELSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTEGNDKKLQMVKEYREKVESELKEICNDVLELLNKYLIENSTNPESKVFYLKMKGDYYRYLAEVASGDDKKATIENSQDAYQKAFDISKTEMQPTHPIRLGLALNFSVFFYEILNSPEKACSLAKQAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSDNAA 234          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Cavefish
Match: ywhabl (14-3-3 protein beta/alpha-A-like [Source:NCBI gene;Acc:103045356])

HSP 1 Score: 298.13 bits (762), Expect = 2.198e-101
Identity = 164/229 (71.62%), Postives = 192/229 (83.84%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSE 823
            + ELV  AKLAEQAERYDDMA AMK VTE   ELSNEERNLLSVAYKNVVG+RRSSWRV+SSIEQKT+G++KK + + EYR KIEKEL +IC DVL LL +YLIPKAT +ES VF+LKM+GDY+RYLAEVA GD K   +Q S DAY++A   +  E++ THPIRLGLALN+SVF+YEI N PE+AC+LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+
Sbjct:    3 KSELVQKAKLAEQAERYDDMAAAMKAVTEGDVELSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKTEGSDKKQQMAKEYREKIEKELKEICNDVLVLLDKYLIPKATPAESKVFYLKMKGDYFRYLAEVALGDDKIAIIQNSQDAYKDAFEISKAEMQPTHPIRLGLALNFSVFYYEILNSPEQACKLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSD 231          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Sea Lamprey
Match: ywhaqb (tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta polypeptide b [Source:ZFIN;Acc:ZDB-GENE-030131-7135])

HSP 1 Score: 287.345 bits (734), Expect = 7.699e-98
Identity = 159/242 (65.70%), Postives = 191/242 (78.93%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + ELV  AKLAEQAERYDDM+ AMK VTE+G+ELSNEERNLLSVAYKNVVG+RRS+WRVISSIEQK+D ++KK   + EYR K+EKEL DIC DVL LL ++LI  AT +ES VF+ KM+GDYYRYLAEVA G  K  A+++S  AY +A   +  E+  THPIRLGLALN+SVF+YEI N PE+AC LA++AFD AIA +D L E+SYKDSTLIMQLLRDNLTLW S+   E  + D  +N
Sbjct:    5 KSELVQKAKLAEQAERYDDMSAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSAWRVISSIEQKSDASDKKQHMAKEYRHKVEKELCDICNDVLALLDKHLIVSATSAESKVFYQKMKGDYYRYLAEVAVGIDKASAMERSQAAYLSAFDVSKAEMSPTHPIRLGLALNFSVFYYEILNSPEKACNLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWASDAQGEDADVDGAEN 246          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005915.1 (pep scaffold:Pmarinus_7.0:GL476980:154455:158510:1 gene:ENSPMAG00000005339.1 transcript:ENSPMAT00000005915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 271.552 bits (693), Expect = 1.329e-91
Identity = 158/242 (65.29%), Postives = 188/242 (77.69%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKT--DGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATIS--ESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTS--EQDAEPGE 844
            RE LV  A+LAEQAERYDDMA AMK VTE    LSNEERNLLSVAYKNVVG+RRS+WRVISSIEQKT  DG+EKK      YR K+EKEL  +C+DVL LL ++L+     S  ES VF+LKM+GDY+RYLAEVA+GD +D  V  S  AY+ A     + ++ THPIRLGLALN+SVF+YEI+N PE+AC+LA++AFD +IA +D L E+SYKDSTLIMQLLRDNLTLWTS  +QD EP E
Sbjct:    4 RELLVQKARLAEQAERYDDMAAAMKAVTELNEPLSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTAGDGSEKKQAMVKAYREKVEKELETVCQDVLDLLDKFLVKSCDDSQQESKVFYLKMKGDYFRYLAEVAAGDKRDGVVLNSEKAYKEAYEICKEHMQPTHPIRLGLALNFSVFYYEIQNAPEQACELAKTAFDDSIAELDSLNEDSYKDSTLIMQLLRDNLTLWTSDRQQDDEPEE 245          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007337.1 (pep scaffold:Pmarinus_7.0:GL477279:15491:28515:1 gene:ENSPMAG00000006598.1 transcript:ENSPMAT00000007337.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 265.388 bits (677), Expect = 5.581e-89
Identity = 150/237 (63.29%), Postives = 186/237 (78.48%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQK--TDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQ--DAE 835
            RE+ V+ AKLAEQAERYD+M   MK+V     ELS EERNLLSVAYKNV+G+RR+SWR+ISSIEQK  + G+E K+K   EYR  +EKEL DIC D+L++L ++LIP A   ES VF+ KM+GDY+RYLAE A+G+ + EA + S+ AY+ A+  A  EL  THPIRLGLALN+SVF+YEI N P+RAC+LA++AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTS+   DAE
Sbjct:    4 REDQVYQAKLAEQAERYDEMVEVMKKVAGLNTELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGSEGKLKIIREYRQTVEKELKDICMDILEVLDKHLIPAAMTGESKVFYYKMKGDYHRYLAEFATGNDRKEAAENSLVAYKAASDIATTELPPTHPIRLGLALNFSVFYYEILNSPDRACKLAKTAFDDAIAELDTLSEDSYKDSTLIMQLLRDNLTLWTSDMQGDAE 240          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011016.1 (pep scaffold:Pmarinus_7.0:GL483328:5531:6205:1 gene:ENSPMAG00000009989.1 transcript:ENSPMAT00000011016.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 242.276 bits (617), Expect = 1.791e-80
Identity = 140/219 (63.93%), Postives = 171/219 (78.08%), Query Frame = 2
Query:  209 KRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKT--DGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATIS--ESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTS-EQDAEPGEAD 850
            ++VTE    LSNEERNLLSVAYKNVVG+RRS+WRVISSIEQKT  DGNEK++     YR KIE+EL  +C DVL LL  +LIP+      ES VF+LKM+GDY+RYLAEVA+G+ +D  V  S  AY+ A   + +++  THPIRLGLALN+SVF+YEI+N PE+ACQLA++AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTS +QD E GE +
Sbjct:    6 RQVTELTEPLSNEERNLLSVAYKNVVGARRSAWRVISSIEQKTATDGNEKRLGLVRSYREKIEQELEAVCGDVLNLLDNHLIPRCDHPQYESKVFYLKMKGDYFRYLAEVATGEKRDHVVSNSEKAYKEAYEVSKEQMMPTHPIRLGLALNFSVFYYEIQNAPEQACQLAKTAFDEAIAELDSLNEDSYKDSTLIMQLLRDNLTLWTSDQQDDEAGEGN 224          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006708.1 (pep scaffold:Pmarinus_7.0:GL478275:1612:6605:-1 gene:ENSPMAG00000006053.1 transcript:ENSPMAT00000006708.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 234.572 bits (597), Expect = 3.291e-77
Identity = 132/220 (60.00%), Postives = 167/220 (75.91%), Query Frame = 2
Query:  191 DMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQK--TDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGE 844
            +M  +MK+V     ELS EERNLLSVAYKNV+G+RR+SWR+ISSIEQK  + G E+K+K   EYR  +EKEL  IC D+L +L ++LIP A+  ES VF+ KM+GDY+RYLAE  + + + EA + S+ AY+ A+  A  EL  THPIRLGLALN+SVF+YEI N P+RAC+LA++AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+   +  E
Sbjct:    1 EMVESMKKVAALDVELSVEERNLLSVAYKNVIGARRASWRIISSIEQKEESKGGEEKLKLIREYRQMVEKELKSICGDILDVLDKHLIPTASTGESKVFYYKMKGDYHRYLAEFTTANDRKEAAENSLVAYKAASDIATTELPPTHPIRLGLALNFSVFYYEILNSPDRACRLAKAAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDMQGDAEE 220          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Yeast
Match: BMH1 (14-3-3 protein, major isoform; controls proteome at post-transcriptional level, binds proteins and DNA, involved in regulation of exocytosis, vesicle transport, Ras/MAPK and rapamycin-sensitive signaling, aggresome formation, spindle position checkpoint; protein increases in abundance and relative distribution to the nucleus increases upon DNA replication stress; antiapoptotic gene similar to human 14-3-3; BMH1 has a paralog, BMH2, that arose from whole genome duplication [Source:SGD;Acc:S000000979])

HSP 1 Score: 266.159 bits (679), Expect = 1.964e-89
Identity = 147/241 (61.00%), Postives = 185/241 (76.76%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEK---KVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEAD 850
            RE+ V++AKLAEQAERY++M   MK V   G ELS EERNLLSVAYKNV+G+RR+SWR++SSIEQK +  EK   +V+    YR KIE EL  I  D+L +L  +LIP AT  ES VF+ KM+GDY+RYLAE +SGD +++A   S++AY+ A+  A  EL  THPIRLGLALN+SVF+YEI+N P++AC LA+ AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+  +E G+A+
Sbjct:    5 REDSVYLAKLAEQAERYEEMVENMKTVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELICSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNASLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDM-SESGQAE 244          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Yeast
Match: BMH2 (14-3-3 protein, minor isoform; controls proteome at post-transcriptional level, binds proteins and DNA, involved in regulation of many processes including exocytosis, vesicle transport, Ras/MAPK signaling, and rapamycin-sensitive signaling; protein increases in abundance and relative distribution to the nucleus increases upon DNA replication stress; abundance relative to Bmh1p increases during sporulation [Source:SGD;Acc:S000002506])

HSP 1 Score: 265.388 bits (677), Expect = 5.963e-89
Identity = 147/242 (60.74%), Postives = 184/242 (76.03%), Query Frame = 2
Query:  134 VREELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEK---KVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEAD 850
             RE+ V++AKLAEQAERY++M   MK V   G ELS EERNLLSVAYKNV+G+RR+SWR++SSIEQK +  EK   +V+    YR KIE EL  I  D+L +L  +LIP AT  ES VF+ KM+GDY+RYLAE +SGD +++A   S++AY+ A+  A  EL  THPIRLGLALN+SVF+YEI+N P++AC LA+ AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+  +E G+ D
Sbjct:    4 TREDSVYLAKLAEQAERYEEMVENMKAVASSGQELSVEERNLLSVAYKNVIGARRASWRIVSSIEQKEESKEKSEHQVELIRSYRSKIETELTKISDDILSVLDSHLIPSATTGESKVFYYKMKGDYHRYLAEFSSGDAREKATNSSLEAYKTASEIATTELPPTHPIRLGLALNFSVFYYEIQNSPDKACHLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDI-SESGQED 244          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Nematostella
Match: EDO42859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E0])

HSP 1 Score: 255.373 bits (651), Expect = 4.522e-85
Identity = 147/241 (61.00%), Postives = 180/241 (74.69%), Query Frame = 2
Query:  128 VSVREELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKE--LETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGE 844
            ++ +EELV +AK AEQAERY+DMA AMK  TE    L  EERNLLSVAYKNVVG++RSSWRVISSIEQK +G+E+K + +  YR  IE EL+++C  VLKLL   LIP A  +ES VF+LKM+GDYYRY  EVA  D + E VQK+M AY  A   A+K+  L  T PIRLGLALN+SVF+YEI  + ++AC LA+ AFD AIA +D L E+ YKDSTLIMQLLRDNLTLW+SE   + G+
Sbjct:    1 MASKEELVQMAKYAEQAERYEDMAKAMKEATEISETLEQEERNLLSVAYKNVVGAKRSSWRVISSIEQKLEGSERKKQNTETYRQTIENELNEVCETVLKLLESKLIPNAQSTESKVFYLKMKGDYYRYEGEVAGADRRREVVQKAMKAYSEAQEIAEKDPKLPPTDPIRLGLALNFSVFYYEIVEDSKQACDLAKKAFDDAIAELDSLNEDQYKDSTLIMQLLRDNLTLWSSENQEDQGD 241          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Nematostella
Match: EDO42175 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S252])

HSP 1 Score: 253.832 bits (647), Expect = 2.557e-84
Identity = 147/246 (59.76%), Postives = 187/246 (76.02%), Query Frame = 2
Query:  122 VQVSVREELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKA---TISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEAD 850
            V    REEL+H+AK+AEQAERYDDM  AM  VT++G  L++EERNLLSVAYKNVVG+RRSSWRVISS+EQK    E+    + +YR  I  EL+  C +VL +L  YL+        +E+ VF+LKM GDY+RYL EVA GD + E ++KS +AY++A+  A+ EL  +HPIRLGLALN+SVF+YEI+N+P  AC+LA+ AFD AIA +D+L++ESYKDSTLIMQLLRDNLTLWTSEQD E  + D
Sbjct:    6 VSKCSREELIHLAKMAEQAERYDDMVNAMSAVTKEGKPLNDEERNLLSVAYKNVVGARRSSWRVISSMEQK--APEEMAALTKKYREDITNELNGKCAEVLDILENYLLKDGQDDINTEAKVFYLKMRGDYHRYLVEVAEGDSRKENIEKSREAYKDASAKAE-ELSPSHPIRLGLALNFSVFYYEIENKPPEACKLAKEAFDDAIAVLDNLKDESYKDSTLIMQLLRDNLTLWTSEQDQEGQDDD 248          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Nematostella
Match: EDO41372 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4S2])

HSP 1 Score: 246.899 bits (629), Expect = 1.027e-81
Identity = 141/240 (58.75%), Postives = 181/240 (75.42%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEK---KVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEA 847
            +EE V++AKLAEQAERYDDM  +MK V + G ELS E+RNLLSVAYKNV+G+RR+SWR+I+SIEQK +   +   K++    YR  IE+EL  IC ++L LL + LI  +   ES VF+ KM+GDY+RY+AE  S + +DEA ++S  AY+ A   A + L  THPIRLGLALN+SVF+YEI+N PE+AC+LA+ AFD AI+ +D LQEESYKDSTLIMQLLRDNLTLWTS+     GE+
Sbjct:    4 KEEHVYMAKLAEQAERYDDMVNSMKEVAKMGTELSTEDRNLLSVAYKNVIGARRASWRIITSIEQKEESKGEDMAKLEMIRNYRKTIEEELKTICGEILSLLDDSLIKNSQSEESKVFYNKMKGDYHRYVAEF-SKEGRDEAAKQSETAYKEAQTIATEHLAKTHPIRLGLALNFSVFYYEIQNAPEKACKLAKEAFDDAISELDSLQEESYKDSTLIMQLLRDNLTLWTSDSTKGDGES 242          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Nematostella
Match: EDO42821 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0E3])

HSP 1 Score: 165.236 bits (417), Expect = 2.158e-49
Identity = 107/271 (39.48%), Postives = 154/271 (56.83%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSG--EYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVK----------------------------------------DEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSE 823
            R ELV +AKLAEQ ER++D+ + MK+  E    L+ E RNLLSV YKNVVGS+R +WR +     ++    +  +  G  +Y+ KIE EL  +CR++L L+   L+  A  +E+ VF+ KM GDY+RYLAE+ SG  +                                        DEA ++S+ AY++A+  A + L  T P+RLGLALN++VF+ EI NE E A   ++ A+ +A+  +D L EE Y+DS LIM LL DN+T+W  E
Sbjct:    5 RNELVQLAKLAEQTERFEDVILYMKKAIEINPSLNKEHRNLLSVGYKNVVGSKRFAWRHLHHDALQSGRYIRDSQLKGIIKYKEKIEMELKTLCREILTLIETCLLDAAEDAEAKVFYDKMTGDYWRYLAEIYSGKQQKDSYGTAVEHEDACDNYDASDNYIACGNYDACDIDNWYDDDEAAERSLGAYKHASSTAAEYLSPTDPVRLGLALNFAVFYKEILNEAEMAIMHSKQAYAAALPEMDSLSEEVYRDSNLIMHLLNDNITIWMEE 275          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Medaka
Match: YWHAB (14-3-3 protein beta/alpha-1 [Source:NCBI gene;Acc:101167287])

HSP 1 Score: 308.531 bits (789), Expect = 2.013e-105
Identity = 167/242 (69.01%), Postives = 196/242 (80.99%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + +LV  AKLAEQAERYDDMA AMK VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+GN+KK + + EYR KIE EL DIC DVL LL  +LI  A+ +ES VF+LKM+GDYYRYL+EVASGD+K + V  S  AYQ A   +  E++ THPIRLGLALN+SVF+YEI N P++AC LA++AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTSE  A+ GE   G+N
Sbjct:    3 KNDLVQKAKLAEQAERYDDMAAAMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNDKKQQMAREYREKIETELQDICHDVLGLLDNFLIANASSAESKVFYLKMKGDYYRYLSEVASGDIKKDTVDNSQQAYQQAFDISKGEMQPTHPIRLGLALNFSVFYYEILNNPDKACSLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQADEGETGDGEN 244          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Medaka
Match: ENSORLT00000024336.2 (14-3-3 protein beta/alpha-1 [Source:NCBI gene;Acc:101154846])

HSP 1 Score: 305.834 bits (782), Expect = 2.298e-104
Identity = 165/242 (68.18%), Postives = 198/242 (81.82%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            + +LV  AKLAEQAERYDDMA AMK VTE+G ELSNEERNLLSVAYKNVVG+RRSSWRVISSIEQKT+GNEKK + + +YR+KIE EL +IC DVL LL ++LIP A+ +ES VF+LKM+GDY+RYL+EVASGD K + V+ S  AYQ+A   + K+++ THPIRLGLALN+SVF+YEI N PE+AC LA+ AFD AIA +D L E+SYKDSTLIMQLLRDNLTLWTSE   +  E   G+N
Sbjct:    3 KNDLVQKAKLAEQAERYDDMAAAMKAVTEQGLELSNEERNLLSVAYKNVVGARRSSWRVISSIEQKTEGNEKKRQMASDYRVKIEAELQEICHDVLNLLDKFLIPNASQAESKVFYLKMKGDYFRYLSEVASGDSKKDTVENSQQAYQDAFDISKKDMQPTHPIRLGLALNFSVFYYEILNSPEQACSLAKQAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSENQGDEPETGDGEN 244          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Medaka
Match: ywhaz (14-3-3 protein beta/alpha-B [Source:NCBI gene;Acc:101168878])

HSP 1 Score: 291.582 bits (745), Expect = 8.768e-99
Identity = 161/238 (67.65%), Postives = 190/238 (79.83%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEAD 850
            +EELV  AKLAEQAERYDDMA AMK VTEK +EL+NEERNLLSVAYKNVVG+RRSSWRV+SS+EQK+D +  K   + +YR KIE EL+DIC+DVL LL +YLIP  T  +S VF+LKM+GDYYRYLAEVA+G+ KD  +  S DAYQ A   +  E+  THPIRLGLALN+SVF+YEI N PE+ACQLA+SAFD AI+ +D L  +SYKDSTLIMQLLRDNLTLW S+   E GE D
Sbjct:    4 KEELVQKAKLAEQAERYDDMAAAMKAVTEKSSELNNEERNLLSVAYKNVVGARRSSWRVVSSMEQKSD-DSSKAALAKDYREKIETELNDICKDVLDLLDKYLIPNTTSPDSKVFYLKMKGDYYRYLAEVATGNNKDSIIGNSEDAYQKALDISTAEMPPTHPIRLGLALNFSVFYYEIVNSPEKACQLAKSAFDEAISKLDSLNNDSYKDSTLIMQLLRDNLTLWMSDTQGE-GEGD 239          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Medaka
Match: ENSORLT00000032209.1 (14-3-3 protein zeta [Source:NCBI gene;Acc:101163516])

HSP 1 Score: 290.426 bits (742), Expect = 2.214e-98
Identity = 161/238 (67.65%), Postives = 190/238 (79.83%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEAD 850
            +++LV  AKLAEQAERYDDMA AMK VTE   +LSNEERNLLSVAYKNVVG+RRSSWRV+SSIEQK +G+++K   + EYR KIE+EL DIC DVL LL ++LIPKA+ +ES VF+LKM+GDYYRYLAEVAS + K   +  S  AY+ A   +  E++ THPIRLGLALNYSVFFYEI N PE ACQLA+ AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+   E  +A+
Sbjct:    6 QKDLVQKAKLAEQAERYDDMATAMKTVTEDSEQLSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKAEGSDRKKAMAQEYREKIEQELKDICNDVLGLLDKFLIPKASTAESKVFYLKMKGDYYRYLAEVASKEDKKGIIGDSQAAYKEAFEISKMEMQPTHPIRLGLALNYSVFFYEILNSPEEACQLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDNQTEGDDAE 243          
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Medaka
Match: ENSORLT00000027323.1 (14-3-3 protein zeta [Source:NCBI gene;Acc:101163516])

HSP 1 Score: 290.812 bits (743), Expect = 2.436e-98
Identity = 161/238 (67.65%), Postives = 190/238 (79.83%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEAD 850
            +++LV  AKLAEQAERYDDMA AMK VTE   +LSNEERNLLSVAYKNVVG+RRSSWRV+SSIEQK +G+++K   + EYR KIE+EL DIC DVL LL ++LIPKA+ +ES VF+LKM+GDYYRYLAEVAS + K   +  S  AY+ A   +  E++ THPIRLGLALNYSVFFYEI N PE ACQLA+ AFD AIA +D L EESYKDSTLIMQLLRDNLTLWTS+   E  +A+
Sbjct:   14 QKDLVQKAKLAEQAERYDDMATAMKTVTEDSEQLSNEERNLLSVAYKNVVGARRSSWRVVSSIEQKAEGSDRKKAMAQEYREKIEQELKDICNDVLGLLDKFLIPKASTAESKVFYLKMKGDYYRYLAEVASKEDKKGIIGDSQAAYKEAFEISKMEMQPTHPIRLGLALNYSVFFYEILNSPEEACQLAKQAFDDAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDNQTEGDDAE 251          
BLAST of 14-3-3 protein beta/alpha vs. Planmine SMEST
Match: SMESG000067831.1 (SMESG000067831.1)

HSP 1 Score: 501.516 bits (1290), Expect = 0.000e+0
Identity = 260/260 (100.00%), Postives = 260/260 (100.00%), Query Frame = 2
Query:   83 METDSGKISWIDAVQVSVREELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            METDSGKISWIDAVQVSVREELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNVVGSRRSSWRVISSIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN
Sbjct:    1 METDSGKISWIDAVQVSVREELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNVVGSRRSSWRVISSIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 260          
BLAST of 14-3-3 protein beta/alpha vs. Planmine SMEST
Match: SMESG000055903.1 (SMESG000055903.1)

HSP 1 Score: 317.39 bits (812), Expect = 7.257e-109
Identity = 178/249 (71.49%), Postives = 204/249 (81.93%), Query Frame = 2
Query:  110 WIDAVQVSVREELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATIS---ESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEA 847
            WI+  Q   REELVHIAKL+EQAERY+DMA AMK+VTE G ELSNEERNLLSVAYKNVVG+RRS+WRVI+SIEQKT+G+EKK  F+ EYRLKIE EL+ IC DVLKLL +YLIP AT S   ES VFFLKM+GDYYRYLAEVAS   K + V+ S++AY NAT  A K L TTHPIRLGLALN+SVF+YEIKN    AC+LA++AFD AIA+ID LQE+SYKDSTLIMQLLRDNLTLWTS+   +  E 
Sbjct:    8 WIEE-QFKSREELVHIAKLSEQAERYEDMACAMKKVTEMGEELSNEERNLLSVAYKNVVGARRSAWRVITSIEQKTEGSEKKQMFANEYRLKIESELNAICNDVLKLLIDYLIPLATKSGQAESEVFFLKMQGDYYRYLAEVASSQNKSDIVKNSLNAYLNATSSASK-LHTTHPIRLGLALNFSVFYYEIKNNRAEACKLAKTAFDDAIADIDHLQEDSYKDSTLIMQLLRDNLTLWTSDDQGDDNEG 254          
BLAST of 14-3-3 protein beta/alpha vs. Planmine SMEST
Match: SMESG000075252.1 (SMESG000075252.1)

HSP 1 Score: 249.595 bits (636), Expect = 2.759e-82
Identity = 141/239 (59.00%), Postives = 182/239 (76.15%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNE-KKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEAD 850
            REE V+ AKLAEQAERY++M  AM+ V    ++L+ EERNLLSVAYKNV+GSRR+SWR+ISSIEQK +  + +K+    ++R +IE+EL D+C+D++++L   L+  AT  E+ VFFLKM+GDYYRYLAE      + +A + S+ AY+ A+  AD EL+ THPIRLGLALN+SVF+YEI N  +RACQLA+ AFD AIA +D+L EESYKDSTLIMQLLRDNLTLWTS+   E    D
Sbjct:    4 REEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVIGSRRASWRIISSIEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMATEEKSKD 242          
BLAST of 14-3-3 protein beta/alpha vs. Planmine SMEST
Match: SMESG000075252.1 (SMESG000075252.1)

HSP 1 Score: 249.21 bits (635), Expect = 3.467e-82
Identity = 140/234 (59.83%), Postives = 181/234 (77.35%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTD-GNEKKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAE 835
            REE V+ AKLAEQAERY++M  AM+ V    ++L+ EERNLLSVAYKNV+GSRR+SWR+ISSIEQK +  + +K+    ++R +IE+EL D+C+D++++L   L+  AT  E+ VFFLKM+GDYYRYLAE      + +A + S+ AY+ A+  AD EL+ THPIRLGLALN+SVF+YEI N  +RACQLA+ AFD AIA +D+L EESYKDSTLIMQLLRDNLTLWTS+   E
Sbjct:    4 REEKVYKAKLAEQAERYEEMVDAMREVARMNSDLTVEERNLLSVAYKNVIGSRRASWRIISSIEQKAEQKDPEKLPVIKKFREQIEQELGDVCKDIIRVLDANLLQSATNEEARVFFLKMKGDYYRYLAEFTVDIERKDAAENSLSAYKQASTIADSELQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAIAELDNLSEESYKDSTLIMQLLRDNLTLWTSDMATE 237          
BLAST of 14-3-3 protein beta/alpha vs. Planmine SMEST
Match: SMESG000047644.1 (SMESG000047644.1)

HSP 1 Score: 247.669 bits (631), Expect = 1.135e-81
Identity = 138/243 (56.79%), Postives = 181/243 (74.49%), Query Frame = 2
Query:  137 REELVHIAKLAEQAERYDDMAVAMKRVTEKGNELSNEERNLLSVAYKNXXXXXXXXXXXXXXIEQKTDGNE-KKVKFSGEYRLKIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVASGDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNEPERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDAEPGEADPGDN 862
            RE  V+ AKLAEQAERYD+M  AM+ V +   EL+ EERNLLSVAYKNV+GSRR+SWR++SSIEQK +  +  ++     YR ++EKEL ++C D++ LL E+++  A+  E+ VFFLKM+GDYYRYL+E    + +  A + S+ AY+ AT  A+ +L+ THPIRLGLALN+SVF+YEI N  +RACQLA+ AFD AI  +D+L EESYKDSTLIMQLLRDNLTLWTS+ D +    D  +N
Sbjct:    4 RETKVYRAKLAEQAERYDEMVDAMRDVAKMTGELNMEERNLLSVAYKNVIGSRRASWRIMSSIEQKAEQKDPSRLPLIKAYRSQVEKELKEVCADIISLLDEHMLVAASGGEAKVFFLKMKGDYYRYLSEFTVDNERKAAAENSLTAYKEATAIAESDLQPTHPIRLGLALNFSVFYYEILNSADRACQLAKKAFDDAITELDNLNEESYKDSTLIMQLLRDNLTLWTSDADQDEKACDEENN 246          
The following BLAST results are available for this feature:
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YWHAB2.373e-10771.07tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAB2.373e-10771.07tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAZ4.157e-10469.58tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAZ4.157e-10469.58tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
YWHAZ4.157e-10469.58tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ftt-21.540e-10569.2614-3-3-like protein 2 [Source:UniProtKB/Swiss-Pro... [more]
ftt-21.540e-10569.2614-3-3-like protein 2 [Source:UniProtKB/Swiss-Pro... [more]
ftt-21.540e-10569.2614-3-3-like protein 2 [Source:UniProtKB/Swiss-Pro... [more]
par-53.733e-10472.3414-3-3-like protein 1 [Source:UniProtKB/Swiss-Pro... [more]
par-53.733e-10472.3414-3-3-like protein 1 [Source:UniProtKB/Swiss-Pro... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
14-3-3zeta1.112e-10067.76gene:FBgn0004907 transcript:FBtr0088413[more]
14-3-3zeta1.112e-10067.76gene:FBgn0004907 transcript:FBtr0088418[more]
14-3-3zeta1.112e-10067.76gene:FBgn0004907 transcript:FBtr0088417[more]
14-3-3zeta1.112e-10067.76gene:FBgn0004907 transcript:FBtr0088412[more]
14-3-3zeta1.112e-10067.76gene:FBgn0004907 transcript:FBtr0100182[more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhaba2.116e-10669.83tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhabb2.940e-10371.31tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhaqb5.506e-10270.74tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhaqb5.506e-10270.74tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhabl3.886e-10067.92tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhab6.017e-10569.42tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
edf13.422e-10269.42endothelial differentiation related factor 1 [Sour... [more]
ywhab3.376e-10070.61tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
edf11.748e-9770.61endothelial differentiation related factor 1 [Sour... [more]
edf19.656e-9670.98endothelial differentiation related factor 1 [Sour... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ywhab9.067e-10670.25tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhaz5.803e-10469.58tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhaz5.803e-10469.58tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhaz5.803e-10469.58tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
Ywhaq5.564e-9765.83tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P68250|1433B_BOVIN5.482e-10771.0714-3-3 protein beta/alpha OS=Bos taurus OX=9913 GN... [more]
sp|A4K2U9|1433B_PONAB1.140e-10671.0714-3-3 protein beta/alpha OS=Pongo abelii OX=9601 ... [more]
sp|Q4R572|1433B_MACFA1.140e-10671.0714-3-3 protein beta/alpha OS=Macaca fascicularis O... [more]
sp|P31946|1433B_HUMAN1.140e-10671.0714-3-3 protein beta/alpha OS=Homo sapiens OX=9606 ... [more]
sp|Q6UFZ9|143B1_ONCMY4.401e-10670.2514-3-3 protein beta/alpha-1 OS=Oncorhynchus mykiss... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1V0M3W31.198e-16290.3814-3-3 alpha protein OS=Dugesia japonica OX=6161 P... [more]
A0A1I8II354.615e-11272.3614_3_3 domain-containing protein OS=Macrostomum li... [more]
G3NH361.614e-10671.0714_3_3 domain-containing protein OS=Gasterosteus a... [more]
G3NH291.837e-10671.0714_3_3 domain-containing protein OS=Gasterosteus a... [more]
A0A3Q3X8J39.460e-10670.6614_3_3 domain-containing protein OS=Mola mola OX=9... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhaba4.688e-10669.83tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhaba1.163e-10570.42tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ywhabb2.028e-10468.6014-3-3 protein beta/alpha-A-like [Source:NCBI gene... [more]
ywhaqb8.136e-10370.6914-3-3 protein beta/alpha-like [Source:NCBI gene;A... [more]
ywhabl2.198e-10171.6214-3-3 protein beta/alpha-A-like [Source:NCBI gene... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ywhaqb7.699e-9865.70tyrosine 3-monooxygenase/tryptophan 5-monooxygenas... [more]
ENSPMAT00000005915.11.329e-9165.29pep scaffold:Pmarinus_7.0:GL476980:154455:158510:1... [more]
ENSPMAT00000007337.15.581e-8963.29pep scaffold:Pmarinus_7.0:GL477279:15491:28515:1 g... [more]
ENSPMAT00000011016.11.791e-8063.93pep scaffold:Pmarinus_7.0:GL483328:5531:6205:1 gen... [more]
ENSPMAT00000006708.13.291e-7760.00pep scaffold:Pmarinus_7.0:GL478275:1612:6605:-1 ge... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
BMH11.964e-8961.0014-3-3 protein, major isoform; controls proteome a... [more]
BMH25.963e-8960.7414-3-3 protein, minor isoform; controls proteome a... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO428594.522e-8561.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421752.557e-8459.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413721.027e-8158.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428212.158e-4939.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
YWHAB2.013e-10569.0114-3-3 protein beta/alpha-1 [Source:NCBI gene;Acc:... [more]
ENSORLT00000024336.22.298e-10468.1814-3-3 protein beta/alpha-1 [Source:NCBI gene;Acc:... [more]
ywhaz8.768e-9967.6514-3-3 protein beta/alpha-B [Source:NCBI gene;Acc:... [more]
ENSORLT00000032209.12.214e-9867.6514-3-3 protein zeta [Source:NCBI gene;Acc:10116351... [more]
ENSORLT00000027323.12.436e-9867.6514-3-3 protein zeta [Source:NCBI gene;Acc:10116351... [more]
back to top
BLAST of 14-3-3 protein beta/alpha vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000067831.10.000e+0100.00SMESG000067831.1[more]
SMESG000055903.17.257e-10971.49SMESG000055903.1[more]
SMESG000075252.12.759e-8259.00SMESG000075252.1[more]
SMESG000075252.13.467e-8259.83SMESG000075252.1[more]
SMESG000047644.11.135e-8156.79SMESG000047644.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031447 ID=SMED30031447|Name=14-3-3 protein beta/alpha|organism=Schmidtea mediterranea sexual|type=transcript|length=936bp
ATGTGATATCGTTTTGTTAATAAAATTGATGCCATAATTTTATTTTATTT
AAAATTTATCGTTTGTTTAAATCAATTATAAAATGGAAACTGATAGCGGT
AAAATTTCTTGGATTGATGCTGTCCAAGTTTCTGTCAGGGAAGAATTGGT
GCATATTGCAAAATTGGCTGAGCAAGCTGAAAGATACGATGATATGGCAG
TCGCAATGAAACGGGTTACTGAAAAAGGAAATGAATTGAGCAATGAAGAA
CGTAATTTGTTGTCTGTTGCATATAAGAACGTTGTTGGATCACGTCGATC
ATCTTGGAGAGTTATATCAAGTATTGAACAGAAAACCGATGGAAATGAGA
AAAAAGTTAAGTTTAGTGGTGAATATAGACTTAAAATTGAGAAAGAATTG
CATGATATTTGTCGTGATGTTTTGAAACTGCTGCGCGAATATTTAATACC
AAAAGCAACAATATCTGAAAGCGTTGTATTCTTTTTGAAAATGGAAGGCG
ACTATTATCGCTACTTAGCTGAAGTAGCTTCTGGTGATGTTAAAGATGAA
GCTGTTCAGAAATCAATGGATGCCTATCAAAATGCTACCGTACACGCTGA
CAAGGAATTAGAAACGACTCATCCAATAAGGTTAGGATTAGCTCTTAATT
ATTCGGTTTTTTTCTATGAAATTAAAAACGAACCTGAACGAGCTTGTCAG
TTAGCTCGAAGTGCTTTTGATAGTGCAATTGCAAATATAGATGATCTTCA
GGAAGAATCTTATAAAGATAGCACTTTAATAATGCAACTTTTGAGGGACA
ATTTAACGTTGTGGACTTCAGAACAAGATGCTGAGCCTGGAGAAGCTGAT
CCTGGCGACAACTGAAATTTTTCCATTGCTTTTGTTTGTTTCGTATGTTG
TAATTATTATGAATAAAACAGAGTTCTTGTAGATCG
back to top

protein sequence of SMED30031447-orf-1

>SMED30031447-orf-1 ID=SMED30031447-orf-1|Name=SMED30031447-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=261bp
METDSGKISWIDAVQVSVREELVHIAKLAEQAERYDDMAVAMKRVTEKGN
ELSNEERNLLSVAYKNVVGSRRSSWRVISSIEQKTDGNEKKVKFSGEYRL
KIEKELHDICRDVLKLLREYLIPKATISESVVFFLKMEGDYYRYLAEVAS
GDVKDEAVQKSMDAYQNATVHADKELETTHPIRLGLALNYSVFFYEIKNE
PERACQLARSAFDSAIANIDDLQEESYKDSTLIMQLLRDNLTLWTSEQDA
EPGEADPGDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002142parenchyma
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR03681514-3-3_dom_sf
IPR00030814-3-3
IPR02341014-3-3_domain
IPR02340914-3-3_CS
Vocabulary: molecular function
TermDefinition
GO:0019904protein domain specific binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0042470melanosome
Vocabulary: biological process
TermDefinition
GO:0045744negative regulation of G-protein coupled receptor protein signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 205..225
NoneNo IPR availablePANTHERPTHR18860:SF2814-3-3 PROTEIN BETA/ALPHAcoord: 19..260
IPR00030814-3-3 proteinPRINTSPR003051433ZETAcoord: 51..80
score: 81.99
coord: 98..122
score: 57.35
coord: 129..151
score: 72.35
coord: 164..190
score: 61.39
coord: 218..247
score: 81.34
coord: 191..217
score: 67.63
IPR00030814-3-3 proteinPIRSFPIRSF00086814-3-3coord: 13..256
e-value: 1.6E-111
score: 369.0
IPR00030814-3-3 proteinPANTHERPTHR1886014-3-3 PROTEINcoord: 19..260
IPR02341014-3-3 domainSMARTSM001011433_4coord: 19..258
e-value: 5.3E-132
score: 454.5
IPR02341014-3-3 domainPFAMPF0024414-3-3coord: 26..245
e-value: 2.7E-99
score: 331.2
IPR03681514-3-3 domain superfamilyGENE3DG3DSA:1.20.190.20coord: 5..256
e-value: 1.3E-114
score: 383.8
IPR03681514-3-3 domain superfamilySUPERFAMILYSSF4844514-3-3 proteincoord: 19..247
IPR02340914-3-3 protein, conserved sitePROSITEPS007971433_2coord: 227..246
IPR02340914-3-3 protein, conserved sitePROSITEPS007961433_1coord: 57..67