Neuronal guanine nucleotide exchange factor

Overview
NameNeuronal guanine nucleotide exchange factor
Smed IDSMED30031446
Length (bp)2017
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuronal guanine nucleotide exchange factor (SMED30031446) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuronal guanine nucleotide exchange factor (SMED30031446) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuronal guanine nucleotide exchange factor (SMED30031446) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuronal guanine nucleotide exchange factor (SMED30031446) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031446

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031446h1SMcG0001953 dd_Smed_v4_5524_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30031446h1SMcG0001953 dd_Smed_v4_5524_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30031446h1SMcG0001953 dd_Smed_v4_5524_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031446h1SMcG0001953 dd_Smed_v4_5524_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031446h1SMcG0001953 dd_Smed_v4_5524_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031446h1SMcG0001953 dd_Smed_v4_5524_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Human
Match: NGEF (neuronal guanine nucleotide exchange factor [Source:HGNC Symbol;Acc:HGNC:7807])

HSP 1 Score: 125.176 bits (313), Expect = 2.214e-29
Identity = 104/359 (28.97%), Postives = 195/359 (54.32%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAK-IIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENG----NIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLLS 1723
            W +  +++S G+ + ++ EEIK QE+ FE+++SEASY +SL++L+  F        +E   I+ I+ P +   LFSN+L +  +S +FL +LE R  E+  I+D+ DIV +YA + F VY+ Y+ NQ +Q   Y +L +E A  + +I +LE  P+C  L   SFL+LP QR+ R+ LL++ +    + + +     +D A + +E ++  C+E    +   ++M+ I + ++FK     I      L+ +GE+++ +   + + +     F E +  L ++ L++ +    +  Y V D  S+    +  E +E+ G    N+F  +L  N + D    Y+++  ++   K+WM  L+
Sbjct:  160 WQDLPEIRSSGVLEILQPEEIKLQEAMFELVTSEASYYKSLNLLVSHF--------MENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLKLLVQNILKRVEERSERECTALD-AHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGD-KYQVFD--SAPRGLLRVEELEDQGQTLANVFILRLLENAD-DREATYMLKASSQSEMKRWMTSLA 505          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Human
Match: NGEF (neuronal guanine nucleotide exchange factor [Source:HGNC Symbol;Acc:HGNC:7807])

HSP 1 Score: 124.79 bits (312), Expect = 4.311e-29
Identity = 104/359 (28.97%), Postives = 195/359 (54.32%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAK-IIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENG----NIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLLS 1723
            W +  +++S G+ + ++ EEIK QE+ FE+++SEASY +SL++L+  F        +E   I+ I+ P +   LFSN+L +  +S +FL +LE R  E+  I+D+ DIV +YA + F VY+ Y+ NQ +Q   Y +L +E A  + +I +LE  P+C  L   SFL+LP QR+ R+ LL++ +    + + +     +D A + +E ++  C+E    +   ++M+ I + ++FK     I      L+ +GE+++ +   + + +     F E +  L ++ L++ +    +  Y V D  S+    +  E +E+ G    N+F  +L  N + D    Y+++  ++   K+WM  L+
Sbjct:  252 WQDLPEIRSSGVLEILQPEEIKLQEAMFELVTSEASYYKSLNLLVSHF--------MENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLKLLVQNILKRVEERSERECTALD-AHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGD-KYQVFD--SAPRGLLRVEELEDQGQTLANVFILRLLENAD-DREATYMLKASSQSEMKRWMTSLA 597          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Human
Match: ARHGEF15 (Rho guanine nucleotide exchange factor 15 [Source:HGNC Symbol;Acc:HGNC:15590])

HSP 1 Score: 111.309 bits (277), Expect = 7.735e-25
Identity = 82/238 (34.45%), Postives = 130/238 (54.62%), Query Frame = 2
Query:  653 RNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELK-KEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF 1363
            RN  W E   V++ GL   +  +E + QES FE+++SEASY RSL +L D F        V +  ++  + P     LFSN+ ++  +S +FLA L  R   S  I+DL D+V  +AV  F VYV Y++NQ++Q E Y+ L    +  +  +  L+S P+C  L L SFLLLP QR+ R+ +LL+ +    + +     E   KA+  + KII +CS     + + + ++ + + L F
Sbjct:  213 RNTLWQELPAVQASGLLDTLSPQERRMQESLFEVVTSEASYLRSLRLLTDTF--------VLSQALRDTLTPRDHHTLFSNVQRVQGVSERFLATLLSRVRSSPHISDLCDVVHAHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQSLPKCERLPLPSFLLLPFQRITRLRMLLQNILRQTE-EGSSRQENAQKALGAVSKIIERCSAEVGRMKQTEELIRLTQRLRF 441          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Human
Match: ARHGEF15 (Rho guanine nucleotide exchange factor 15 [Source:HGNC Symbol;Acc:HGNC:15590])

HSP 1 Score: 111.694 bits (278), Expect = 9.177e-25
Identity = 85/251 (33.86%), Postives = 133/251 (52.99%), Query Frame = 2
Query:  614 RKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNEL-KKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF 1363
            R PG         RN  W E   V++ GL   +  +E + QES FE+++SEASY RSL +L D F        V +  ++  + P     LFSN+ ++  +S +FLA L  R   S  I+DL D+V  +AV  F VYV Y++NQ++Q E Y+ L    +  +  +  L+S P+C  L L SFLLLP QR+ R+ +LL+ +    + +     E   KA+  + KII +CS     + + + ++ + + L F
Sbjct:  387 RPPGP--------RNTLWQELPAVQASGLLDTLSPQERRMQESLFEVVTSEASYLRSLRLLTDTF--------VLSQALRDTLTPRDHHTLFSNVQRVQGVSERFLATLLSRVRSSPHISDLCDVVHAHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQSLPKCERLPLPSFLLLPFQRITRLRMLLQNILRQTE-EGSSRQENAQKALGAVSKIIERCSAEVGRMKQTEELIRLTQRLRF 620          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Human
Match: ARHGEF15 (Rho guanine nucleotide exchange factor 15 [Source:HGNC Symbol;Acc:HGNC:15590])

HSP 1 Score: 111.694 bits (278), Expect = 9.177e-25
Identity = 85/251 (33.86%), Postives = 133/251 (52.99%), Query Frame = 2
Query:  614 RKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNEL-KKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF 1363
            R PG         RN  W E   V++ GL   +  +E + QES FE+++SEASY RSL +L D F        V +  ++  + P     LFSN+ ++  +S +FLA L  R   S  I+DL D+V  +AV  F VYV Y++NQ++Q E Y+ L    +  +  +  L+S P+C  L L SFLLLP QR+ R+ +LL+ +    + +     E   KA+  + KII +CS     + + + ++ + + L F
Sbjct:  387 RPPGP--------RNTLWQELPAVQASGLLDTLSPQERRMQESLFEVVTSEASYLRSLRLLTDTF--------VLSQALRDTLTPRDHHTLFSNVQRVQGVSERFLATLLSRVRSSPHISDLCDVVHAHAVGPFSVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQSLPKCERLPLPSFLLLPFQRITRLRMLLQNILRQTE-EGSSRQENAQKALGAVSKIIERCSAEVGRMKQTEELIRLTQRLRF 620          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Celegans
Match: ephx-1 (EPHeXin (Eph-interacting GEF) homolog [Source:UniProtKB/TrEMBL;Acc:A0A1D3PD25])

HSP 1 Score: 95.9005 bits (237), Expect = 2.105e-20
Identity = 55/157 (35.03%), Postives = 85/157 (54.14%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKE-IATAKIIEELESQPEC 1132
            W E  +V++ GL + +  E    QE+ FE+I+SEASY RSL+VLI  F  +PQM  + +     ++    ++HLFSNI  +   S + L DLE R  E+  + D+ DI++ +    F+VY+ Y  NQ +Q      LK E       ++ LE   +C
Sbjct:  149 WCELPEVRAAGLLEKLDDECKLRQEAYFEVITSEASYLRSLNVLITHFMASPQM--LGSKSALSVLSDSDRKHLFSNIFAVRDCSERLLCDLETRLEENLILDDICDILSDHFDKHFEVYIKYCSNQVYQDRTLRRLKTENPGFLSAVQRLEENKQC 303          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Celegans
Match: ephx-1 (EPHeXin (Eph-interacting GEF) homolog [Source:UniProtKB/TrEMBL;Acc:A0A1D3PD25])

HSP 1 Score: 95.9005 bits (237), Expect = 2.890e-20
Identity = 55/157 (35.03%), Postives = 85/157 (54.14%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKE-IATAKIIEELESQPEC 1132
            W E  +V++ GL + +  E    QE+ FE+I+SEASY RSL+VLI  F  +PQM  + +     ++    ++HLFSNI  +   S + L DLE R  E+  + D+ DI++ +    F+VY+ Y  NQ +Q      LK E       ++ LE   +C
Sbjct:  193 WCELPEVRAAGLLEKLDDECKLRQEAYFEVITSEASYLRSLNVLITHFMASPQM--LGSKSALSVLSDSDRKHLFSNIFAVRDCSERLLCDLETRLEENLILDDICDILSDHFDKHFEVYIKYCSNQVYQDRTLRRLKTENPGFLSAVQRLEENKQC 347          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Celegans
Match: ephx-1 (EPHeXin (Eph-interacting GEF) homolog [Source:UniProtKB/TrEMBL;Acc:A0A1D3PD25])

HSP 1 Score: 95.5153 bits (236), Expect = 4.660e-20
Identity = 55/157 (35.03%), Postives = 85/157 (54.14%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKE-IATAKIIEELESQPEC 1132
            W E  +V++ GL + +  E    QE+ FE+I+SEASY RSL+VLI  F  +PQM  + +     ++    ++HLFSNI  +   S + L DLE R  E+  + D+ DI++ +    F+VY+ Y  NQ +Q      LK E       ++ LE   +C
Sbjct:  520 WCELPEVRAAGLLEKLDDECKLRQEAYFEVITSEASYLRSLNVLITHFMASPQM--LGSKSALSVLSDSDRKHLFSNIFAVRDCSERLLCDLETRLEENLILDDICDILSDHFDKHFEVYIKYCSNQVYQDRTLRRLKTENPGFLSAVQRLEENKQC 674          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Celegans
Match: ephx-1 (EPHeXin (Eph-interacting GEF) homolog [Source:UniProtKB/TrEMBL;Acc:A0A1D3PD25])

HSP 1 Score: 95.5153 bits (236), Expect = 5.267e-20
Identity = 55/157 (35.03%), Postives = 85/157 (54.14%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKE-IATAKIIEELESQPEC 1132
            W E  +V++ GL + +  E    QE+ FE+I+SEASY RSL+VLI  F  +PQM  + +     ++    ++HLFSNI  +   S + L DLE R  E+  + D+ DI++ +    F+VY+ Y  NQ +Q      LK E       ++ LE   +C
Sbjct:  660 WCELPEVRAAGLLEKLDDECKLRQEAYFEVITSEASYLRSLNVLITHFMASPQM--LGSKSALSVLSDSDRKHLFSNIFAVRDCSERLLCDLETRLEENLILDDICDILSDHFDKHFEVYIKYCSNQVYQDRTLRRLKTENPGFLSAVQRLEENKQC 814          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Fly
Match: Exn (gene:FBgn0261547 transcript:FBtr0302647)

HSP 1 Score: 78.5666 bits (192), Expect = 1.170e-14
Identity = 75/256 (29.30%), Postives = 132/256 (51.56%), Query Frame = 2
Query:  617 KPGKICQELKENRNLK----WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNEL---KKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF 1363
            KP     +L E +N      W E  +V    +   +   E   QE++FEII+SEASY +SL++L   F N    + ++++    ++    ++ LFS I+ ++  S + L +LE  + ++  +  LS  + + A   F VYV + ++Q         L   K+ +A  + +E LE+ P CC L+L SFL+LPMQR+ R+ LL+ AV +   P  +   E     +  ++K++ +C+E  N  ++   +  I R L+F
Sbjct:  556 KPRPTALQLVEPKNGPSRTLWSEIPEVIHSCILPTLTSRERSLQEAKFEIITSEASYLKSLNLLRRHFMN--HNAFLDSS----VLSAKDRKALFSYIVPVHECSERLLTELEACWQDNIMLLGLSRCIYEIAERHFHVYVAFCEHQGRMDRTLRRLKESKESLAFQQHLERLEASPSCCGLNLHSFLMLPMQRITRLPLLIDAVFSKESPLNREEYESWKLTLALVQKVVGQCNEAANRWEQAFELERIARQLEF 805          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Fly
Match: Exn (gene:FBgn0261547 transcript:FBtr0302648)

HSP 1 Score: 78.5666 bits (192), Expect = 1.170e-14
Identity = 75/256 (29.30%), Postives = 132/256 (51.56%), Query Frame = 2
Query:  617 KPGKICQELKENRNLK----WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNEL---KKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF 1363
            KP     +L E +N      W E  +V    +   +   E   QE++FEII+SEASY +SL++L   F N    + ++++    ++    ++ LFS I+ ++  S + L +LE  + ++  +  LS  + + A   F VYV + ++Q         L   K+ +A  + +E LE+ P CC L+L SFL+LPMQR+ R+ LL+ AV +   P  +   E     +  ++K++ +C+E  N  ++   +  I R L+F
Sbjct:  556 KPRPTALQLVEPKNGPSRTLWSEIPEVIHSCILPTLTSRERSLQEAKFEIITSEASYLKSLNLLRRHFMN--HNAFLDSS----VLSAKDRKALFSYIVPVHECSERLLTELEACWQDNIMLLGLSRCIYEIAERHFHVYVAFCEHQGRMDRTLRRLKESKESLAFQQHLERLEASPSCCGLNLHSFLMLPMQRITRLPLLIDAVFSKESPLNREEYESWKLTLALVQKVVGQCNEAANRWEQAFELERIARQLEF 805          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Fly
Match: Exn (gene:FBgn0261547 transcript:FBtr0302649)

HSP 1 Score: 78.5666 bits (192), Expect = 1.170e-14
Identity = 75/256 (29.30%), Postives = 132/256 (51.56%), Query Frame = 2
Query:  617 KPGKICQELKENRNLK----WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNEL---KKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF 1363
            KP     +L E +N      W E  +V    +   +   E   QE++FEII+SEASY +SL++L   F N    + ++++    ++    ++ LFS I+ ++  S + L +LE  + ++  +  LS  + + A   F VYV + ++Q         L   K+ +A  + +E LE+ P CC L+L SFL+LPMQR+ R+ LL+ AV +   P  +   E     +  ++K++ +C+E  N  ++   +  I R L+F
Sbjct:  556 KPRPTALQLVEPKNGPSRTLWSEIPEVIHSCILPTLTSRERSLQEAKFEIITSEASYLKSLNLLRRHFMN--HNAFLDSS----VLSAKDRKALFSYIVPVHECSERLLTELEACWQDNIMLLGLSRCIYEIAERHFHVYVAFCEHQGRMDRTLRRLKESKESLAFQQHLERLEASPSCCGLNLHSFLMLPMQRITRLPLLIDAVFSKESPLNREEYESWKLTLALVQKVVGQCNEAANRWEQAFELERIARQLEF 805          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Fly
Match: Exn (gene:FBgn0261547 transcript:FBtr0302651)

HSP 1 Score: 77.411 bits (189), Expect = 3.496e-14
Identity = 75/256 (29.30%), Postives = 132/256 (51.56%), Query Frame = 2
Query:  617 KPGKICQELKENRNLK----WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNEL---KKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF 1363
            KP     +L E +N      W E  +V    +   +   E   QE++FEII+SEASY +SL++L   F N    + ++++    ++    ++ LFS I+ ++  S + L +LE  + ++  +  LS  + + A   F VYV + ++Q         L   K+ +A  + +E LE+ P CC L+L SFL+LPMQR+ R+ LL+ AV +   P  +   E     +  ++K++ +C+E  N  ++   +  I R L+F
Sbjct: 1534 KPRPTALQLVEPKNGPSRTLWSEIPEVIHSCILPTLTSRERSLQEAKFEIITSEASYLKSLNLLRRHFMN--HNAFLDSS----VLSAKDRKALFSYIVPVHECSERLLTELEACWQDNIMLLGLSRCIYEIAERHFHVYVAFCEHQGRMDRTLRRLKESKESLAFQQHLERLEASPSCCGLNLHSFLMLPMQRITRLPLLIDAVFSKESPLNREEYESWKLTLALVQKVVGQCNEAANRWEQAFELERIARQLEF 1783          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Fly
Match: Exn (gene:FBgn0261547 transcript:FBtr0302650)

HSP 1 Score: 77.411 bits (189), Expect = 3.496e-14
Identity = 75/256 (29.30%), Postives = 132/256 (51.56%), Query Frame = 2
Query:  617 KPGKICQELKENRNLK----WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNEL---KKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF 1363
            KP     +L E +N      W E  +V    +   +   E   QE++FEII+SEASY +SL++L   F N    + ++++    ++    ++ LFS I+ ++  S + L +LE  + ++  +  LS  + + A   F VYV + ++Q         L   K+ +A  + +E LE+ P CC L+L SFL+LPMQR+ R+ LL+ AV +   P  +   E     +  ++K++ +C+E  N  ++   +  I R L+F
Sbjct: 1534 KPRPTALQLVEPKNGPSRTLWSEIPEVIHSCILPTLTSRERSLQEAKFEIITSEASYLKSLNLLRRHFMN--HNAFLDSS----VLSAKDRKALFSYIVPVHECSERLLTELEACWQDNIMLLGLSRCIYEIAERHFHVYVAFCEHQGRMDRTLRRLKESKESLAFQQHLERLEASPSCCGLNLHSFLMLPMQRITRLPLLIDAVFSKESPLNREEYESWKLTLALVQKVVGQCNEAANRWEQAFELERIARQLEF 1783          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Zebrafish
Match: arhgef15 (Rho guanine nucleotide exchange factor (GEF) 15 [Source:ZFIN;Acc:ZDB-GENE-060526-292])

HSP 1 Score: 102.449 bits (254), Expect = 1.741e-22
Identity = 58/157 (36.94%), Postives = 97/157 (61.78%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKE-IATAKIIEELESQPEC 1132
            W +   VK  G+   + + E + QES FE+++SEASY RSL VL D F  + +++  ET  I      + ++ LFSN+L++Y +S +F+ DL +R  ES  I+D+SDI+ +++ N F VY+ Y++NQ++Q + Y++L +     A ++  LE  P C
Sbjct:   69 WQDLPVVKESGMLHKLTRTEKQRQESMFEVLTSEASYLRSLRVLKDHFLGSRELN--ETLVI------HDRKVLFSNLLQVYEVSERFIRDLLKRVDESVVISDVSDIIYEHSENHFSVYIDYVRNQQYQEKTYSKLMESNTDFAVVMRRLELSPLC 217          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Zebrafish
Match: ngef (neuronal guanine nucleotide exchange factor [Source:ZFIN;Acc:ZDB-GENE-130530-794])

HSP 1 Score: 102.834 bits (255), Expect = 2.769e-22
Identity = 105/362 (29.01%), Postives = 179/362 (49.45%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKE-IATAKIIEELESQPEC----CXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFKP-GKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENGNIFQ--FKLQINRNSDVCDV-YLIQTKNKESHKKWMNLLS 1723
            W   + VK  GL + ++ +EI  QE+ FE+++SEASY +SL +L   F   P   LV T      +       LFSNI  I   S KFL DLE R  ES  I+D+ DIV  +AVN F V++ Y+ NQ +Q   Y  + +E  A  + +  LE+QP+      +  L        +  L +  +LK V  N++ ++  ++     A Q +EKI+ +C+E    +   + ++ I + L+FK     +      L+ +GEV++ +   S + M     +   +  L +  LL+TK +     + V D CS S   +  E +E+ G +    F L++  N +  +V Y+++T++     +W+  L+
Sbjct:  250 WQNLDAVKKSGLLQTLEPKEIILQEAMFELVTSEASYYKSLELLETHFLRNPL--LVNT------LSQSDMHFLFSNITDIMKASEKFLMDLEHRIEESILISDVCDIVHFHAVNHFQVFISYVINQVYQETNYRRILQENCAFRENMAILENQPKVKGLSFTSFLILPFQRITRLKLLVQNILKRVEENSEKERTAIL-----AHQELEKIVKQCNEGARKMSRTEELISIEKTLEFKSKSVPVISHSRWLLKKGEVQQMSGPKSTRTMRSRKLYHPIYLFLFNNLLLITKRNSSGDKFQVLDSCSRS--MLRTEDLEDQGQMLACVFVLKLLENQEDREVSYMLKTESVSDKLRWICALT 596          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Zebrafish
Match: ngef (neuronal guanine nucleotide exchange factor [Source:ZFIN;Acc:ZDB-GENE-130530-794])

HSP 1 Score: 102.449 bits (254), Expect = 2.981e-22
Identity = 105/362 (29.01%), Postives = 179/362 (49.45%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKE-IATAKIIEELESQPEC----CXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFKP-GKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENGNIFQ--FKLQINRNSDVCDV-YLIQTKNKESHKKWMNLLS 1723
            W   + VK  GL + ++ +EI  QE+ FE+++SEASY +SL +L   F   P   LV T      +       LFSNI  I   S KFL DLE R  ES  I+D+ DIV  +AVN F V++ Y+ NQ +Q   Y  + +E  A  + +  LE+QP+      +  L        +  L +  +LK V  N++ ++  ++     A Q +EKI+ +C+E    +   + ++ I + L+FK     +      L+ +GEV++ +   S + M     +   +  L +  LL+TK +     + V D CS S   +  E +E+ G +    F L++  N +  +V Y+++T++     +W+  L+
Sbjct:  109 WQNLDAVKKSGLLQTLEPKEIILQEAMFELVTSEASYYKSLELLETHFLRNPL--LVNT------LSQSDMHFLFSNITDIMKASEKFLMDLEHRIEESILISDVCDIVHFHAVNHFQVFISYVINQVYQETNYRRILQENCAFRENMAILENQPKVKGLSFTSFLILPFQRITRLKLLVQNILKRVEENSEKERTAIL-----AHQELEKIVKQCNEGARKMSRTEELISIEKTLEFKSKSVPVISHSRWLLKKGEVQQMSGPKSTRTMRSRKLYHPIYLFLFNNLLLITKRNSSGDKFQVLDSCSRS--MLRTEDLEDQGQMLACVFVLKLLENQEDREVSYMLKTESVSDKLRWICALT 455          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Zebrafish
Match: arhgef15 (Rho guanine nucleotide exchange factor (GEF) 15 [Source:ZFIN;Acc:ZDB-GENE-060526-292])

HSP 1 Score: 102.834 bits (255), Expect = 4.040e-22
Identity = 58/157 (36.94%), Postives = 97/157 (61.78%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNEL-KKEIATAKIIEELESQPEC 1132
            W +   VK  G+   + + E + QES FE+++SEASY RSL VL D F  + +++  ET  I      + ++ LFSN+L++Y +S +F+ DL +R  ES  I+D+SDI+ +++ N F VY+ Y++NQ++Q + Y++L +     A ++  LE  P C
Sbjct:  470 WQDLPVVKESGMLHKLTRTEKQRQESMFEVLTSEASYLRSLRVLKDHFLGSRELN--ETLVI------HDRKVLFSNLLQVYEVSERFIRDLLKRVDESVVISDVSDIIYEHSENHFSVYIDYVRNQQYQEKTYSKLMESNTDFAVVMRRLELSPLC 618          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Zebrafish
Match: si:dkey-38p12.3 (si:dkey-38p12.3 [Source:ZFIN;Acc:ZDB-GENE-060810-103])

HSP 1 Score: 93.5893 bits (231), Expect = 1.602e-19
Identity = 104/323 (32.20%), Postives = 166/323 (51.39%), Query Frame = 2
Query:  635 QELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAY-NELKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAV--RTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFKPGKKIK--EQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVE 1588
            Q LK+N NL W E   V+  G+ + +  EE K+QES FE+I+SE SY RSL VL + F        VE++ +   +    K+ LFSNI++I  +S +FL DLE R  E+  I+D+ DI+  +A + F  Y+ Y++NQ +Q + Y N ++     A +I  L+  P+C  L   SFLLLP QR+ RI +L++ +  RT     ++       KA+  + KII +C+     + + + +++I   L+F   K +    Q   L  +GEV   NK  +            + F+     LL+  + K    Y V D+   S + V+
Sbjct:   56 QSLKQN-NL-WREQSAVRDSGVLEKLSPEECKYQESMFEVITSEMSYLRSLRVLTEHF--------VESSELNETLIIMDKKTLFSNIIRIQEVSERFLKDLEERLDENIIISDICDIIHYHAQHHFPAYIDYVRNQIYQEKTYSNLMQTNTQFATVITRLQESPKCQRLPFMSFLLLPFQRITRIKMLIENILKRTAVGTDKEQT---ASKALDSVSKIIEECNTQVGKMKQMEELIQINGMLEFDKLKAVPIISQTRYLEKQGEVLEVNKGGTFLGNLRPKFTPVYLFLFND--LLVIAIKKSAERYVVLDHAHRSLVQVQ 363          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Xenopus
Match: ARHGEF26 (Rho guanine nucleotide exchange factor 26 [Source:NCBI gene;Acc:100495357])

HSP 1 Score: 112.079 bits (279), Expect = 6.973e-25
Identity = 117/359 (32.59%), Postives = 186/359 (51.81%), Query Frame = 2
Query:  539 NNQEALNDIDLVDCIFKDDRSRNSSRKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAK-IIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK--PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEE 1606
            N +E   DID       D+ + +  +K  +I  E K  R+  W +   V+  GL++++ +EE K QE+ FE+ISSE SY  SL +LI  F N+ Q+S   T          +  HLFSNI  +Y  S KF  +LE R   +  I D+SDIV K+A   FD YV Y  N+ +Q      L    ++ K ++ ++ES  EC +L + SFL+LPMQR+ R+ LL+  +     P++    E    A++ + K++  C+E    ++  + M+ I   L+FK  P   +      L+  GE+    ++      S+    ++F+F L ++ L++TK  K E +YNV DYC   ++ VE    EE
Sbjct:  381 NYKEKALDID------SDEDADSKEQKEDRIIVEYKPLRS-TWSQLSVVRKNGLSQSVSQEERKRQEAMFEVISSEHSYLLSLEILIRMFKNSKQLSATMTKT--------ESHHLFSNITDVYEASKKFFKELEGRHQRNILIEDISDIVEKHAKATFDPYVKYCTNEVYQQRTLQRLILTNSSFKEVLSKIESHEECRNLPMISFLILPMQRVTRLPLLMDTI-CQKTPKESAKYEASKHALKEVGKLVRLCNEGARKMERMEMMVTINSQLEFKIKPFPLVSSSRW-LLKRGELTAYVED--TGIFSKRTTKQQFYFFLFNDVLIITK-KKSEESYNVTDYCLREKLLVEQNDNEE 719          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Xenopus
Match: ARHGEF26 (Rho guanine nucleotide exchange factor 26 [Source:NCBI gene;Acc:100495357])

HSP 1 Score: 111.694 bits (278), Expect = 8.022e-25
Identity = 117/359 (32.59%), Postives = 186/359 (51.81%), Query Frame = 2
Query:  539 NNQEALNDIDLVDCIFKDDRSRNSSRKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAK-IIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK--PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEE 1606
            N +E   DID       D+ + +  +K  +I  E K  R+  W +   V+  GL++++ +EE K QE+ FE+ISSE SY  SL +LI  F N+ Q+S   T          +  HLFSNI  +Y  S KF  +LE R   +  I D+SDIV K+A   FD YV Y  N+ +Q      L    ++ K ++ ++ES  EC +L + SFL+LPMQR+ R+ LL+  +     P++    E    A++ + K++  C+E    ++  + M+ I   L+FK  P   +      L+  GE+    ++      S+    ++F+F L ++ L++TK  K E +YNV DYC   ++ VE    EE
Sbjct:  381 NYKEKALDID------SDEDADSKEQKEDRIIVEYKPLRS-TWSQLSVVRKNGLSQSVSQEERKRQEAMFEVISSEHSYLLSLEILIRMFKNSKQLSATMTKT--------ESHHLFSNITDVYEASKKFFKELEGRHQRNILIEDISDIVEKHAKATFDPYVKYCTNEVYQQRTLQRLILTNSSFKEVLSKIESHEECRNLPMISFLILPMQRVTRLPLLMDTI-CQKTPKESAKYEASKHALKEVGKLVRLCNEGARKMERMEMMVTINSQLEFKIKPFPLVSSSRW-LLKRGELTAYVED--TGIFSKRTTKQQFYFFLFNDVLIITK-KKSEESYNVTDYCLREKLLVEQNDNEE 719          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Xenopus
Match: ARHGEF26 (Rho guanine nucleotide exchange factor 26 [Source:NCBI gene;Acc:100495357])

HSP 1 Score: 111.694 bits (278), Expect = 8.231e-25
Identity = 117/359 (32.59%), Postives = 186/359 (51.81%), Query Frame = 2
Query:  539 NNQEALNDIDLVDCIFKDDRSRNSSRKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAK-IIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK--PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEE 1606
            N +E   DID       D+ + +  +K  +I  E K  R+  W +   V+  GL++++ +EE K QE+ FE+ISSE SY  SL +LI  F N+ Q+S   T          +  HLFSNI  +Y  S KF  +LE R   +  I D+SDIV K+A   FD YV Y  N+ +Q      L    ++ K ++ ++ES  EC +L + SFL+LPMQR+ R+ LL+  +     P++    E    A++ + K++  C+E    ++  + M+ I   L+FK  P   +      L+  GE+    ++      S+    ++F+F L ++ L++TK  K E +YNV DYC   ++ VE    EE
Sbjct:  381 NYKEKALDID------SDEDADSKEQKEDRIIVEYKPLRS-TWSQLSVVRKNGLSQSVSQEERKRQEAMFEVISSEHSYLLSLEILIRMFKNSKQLSATMTKT--------ESHHLFSNITDVYEASKKFFKELEGRHQRNILIEDISDIVEKHAKATFDPYVKYCTNEVYQQRTLQRLILTNSSFKEVLSKIESHEECRNLPMISFLILPMQRVTRLPLLMDTI-CQKTPKESAKYEASKHALKEVGKLVRLCNEGARKMERMEMMVTINSQLEFKIKPFPLVSSSRW-LLKRGELTAYVED--TGIFSKRTTKQQFYFFLFNDVLIITK-KKSEESYNVTDYCLREKLLVEQNDNEE 719          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Xenopus
Match: NGEF (neuronal guanine nucleotide exchange factor [Source:NCBI gene;Acc:100487663])

HSP 1 Score: 107.071 bits (266), Expect = 1.975e-23
Identity = 106/391 (27.11%), Postives = 201/391 (51.41%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAK-IIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENG----NIFQFKLQINRNSDVCDVYLIQTKNKESHKKWM-NLLSNS*ERSEIVKM--------HIICIFIIISDE 1792
            W +   V+  G+   ++ EE+K QE+ FE+++SEASY +SL +++  F        +++  ++  +   +   +FSN+L++   S +FL  LE+RF E+  I+D+ DIV ++A   F VYV Y+ NQ +Q  AY +L +E    +  +  LE+ P C  L   SFL+LP QR+ R+ LL++ + T  +   +  +  + +A + +EK++  C++    +   ++++ I + L+FK     I      L+ +GE+++ +   + + +     F+  +  L ++ LLM K    E  Y V D  +     +  E +E+ G    N+F  KL  N +      Y+++  ++   K+WM +L+ N   R++ V M         + C+   +S E
Sbjct:  235 WQDLPDVRKSGVLALLQPEEVKLQEAMFELLTSEASYYKSLRLVVSHF--------MDSERLRASLHQSEIHFIFSNVLEVLATSERFLLALEQRFEENIVISDVCDIVYEHAEKHFVVYVTYVCNQTYQERAYRKLLQERPEFRESVGHLETDPVCRGLPFSSFLILPFQRITRLKLLVQNILTKVEEGSEREVSAL-QAHRELEKLVRACNDGVRKMSRTEQLISIEKTLEFKIKSVPIISHSRWLMKQGELQQMSGPRTSRTLRTKKLFRPVYLFLFNDLLLMCKPLTGE-RYQVFDVAARG--LLRVEELEDQGQTLANVFILKLLENAHEREF-TYMLKATSQSEMKRWMTSLVPN--RRTKFVSMSAKLLDCPQVQCVHPYVSQE 610          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Xenopus
Match: NGEF (neuronal guanine nucleotide exchange factor [Source:NCBI gene;Acc:100487663])

HSP 1 Score: 106.301 bits (264), Expect = 2.349e-23
Identity = 106/391 (27.11%), Postives = 201/391 (51.41%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAK-IIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENG----NIFQFKLQINRNSDVCDVYLIQTKNKESHKKWM-NLLSNS*ERSEIVKM--------HIICIFIIISDE 1792
            W +   V+  G+   ++ EE+K QE+ FE+++SEASY +SL +++  F        +++  ++  +   +   +FSN+L++   S +FL  LE+RF E+  I+D+ DIV ++A   F VYV Y+ NQ +Q  AY +L +E    +  +  LE+ P C  L   SFL+LP QR+ R+ LL++ + T  +   +  +  + +A + +EK++  C++    +   ++++ I + L+FK     I      L+ +GE+++ +   + + +     F+  +  L ++ LLM K    E  Y V D  +     +  E +E+ G    N+F  KL  N +      Y+++  ++   K+WM +L+ N   R++ V M         + C+   +S E
Sbjct:  144 WQDLPDVRKSGVLALLQPEEVKLQEAMFELLTSEASYYKSLRLVVSHF--------MDSERLRASLHQSEIHFIFSNVLEVLATSERFLLALEQRFEENIVISDVCDIVYEHAEKHFVVYVTYVCNQTYQERAYRKLLQERPEFRESVGHLETDPVCRGLPFSSFLILPFQRITRLKLLVQNILTKVEEGSEREVSAL-QAHRELEKLVRACNDGVRKMSRTEQLISIEKTLEFKIKSVPIISHSRWLMKQGELQQMSGPRTSRTLRTKKLFRPVYLFLFNDLLLMCKPLTGE-RYQVFDVAARG--LLRVEELEDQGQTLANVFILKLLENAHEREF-TYMLKATSQSEMKRWMTSLVPN--RRTKFVSMSAKLLDCPQVQCVHPYVSQE 519          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Mouse
Match: Ngef (neuronal guanine nucleotide exchange factor [Source:MGI Symbol;Acc:MGI:1858414])

HSP 1 Score: 122.865 bits (307), Expect = 9.389e-29
Identity = 103/359 (28.69%), Postives = 195/359 (54.32%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAK-IIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENG----NIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLLS 1723
            W +  +++S G+   ++ EEI+ QE+ FE+++SEASY +SL++L+  F        +E   +K I+ P +   LFSN+L +  +S +FL +LE R  E+  I+D+ DIV +YA + F VY+ Y+ NQ +Q   Y +L +E A  + +I +LE  P+C  L   SFL+LP QR+ R+ LL++ +    + + +     +D A + +E ++  C+E    +   ++M+ I + ++FK     I      L+ +GE+++ +   + + +     F+E +  L ++ L++ +    +  Y V D  S+    +  E +E+ G    N+F  +L  N + D    Y+++  ++   K+WM  L+
Sbjct:  162 WQDLPEIQSSGVLDILQPEEIRLQEAMFELVTSEASYYKSLNLLVSHF--------MENERLKKILHPSEAHILFSNVLDVMAVSERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCKGLPFSSFLILPFQRITRLKLLVQNILKRVEERSEREGTALD-AHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFREIYLFLFNDLLVICRQIPGD-KYQVFD--SAPRGLLRVEELEDQGQTLANVFILRLLENAD-DREATYMLKASSQSEMKRWMTSLA 507          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Mouse
Match: Ngef (neuronal guanine nucleotide exchange factor [Source:MGI Symbol;Acc:MGI:1858414])

HSP 1 Score: 122.094 bits (305), Expect = 2.112e-28
Identity = 103/359 (28.69%), Postives = 195/359 (54.32%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAK-IIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENG----NIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLLS 1723
            W +  +++S G+   ++ EEI+ QE+ FE+++SEASY +SL++L+  F        +E   +K I+ P +   LFSN+L +  +S +FL +LE R  E+  I+D+ DIV +YA + F VY+ Y+ NQ +Q   Y +L +E A  + +I +LE  P+C  L   SFL+LP QR+ R+ LL++ +    + + +     +D A + +E ++  C+E    +   ++M+ I + ++FK     I      L+ +GE+++ +   + + +     F+E +  L ++ L++ +    +  Y V D  S+    +  E +E+ G    N+F  +L  N + D    Y+++  ++   K+WM  L+
Sbjct:  252 WQDLPEIQSSGVLDILQPEEIRLQEAMFELVTSEASYYKSLNLLVSHF--------MENERLKKILHPSEAHILFSNVLDVMAVSERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCKGLPFSSFLILPFQRITRLKLLVQNILKRVEERSEREGTALD-AHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFREIYLFLFNDLLVICRQIPGD-KYQVFD--SAPRGLLRVEELEDQGQTLANVFILRLLENAD-DREATYMLKASSQSEMKRWMTSLA 597          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Mouse
Match: Arhgef15 (Rho guanine nucleotide exchange factor (GEF) 15 [Source:MGI Symbol;Acc:MGI:3045246])

HSP 1 Score: 114.005 bits (284), Expect = 1.338e-25
Identity = 83/242 (34.30%), Postives = 133/242 (54.96%), Query Frame = 2
Query:  641 LKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNEL-KKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF 1363
            L   RN  W E   V+  GL +++  +E + QES FE+++SEASY RSL +L D F        V +  ++  + P     LFSN+ ++ ++S +FL  L  R   S  ITDL D+V  +AV  F VYV Y++NQ++Q E Y+ L    +  +  +  L+S P+C  L L SFLLLP QR+ R+ +LL+ + +  + +     E   KA+  + KII +CS     + + + ++ + + L F
Sbjct:  396 LPGPRNTLWQELPAVRGSGLLESLSPQERRMQESLFEVVTSEASYLRSLRLLTDTF--------VLSQALRDTLTPRDHHTLFSNVQRVQSVSERFLGTLLSRVRSSPHITDLCDVVHAHAVGPFFVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQSLPKCERLPLPSFLLLPFQRITRLRMLLQNILSQTE-EGSSRQENAQKALGAVSKIIERCSAEVGRMKQTEELIRLTQRLRF 628          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Mouse
Match: Arhgef15 (Rho guanine nucleotide exchange factor (GEF) 15 [Source:MGI Symbol;Acc:MGI:3045246])

HSP 1 Score: 114.005 bits (284), Expect = 1.338e-25
Identity = 83/242 (34.30%), Postives = 133/242 (54.96%), Query Frame = 2
Query:  641 LKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNEL-KKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF 1363
            L   RN  W E   V+  GL +++  +E + QES FE+++SEASY RSL +L D F        V +  ++  + P     LFSN+ ++ ++S +FL  L  R   S  ITDL D+V  +AV  F VYV Y++NQ++Q E Y+ L    +  +  +  L+S P+C  L L SFLLLP QR+ R+ +LL+ + +  + +     E   KA+  + KII +CS     + + + ++ + + L F
Sbjct:  396 LPGPRNTLWQELPAVRGSGLLESLSPQERRMQESLFEVVTSEASYLRSLRLLTDTF--------VLSQALRDTLTPRDHHTLFSNVQRVQSVSERFLGTLLSRVRSSPHITDLCDVVHAHAVGPFFVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQSLPKCERLPLPSFLLLPFQRITRLRMLLQNILSQTE-EGSSRQENAQKALGAVSKIIERCSAEVGRMKQTEELIRLTQRLRF 628          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Mouse
Match: Arhgef26 (Rho guanine nucleotide exchange factor (GEF) 26 [Source:MGI Symbol;Acc:MGI:1918053])

HSP 1 Score: 107.457 bits (267), Expect = 1.530e-23
Identity = 114/400 (28.50%), Postives = 197/400 (49.25%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIAT----AKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF--KPGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVE-------------------YETIEENGNIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLLSNS-----*ERSEIVKMHIICIF 1774
            W +   VK  GL++ + +EE K QE+ FE+ISSE SY  SL +LI  F N+ +++   T          ++ HLFSNI  ++  S KF  +LE R   +  I D+SDIV K+  + FD YV Y  N+ +Q      L+K +AT     +++  +ES  +C +L + SFL+LPMQR+ R+ LL+  +     P+     E+  +A++ + K++  C+E    ++  + M  I   L+F  KP   +      L+  GE+    ++      S+ M  ++ +F L ++ L++TK  K E +YNV+DY    ++ VE                   Y       ++F   +  N  S+  D+ L+  + +    +W+  L +S      +R+ + ++ II  F
Sbjct:  416 WSQLSAVKRNGLSQTVSQEERKRQEAIFEVISSEHSYLLSLEILIRMFKNSKELTDTMTK--------TERHHLFSNITDVWEASKKFFTELEARHQNNIFIEDISDIVEKHTASTFDPYVKYCTNEVYQQRT---LQKLLATNPSFKEVLSRIESHEDCRNLPMISFLILPMQRVTRLPLLMDTI-CQKTPKDSPKYEVCKRALKEVSKLVRLCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRW-LVKRGELTAYVED--TVLFSKRMSKQQVYFFLFNDVLIITK-KKSEESYNVNDYSLRDQLLVESCDNEELNSSPGKNPSTMLYSRQSSATHLFTLTVLSNHASEKVDM-LLGAETQSERARWITALGHSSGKQPPDRTTLTQVEIIRSF 798          
BLAST of Neuronal guanine nucleotide exchange factor vs. UniProt/SwissProt
Match: sp|Q5RDX5|NGEF_PONAB (Ephexin-1 OS=Pongo abelii OX=9601 GN=NGEF PE=2 SV=1)

HSP 1 Score: 125.561 bits (314), Expect = 1.358e-28
Identity = 104/359 (28.97%), Postives = 195/359 (54.32%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAK-IIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENG----NIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLLS 1723
            W +  +++S G+ + ++ EEIK QE+ FE+++SEASY +SL++L+  F        +E   I+ I+ P +   LFSN+L +  +S +FL +LE R  E+  I+D+ DIV +YA + F VY+ Y+ NQ +Q   Y +L +E A  + +I +LE  P+C  L   SFL+LP QR+ R+ LL++ +    + + +     +D A + +E ++  C+E    +   ++M+ I + ++FK     I      L+ +GE+++ +   + + +     F E +  L ++ L++ +    +  Y V D  S+    +  E +E+ G    N+F  +L  N + D    Y+++  ++   K+WM  L+
Sbjct:  251 WQDLPEIRSSGVLEILQPEEIKLQEAMFELVTSEASYYKSLNLLVSHF--------MENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLKLLVQNILKRVEERSERECTALD-AHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGD-KYQVFD--SAPRGLLRVEELEDQGQTLANVFILRLLENAD-DREATYMLKASSQSEMKRWMTSLA 596          
BLAST of Neuronal guanine nucleotide exchange factor vs. UniProt/SwissProt
Match: sp|Q8N5V2|NGEF_HUMAN (Ephexin-1 OS=Homo sapiens OX=9606 GN=NGEF PE=1 SV=2)

HSP 1 Score: 124.79 bits (312), Expect = 2.070e-28
Identity = 104/359 (28.97%), Postives = 195/359 (54.32%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAK-IIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENG----NIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLLS 1723
            W +  +++S G+ + ++ EEIK QE+ FE+++SEASY +SL++L+  F        +E   I+ I+ P +   LFSN+L +  +S +FL +LE R  E+  I+D+ DIV +YA + F VY+ Y+ NQ +Q   Y +L +E A  + +I +LE  P+C  L   SFL+LP QR+ R+ LL++ +    + + +     +D A + +E ++  C+E    +   ++M+ I + ++FK     I      L+ +GE+++ +   + + +     F E +  L ++ L++ +    +  Y V D  S+    +  E +E+ G    N+F  +L  N + D    Y+++  ++   K+WM  L+
Sbjct:  252 WQDLPEIRSSGVLEILQPEEIKLQEAMFELVTSEASYYKSLNLLVSHF--------MENERIRKILHPSEAHILFSNVLDVLAVSERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCRGLPFSSFLILPFQRITRLKLLVQNILKRVEERSERECTALD-AHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFHEIYLFLFNDLLVICRQIPGD-KYQVFD--SAPRGLLRVEELEDQGQTLANVFILRLLENAD-DREATYMLKASSQSEMKRWMTSLA 597          
BLAST of Neuronal guanine nucleotide exchange factor vs. UniProt/SwissProt
Match: sp|Q8CHT1|NGEF_MOUSE (Ephexin-1 OS=Mus musculus OX=10090 GN=Ngef PE=1 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 1.586e-27
Identity = 103/359 (28.69%), Postives = 195/359 (54.32%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAK-IIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENG----NIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLLS 1723
            W +  +++S G+   ++ EEI+ QE+ FE+++SEASY +SL++L+  F        +E   +K I+ P +   LFSN+L +  +S +FL +LE R  E+  I+D+ DIV +YA + F VY+ Y+ NQ +Q   Y +L +E A  + +I +LE  P+C  L   SFL+LP QR+ R+ LL++ +    + + +     +D A + +E ++  C+E    +   ++M+ I + ++FK     I      L+ +GE+++ +   + + +     F+E +  L ++ L++ +    +  Y V D  S+    +  E +E+ G    N+F  +L  N + D    Y+++  ++   K+WM  L+
Sbjct:  252 WQDLPEIQSSGVLDILQPEEIRLQEAMFELVTSEASYYKSLNLLVSHF--------MENERLKKILHPSEAHILFSNVLDVMAVSERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKAAFRELIAQLELDPKCKGLPFSSFLILPFQRITRLKLLVQNILKRVEERSEREGTALD-AHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFREIYLFLFNDLLVICRQIPGD-KYQVFD--SAPRGLLRVEELEDQGQTLANVFILRLLENAD-DREATYMLKASSQSEMKRWMTSLA 597          
BLAST of Neuronal guanine nucleotide exchange factor vs. UniProt/SwissProt
Match: sp|Q5BKC9|NGEF_RAT (Ephexin-1 OS=Rattus norvegicus OX=10116 GN=Ngef PE=1 SV=2)

HSP 1 Score: 120.168 bits (300), Expect = 6.226e-27
Identity = 104/359 (28.97%), Postives = 194/359 (54.04%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKE-IATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENG----NIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLLS 1723
            W +  +++S G+   ++ EE K QE+ FE+++SEASY +SL++L+  F        +E   +K I+ P +   LFSN+L +  +S +FL +LE R  E+  I+D+ DIV +YA + F VY+ Y+ NQ +Q   Y +L +E  A  ++I +LE  P+C  L L SFL+LP QR+ R+ LL++ +    +   +     +D A + +E ++  C+E    +   ++M+ I + ++FK     I      L+ +GE+++ +   + + +     F+E +  L ++ L++ +    +  Y V D  S+    +  E +E+ G    N+F  +L  N + D    Y+++  ++   K+WM  L+
Sbjct:  243 WQDLPEIQSSGVLDILQPEETKLQEAMFELVTSEASYYKSLNLLVSHF--------MENERLKKILHPSEAHILFSNVLDVMAVSERFLLELEHRMEENIVISDVCDIVYRYAADHFSVYITYVSNQTYQERTYKQLLQEKTAFRELIAQLELDPKCKGLPLSSFLILPFQRITRLKLLVQNILKRVEEGSEREGTALD-AHKELEMVVKACNEGVRKMSRTEQMISIQKKMEFKIKSVPIISHSRWLLKQGELQQMSGPKTSRTLRTKKLFREIYLFLFNDLLVICRQIPGD-KYQVFD--SAPRGLLRVEELEDQGQTLANVFILRLLENAD-DREATYMLKASSQSEMKRWMTSLA 588          
BLAST of Neuronal guanine nucleotide exchange factor vs. UniProt/SwissProt
Match: sp|Q5FWH6|ARHGF_MOUSE (Rho guanine nucleotide exchange factor 15 OS=Mus musculus OX=10090 GN=Arhgef15 PE=1 SV=1)

HSP 1 Score: 114.005 bits (284), Expect = 9.361e-25
Identity = 83/242 (34.30%), Postives = 133/242 (54.96%), Query Frame = 2
Query:  641 LKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNEL-KKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF 1363
            L   RN  W E   V+  GL +++  +E + QES FE+++SEASY RSL +L D F        V +  ++  + P     LFSN+ ++ ++S +FL  L  R   S  ITDL D+V  +AV  F VYV Y++NQ++Q E Y+ L    +  +  +  L+S P+C  L L SFLLLP QR+ R+ +LL+ + +  + +     E   KA+  + KII +CS     + + + ++ + + L F
Sbjct:  396 LPGPRNTLWQELPAVRGSGLLESLSPQERRMQESLFEVVTSEASYLRSLRLLTDTF--------VLSQALRDTLTPRDHHTLFSNVQRVQSVSERFLGTLLSRVRSSPHITDLCDVVHAHAVGPFFVYVDYVRNQQYQEETYSRLMDTNVRFSAELRRLQSLPKCERLPLPSFLLLPFQRITRLRMLLQNILSQTE-EGSSRQENAQKALGAVSKIIERCSAEVGRMKQTEELIRLTQRLRF 628          
BLAST of Neuronal guanine nucleotide exchange factor vs. TrEMBL
Match: A0A401PDJ3 (Uncharacterized protein OS=Scyliorhinus torazame OX=75743 GN=scyTo_0005868 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 1.706e-31
Identity = 115/359 (32.03%), Postives = 195/359 (54.32%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNE-LKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENG----NIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLLS 1723
            W   E+V++  +   + ++EIK QE+ FE+++SEASYN+SL +LI  F  + Q+S          + P +K H+FSNIL I   S +F  DLE R  E   I+D+ DIV ++ VN F+VY+PY+ NQ +Q  AY   ++  +    ++ ELE  P+C  L   SFL+LP QR+ R+ LL++ +   A+ + K     V KA + +EK+I +CSE    +   ++++   + L+FK     I  Q   L+ +GE+++ +   + +   +   FK  + IL ++  L+TK       Y V DY       +  + +E+ G    NIF  +L +  N+D    Y+++ K+    K+W++ L+
Sbjct:  292 WQNLEKVRNSTVLSTLSRKEIKLQEAMFELVTSEASYNKSLEILIFHFMKSEQLS--------EALSPTEKHHIFSNILDIKAASERFFRDLEHRIEEDIVISDVCDIVYEHTVNHFNVYIPYVTNQSYQEAAYRRAMEHNLQFRNVMAELERDPKCRGLPFPSFLILPFQRITRLKLLVQNILKTAEEESKRESSAV-KAHRELEKVIKECSERVKKMGRTEQLINFEKKLEFKIKAVPIISQSRWLLKKGELEQMSGQKATRTFRKKKLFKPVYLILFNDLFLITKKHSYGDRYEVFDYALRG--LLRVQELEDQGQALANIFMLRL-LENNNDREVQYMLKAKSLSDKKRWVHALA 638          
BLAST of Neuronal guanine nucleotide exchange factor vs. TrEMBL
Match: A0A401T0V1 (Uncharacterized protein OS=Chiloscyllium punctatum OX=137246 GN=chiPu_0014772 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 7.090e-31
Identity = 115/358 (32.12%), Postives = 193/358 (53.91%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNE-LKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENG----NIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLL 1720
            W   E+V++  +   + ++EIK QE+ FE+++SEASY +SL +L+  F  + Q+S          + P +K H+FSNIL I   S +F  DLE R  E   I+D+ DIV ++ VN F+VY+PY+ NQ +Q  AY   ++  +    ++ ELE  P+C  L   SFL+LP QR+ R+ LL++ +   A+ + K     V KA + +EK+I +CSE    +   ++++   + LDFK     I  Q   L+ EGE+++ +   + +   +   FK    IL ++  L+TK       Y V DY       +  + +E+ G    NIF  +L +  N+D    Y+++ K++   K+W++ L
Sbjct:  343 WQNLEKVRNSTVLSTLSRKEIKLQEAMFELVTSEASYYKSLEILVFHFMKSEQLS--------EALSPIEKHHIFSNILDIKAASERFFRDLEHRIEEDIVISDVCDIVYEHTVNHFNVYIPYVTNQSYQEAAYRRAMENNLQFRNVMAELEKDPKCRGLPFPSFLILPFQRITRLKLLVQNILKTAEEESKRESTAV-KAHKELEKVIKECSERVKKMGRTEQLISFEKKLDFKVKAVPIISQSRWLLKEGELEQMSGQKATRTFRKKKLFKPVHLILFNDLFLITKKHSYGDRYEVFDYALRG--LLRVQELEDQGQALANIFMLRL-LENNNDREVQYMLKAKSQSDKKRWVHAL 688          
BLAST of Neuronal guanine nucleotide exchange factor vs. TrEMBL
Match: A0A5K4E9M8 (Putative guanine-nucleotide-exchange-factor OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.033e-31
Identity = 124/364 (34.07%), Postives = 193/364 (53.02%), Query Frame = 2
Query:  593 DRSRN--SSRKPGKICQELKENRN---------LKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVK-------RSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENGNIFQF 1627
            +RS+N  S+ KP +  QE++   N         ++W E  QV S  LA+++   + K QE+ FE+I+SEASY R+L +LI+KFY AP M   + +    +I   +K HLFSNI +I+  S  FL D+E  F ++  I  L +I+ ++  N F+ YV Y+QNQ +Q     +L    A  + +  ++ QP C  L L+SFLLLPMQR+ R+ LLL A+   A P+     +    A+  IEK+I KC   K  +++++R++EI R L++K   K +  +   L+ EG+++       + +    +       K       L S+YLL+TK  +      V+D CS S I VE      N  I  F
Sbjct:  236 ERSKNQSSASKPRRQTQEVQNFVNEVAGTGPNRVQWSEMPQVISADLARDLPDYQKKLQEALFEVITSEASYYRTLHILIEKFYKAPCM---QPDSKTSVITAIEKRHLFSNISEIFFTSETFLRDMELYFIQNPLIPQLCEIIYEHTENHFENYVKYVQNQMYQLRTLTKLLSSPAFVEAVRSIQQQPSCGFLDLNSFLLLPMQRVTRLRLLLTAILHYA-PKNGVTYQSGLVALASIEKLISKCDSEKARMEQKERLVEICRRLEYKYDAKSLATESRTLVKEGDLRLLTMTNVQGSGFHRRFSSIRKSKATIATLFLFSDYLLITK-KRSNQHLLVEDSCSLSYIHVEAHNALPNCFIHHF 594          
BLAST of Neuronal guanine nucleotide exchange factor vs. TrEMBL
Match: A0A3Q0KCF1 (Putative guanine-nucleotide-exchange-factor OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.233e-31
Identity = 124/364 (34.07%), Postives = 193/364 (53.02%), Query Frame = 2
Query:  593 DRSRN--SSRKPGKICQELKENRN---------LKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVK-------RSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENGNIFQF 1627
            +RS+N  S+ KP +  QE++   N         ++W E  QV S  LA+++   + K QE+ FE+I+SEASY R+L +LI+KFY AP M   + +    +I   +K HLFSNI +I+  S  FL D+E  F ++  I  L +I+ ++  N F+ YV Y+QNQ +Q     +L    A  + +  ++ QP C  L L+SFLLLPMQR+ R+ LLL A+   A P+     +    A+  IEK+I KC   K  +++++R++EI R L++K   K +  +   L+ EG+++       + +    +       K       L S+YLL+TK    +    V+D CS S I VE      N  I  F
Sbjct:  312 ERSKNQSSASKPRRQTQEVQNFVNEVAGTGPNRVQWSEMPQVISADLARDLPDYQKKLQEALFEVITSEASYYRTLHILIEKFYKAPCM---QPDSKTSVITAIEKRHLFSNISEIFFTSETFLRDMELYFIQNPLIPQLCEIIYEHTENHFENYVKYVQNQMYQLRTLTKLLSSPAFVEAVRSIQQQPSCGFLDLNSFLLLPMQRVTRLRLLLTAILHYA-PKNGVTYQSGLVALASIEKLISKCDSEKARMEQKERLVEICRRLEYKYDAKSLATESRTLVKEGDLRLLTMTNVQGSGFHRRFSSIRKSKATIATLFLFSDYLLITKKRSNQHLL-VEDSCSLSYIHVEAHNALPNCFIHHF 670          
BLAST of Neuronal guanine nucleotide exchange factor vs. TrEMBL
Match: G4V979 (Putative guanine-nucleotide-exchange-factor OS=Schistosoma mansoni OX=6183 GN=Smp_012580 PE=4 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 8.821e-31
Identity = 124/364 (34.07%), Postives = 193/364 (53.02%), Query Frame = 2
Query:  593 DRSRN--SSRKPGKICQELKENRN---------LKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVK-------RSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENGNIFQF 1627
            +RS+N  S+ KP +  QE++   N         ++W E  QV S  LA+++   + K QE+ FE+I+SEASY R+L +LI+KFY AP M   + +    +I   +K HLFSNI +I+  S  FL D+E  F ++  I  L +I+ ++  N F+ YV Y+QNQ +Q     +L    A  + +  ++ QP C  L L+SFLLLPMQR+ R+ LLL A+   A P+     +    A+  IEK+I KC   K  +++++R++EI R L++K   K +  +   L+ EG+++       + +    +       K       L S+YLL+TK    +    V+D CS S I VE      N  I  F
Sbjct:  316 ERSKNQSSASKPRRQTQEVQNFVNEVAGTGPNRVQWSEMPQVISADLARDLPDYQKKLQEALFEVITSEASYYRTLHILIEKFYKAPCM---QPDSKTSVITAIEKRHLFSNISEIFFTSETFLRDMELYFIQNPLIPQLCEIIYEHTENHFENYVKYVQNQMYQLRTLTKLLSSPAFVEAVRSIQQQPSCGFLDLNSFLLLPMQRVTRLRLLLTAILHYA-PKNGVTYQSGLVALASIEKLISKCDSEKARMEQKERLVEICRRLEYKYDAKSLATESRTLVKEGDLRLLTMTNVQGSGFHRRFSSIRKSKATIATLFLFSDYLLITKKRSNQHLL-VEDSCSLSYIHVEAHNALPNCFIHHF 674          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Cavefish
Match: si:dkey-38p12.3 (rho guanine nucleotide exchange factor 15-like [Source:NCBI gene;Acc:103030780])

HSP 1 Score: 106.301 bits (264), Expect = 3.153e-23
Identity = 84/244 (34.43%), Postives = 134/244 (54.92%), Query Frame = 2
Query:  653 RNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNEL-KKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVD------KAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF 1363
            +N  W +   VK  G+ + +  EE K+QES FE+++SE SY RSL VL + F        +E+  +   +    K+ LFSNIL+I  +S KFL DLE R  ES  ++D+ DI++ +A + F  Y+ Y++NQ +Q + Y+ L +     A +I  L+  P C  L   SFLLLP QR+ RI +L++ +        K  +E  D      KA+  + KII +C+     + + + ++EI + L+F
Sbjct:  548 QNTLWQDLPSVKESGILQKLTPEECKYQESMFEVMTSEVSYLRSLRVLTEHF--------LESRELNDTLIVLDKKTLFSNILRIREVSEKFLKDLENRLDESLVVSDICDIISYHAQHNFPAYIDYVRNQIYQDKTYSTLMQTNTQFATVISRLQESPRCQRLPFMSFLLLPFQRITRIKILVENIL-------KRTVEGTDKEESASKALSAVSKIIEECNSQVGKMKQMEELIEINKMLEF 776          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Cavefish
Match: arhgef16 (rho guanine nucleotide exchange factor 16 [Source:NCBI gene;Acc:103040535])

HSP 1 Score: 100.523 bits (249), Expect = 1.152e-21
Identity = 103/360 (28.61%), Postives = 179/360 (49.72%), Query Frame = 2
Query:  659 LKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNE-LKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF---KPGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENGNIFQF-KLQINRNSDV-CDVYLIQTKNKESHKKWMNLL 1720
            + W +   V+  G+ + +  EE K QE  FEI++SE SY  SLS+L+  F          ++ ++  +   +  HLFSNI  I  +S +F  +LERR      I D+SDIV  YA N F  Y+ Y  N+ FQ     + L    A  ++++++ES PEC  L + SFL+LPMQR  R+ LL+  +     P+Q         A++ I K++  C++    ++  ++M  I + ++F   KP   +      L+ +GE+  + +        ++   K +W  + ++ L++TK  K E +Y V DY +   +    E +EE  +   + +L +  NS+  C+     ++NK    +W+  L
Sbjct:  235 VTWSQLPVVQEMGILETISPEERKRQEVIFEIMTSEYSYLHSLSILVRHFK--------ASDDLRKAMTATEHHHLFSNISVIQAVSKRFFEELERRHQLDPVIKDISDIVQDYAANHFKPYIVYCSNETFQQRTLQKLLASNTAFKEVLKKIESSPECGGLPMISFLILPMQRATRLPLLMDTI-CQKTPKQTTNYYAARWALKEISKLVKSCNDGARRMERTEQMYTIQKQMEFGRIKPFPLVSASRW-LLKKGELAINLEE--LGLFWKAFSHKSYWLFVFNDVLIVTK-RKSEESYVVCDYATLENV----EVVEEQADSKHYLRLTMKPNSEGRCEQMAFVSENKLDRARWVTAL 577          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Cavefish
Match: arhgef16 (rho guanine nucleotide exchange factor 16 [Source:NCBI gene;Acc:103040535])

HSP 1 Score: 100.523 bits (249), Expect = 1.152e-21
Identity = 103/360 (28.61%), Postives = 179/360 (49.72%), Query Frame = 2
Query:  659 LKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNE-LKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF---KPGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENGNIFQF-KLQINRNSDV-CDVYLIQTKNKESHKKWMNLL 1720
            + W +   V+  G+ + +  EE K QE  FEI++SE SY  SLS+L+  F          ++ ++  +   +  HLFSNI  I  +S +F  +LERR      I D+SDIV  YA N F  Y+ Y  N+ FQ     + L    A  ++++++ES PEC  L + SFL+LPMQR  R+ LL+  +     P+Q         A++ I K++  C++    ++  ++M  I + ++F   KP   +      L+ +GE+  + +        ++   K +W  + ++ L++TK  K E +Y V DY +   +    E +EE  +   + +L +  NS+  C+     ++NK    +W+  L
Sbjct:  235 VTWSQLPVVQEMGILETISPEERKRQEVIFEIMTSEYSYLHSLSILVRHFK--------ASDDLRKAMTATEHHHLFSNISVIQAVSKRFFEELERRHQLDPVIKDISDIVQDYAANHFKPYIVYCSNETFQQRTLQKLLASNTAFKEVLKKIESSPECGGLPMISFLILPMQRATRLPLLMDTI-CQKTPKQTTNYYAARWALKEISKLVKSCNDGARRMERTEQMYTIQKQMEFGRIKPFPLVSASRW-LLKKGELAINLEE--LGLFWKAFSHKSYWLFVFNDVLIVTK-RKSEESYVVCDYATLENV----EVVEEQADSKHYLRLTMKPNSEGRCEQMAFVSENKLDRARWVTAL 577          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Cavefish
Match: ngef (neuronal guanine nucleotide exchange factor [Source:ZFIN;Acc:ZDB-GENE-130530-794])

HSP 1 Score: 98.2117 bits (243), Expect = 5.071e-21
Identity = 110/352 (31.25%), Postives = 182/352 (51.70%), Query Frame = 2
Query:  683 VKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAKI-IEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFKP-GKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENGNI--FQFKLQINRNSDVCDV-YLIQTKNKESHKKWMNLLS 1723
            V++ GL   +   EI  QE+ FE+++SEASY +SL +L + F   P   L+ T      +       LFSNI  I   S +FL DLE R  ES  I+D+ DIV  +AVN F V++ Y+ NQ +Q + Y  + +E A  +  +  LE+QP+   LS  SFL+LP QR+ R+ LL++ +    +   +  I  + KA Q +E+I+ +C+E    +   + ++ I + L+FK     +      L+ +GEV + +   S + M     +   +  L +  LL+TK S     + V D CS S   +  E +E+ G +  F F L++  N +   V Y+++T +     +W+  L+
Sbjct:  119 VQNSGLLSGLPHREIILQEAMFELVTSEASYYKSLELLENHFLQNPL--LINT------LSQSDMHFLFSNIADIMKASERFLMDLEHRIEESLLISDVCDIVFHHAVNYFHVFISYVINQVYQEKNYRRILQENALFRENMALLENQPKVKGLSFTSFLILPFQRITRLKLLVQNILKKVEENSEREINAI-KAHQELERIVKECNEGARKMSRTEELISIEKTLEFKSKSVPVISHSRWLLKKGEVLQMSGPKSTRTMKSRKLYHPIYLFLFNNLLLITKRSSSGEKFQVLDSCSRS--MLRTEDLEDQGQMLAFVFVLKLLENQEDRPVSYMLKTTSMSEKLRWICALT 459          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Cavefish
Match: ARHGEF26 (Rho guanine nucleotide exchange factor 26 [Source:NCBI gene;Acc:103044275])

HSP 1 Score: 92.0485 bits (227), Expect = 8.436e-19
Identity = 89/315 (28.25%), Postives = 150/315 (47.62%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNE-LKKEIATAKIIEELESQPEC-----CXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF--KPGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFV 1585
            W +   VK    AK + +EE K QE+ FE+ISSE SY  SL +LI  F ++ ++S   T             HLFSNI+ +   S KF  +LE R  ++  I D+SDIV ++A + F+ YV Y  N+ +Q       L K  +  +++  +E+  +C     CS  +     +    LL   +  K  + + Q       E   KA+  + K++ KC+E    ++  + M  I   L+F  KP   +      ++  GE+   ++       S+ M  ++ +F L ++ L++T+  K E +Y V DY    +I+V
Sbjct:  444 WSQLSVVKKSEAAKKLSQEERKRQEAIFEVISSEHSYLHSLMILIRLFKDSQELSETMTK--------TDHHHLFSNIVDVCETSKKFFKELEDRHQQNIVIDDISDIVIRHAQSNFEPYVTYCSNEVYQQRTLQRLLSKNPSFKEVLNRIETHSDCRNLPMCSFLILPMQRVTRLPLLVDTICQKTPKDSPQ------YEECKKALHCVSKLVRKCNEGARKMERTEMMYTINSQLEFKIKPFPLVSSSRW-MVKRGELTAYSEE-KNSIFSKRMSRQQVYFFLFNDVLIVTR-KKSEESYTVIDYALRDQIWV 741          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000490.1 (pep scaffold:Pmarinus_7.0:GL477825:44699:67115:1 gene:ENSPMAG00000000430.1 transcript:ENSPMAT00000000490.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.8853 bits (211), Expect = 6.095e-18
Identity = 52/182 (28.57%), Postives = 101/182 (55.49%), Query Frame = 2
Query:  590 DDRSRNSSRKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIAT-AKIIEELESQPEC 1132
            + R R+  R+      +L++ R L W     V + G+  ++  +  K QE+ FE+++SEASY +S+S++ D F  + +++          +    K+ L+S+I  +  ++  F+A+L  R      I+D+ DIV KYA ++F VY+PY+ N R+Q + + EL++  +  +  ++ L+  P+C
Sbjct:   52 ESRGRDEERRESVALLQLQQQRML-WQHLPHVIASGVLASLSGDAKKQQEAMFEVLTSEASYLKSISIVTDFFMTSEELN--------QTLNMESKKALYSSIADVKKVTESFIAELGDRIDSDILISDICDIVYKYARDDFKVYIPYLTNNRYQEKKFIELRESNSQFSAAVQRLQEMPQC 224          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Yeast
Match: ROM2 (Guanine nucleotide exchange factor (GEF) for Rho1p and Rho2p; mutations are synthetically lethal with mutations in rom1, which also encodes a GEF; Rom2p localization to the bud surface is dependent on Ack1p; ROM2 has a paralog, ROM1, that arose from the whole genome duplication [Source:SGD;Acc:S000004363])

HSP 1 Score: 54.299 bits (129), Expect = 5.953e-8
Identity = 35/115 (30.43%), Postives = 66/115 (57.39%), Query Frame = 2
Query:  707 NMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRF 1051
            N+ K+EIK QE+ +E+  +E ++ +SL +  D F      +L ETN I   I+    +H+F++I  IY+++ +FL  L  R   S  +  + DIV ++ +  F+ +V Y+ ++ +
Sbjct:  652 NLPKKEIKRQEAIYEVYITEKNFVKSLEITRDTFMK----TLAETNIISADIRKNFIKHVFAHINDIYSVNRRFLKALTDRQRSSPVVRGIGDIVLRF-IPFFEPFVSYVASRPY 761          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Yeast
Match: ROM1 (Guanine nucleotide exchange factor (GEF) for Rho1p; mutations are synthetically lethal with mutations in rom2, which also encodes a GEP; ROM1 has a paralog, ROM2, that arose from the whole genome duplication [Source:SGD;Acc:S000003302])

HSP 1 Score: 52.373 bits (124), Expect = 2.201e-7
Identity = 34/120 (28.33%), Postives = 71/120 (59.17%), Query Frame = 2
Query:  692 KGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRF 1051
            K + +++ K++IK QE+ +E+ ++E  + +SL ++ D F       L+ETN I   ++    +H+F++I +IY+++ +FL  L +R   S     ++DI  +Y +  FD ++ YI ++ +
Sbjct:  452 KSVWESLSKQQIKRQEAIYELFTTEKKFVKSLEIIRDTFMK----KLLETNIIPSDVRINFVKHVFAHINEIYSVNREFLKALAQRQSLSPICPGIADIFLQY-LPFFDPFLSYIASRPY 566          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Nematostella
Match: EDO39595 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9L2])

HSP 1 Score: 92.4337 bits (228), Expect = 8.466e-20
Identity = 94/361 (26.04%), Postives = 175/361 (48.48%), Query Frame = 2
Query:  659 LKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELV--DKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF--KPGKKIKEQLGKLIHEGEVKRSN---KNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSS--SEIFVEYETIEENGNIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMN 1714
            + W E  +V   G+ + +   E K QE+ FE+I+SEASY +SL++L   F ++P++   + +  + +++  Q+  LF N+  +   S KFL  L +R  +S  I+ +SDI+ ++A   FD+Y+ Y  +Q +Q     EL K     + +E +    +C +    SF    +  + RI  L   V       ++   E V  DKA++ I K++H C+E    ++  + ++ +   ++F  KP   +      L+  GEV       K+P    + + +K K  +  L ++ LLM K  K ++ Y V DY +   +++ V  E   +   +    L  N N    D +LI  +++    +W++
Sbjct:    1 MLWCELPEVMKSGVLETIDPTERKRQEAMFEVITSEASYLKSLNILGSHFMDSPEL---QADTAQSVVEKSQQRVLFGNVKGVLEASEKFLTALRQRQRKSYVISTISDIIEEHATQYFDIYIKYCSHQVYQDRILKELGK---NPRFVEAVRRLEQCSTAQCLSFQSFLVLPMQRITRLPLLVDAICHRCEEGSDEFVRTDKALKSINKVVHDCNEGARKMERMEELIALQPLIEFAVKPVALVSSNRW-LLRRGEVLLVTEEFKSP----LRKKIKTKPVYMFLFNDLLLMCK-KKSDIKYRVLDYANRNMTKVEVANEPSIQMKYLLSLILLENSNGKTKD-FLICAESETDKTRWLD 348          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Medaka
Match: arhgef16 (rho guanine nucleotide exchange factor 16 [Source:NCBI gene;Acc:101175237])

HSP 1 Score: 107.842 bits (268), Expect = 6.179e-24
Identity = 114/386 (29.53%), Postives = 187/386 (48.45%), Query Frame = 2
Query:  533 SNNNQEALNDIDLVDCIFKDDRSRNSSRKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNE-LKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF---KPGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENGNI--------FQFKLQINRNSD 1654
            S N  E L+D  +V+   +D      + KP +          L W +  QVK+  +   +  +E K QE+ FEII SE SY  SL +L+  F N+  +S          + P +  HLFSNI  I  +S +F  DLERR  E   I D+SDI+  +A + F+ Y+ Y  N+ FQ   + + L    A  + +++LES  EC  L + SFL+LPMQR+ R+ LLL  +     P+          A+  + K++  C++    ++  ++M  I + +DF   KP   +      L   GE+   N +  +  + ++   + ++  L ++ L++TK  K E  + V DY +   + VEY  +E +G +          FKL + +NSD
Sbjct:  226 STNQDELLDDFVVVETPVEDQGIVVKNYKPAQ----------LTWSQLPQVKNSDILSRITPQERKRQEAIFEIICSEHSYLHSLGILVRHFKNSKTLS--------KTMAPTEHHHLFSNISVILKVSQRFFEDLERRHQEDVVIRDISDIIQNHAAHHFEPYIAYCSNETFQQRTHQKLLNTNSAFKEALKQLESSSECGGLPMFSFLILPMQRVTRLPLLLDTI-CQKTPENTAEYFAAVWALHAMSKLVTSCNDGARRMERTEQMYTIQKQMDFGKIKPFPLVSSSRW-LKKRGEL---NISAEELSIWKAFTNRSYYLFLFNDVLIVTK-KKTEEIFVVLDYATLENVEVEY-VMETDGQMSSPTKSTPLTFKLLMTKNSD 586          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Medaka
Match: arhgef16 (rho guanine nucleotide exchange factor 16 [Source:NCBI gene;Acc:101175237])

HSP 1 Score: 107.842 bits (268), Expect = 6.179e-24
Identity = 114/386 (29.53%), Postives = 187/386 (48.45%), Query Frame = 2
Query:  533 SNNNQEALNDIDLVDCIFKDDRSRNSSRKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNE-LKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF---KPGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENGNI--------FQFKLQINRNSD 1654
            S N  E L+D  +V+   +D      + KP +          L W +  QVK+  +   +  +E K QE+ FEII SE SY  SL +L+  F N+  +S          + P +  HLFSNI  I  +S +F  DLERR  E   I D+SDI+  +A + F+ Y+ Y  N+ FQ   + + L    A  + +++LES  EC  L + SFL+LPMQR+ R+ LLL  +     P+          A+  + K++  C++    ++  ++M  I + +DF   KP   +      L   GE+   N +  +  + ++   + ++  L ++ L++TK  K E  + V DY +   + VEY  +E +G +          FKL + +NSD
Sbjct:  226 STNQDELLDDFVVVETPVEDQGIVVKNYKPAQ----------LTWSQLPQVKNSDILSRITPQERKRQEAIFEIICSEHSYLHSLGILVRHFKNSKTLS--------KTMAPTEHHHLFSNISVILKVSQRFFEDLERRHQEDVVIRDISDIIQNHAAHHFEPYIAYCSNETFQQRTHQKLLNTNSAFKEALKQLESSSECGGLPMFSFLILPMQRVTRLPLLLDTI-CQKTPENTAEYFAAVWALHAMSKLVTSCNDGARRMERTEQMYTIQKQMDFGKIKPFPLVSSSRW-LKKRGEL---NISAEELSIWKAFTNRSYYLFLFNDVLIVTK-KKTEEIFVVLDYATLENVEVEY-VMETDGQMSSPTKSTPLTFKLLMTKNSD 586          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Medaka
Match: si:dkey-38p12.3 (ephexin-1 [Source:NCBI gene;Acc:101161585])

HSP 1 Score: 99.3673 bits (246), Expect = 4.385e-21
Identity = 60/182 (32.97%), Postives = 98/182 (53.85%), Query Frame = 2
Query:  590 DDRSRNSSRKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIAT-AKIIEELESQPEC 1132
            D  +R SS   G     +  +++  W +  QV+  G+ + +  E+ K+QES FE+++SE SY RSL VL + F    ++      G   II+    + LFSNIL++  +S +FL DLE R  +     D+ DI+  ++ + F  Y+ Y++NQ +Q + Y  L K  A  A +I  L+  P+C
Sbjct:  473 DWAARPSSNGGGPRSSPIPADKSTLWQDLPQVRESGVLETLTPEQCKYQESMFEVLTSETSYLRSLHVLTEHFLENREL------GEALIIR--DTKTLFSNILRVREVSERFLKDLEDRVFQDIVFPDICDIIHYHSQHNFPAYIDYVRNQIYQEKTYAVLMKTNAQFAAVIARLQESPQC 646          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Medaka
Match: ARHGEF26 (Rho guanine nucleotide exchange factor 26 [Source:NCBI gene;Acc:101154796])

HSP 1 Score: 97.8265 bits (242), Expect = 1.199e-20
Identity = 96/310 (30.97%), Postives = 160/310 (51.61%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAK-IIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDF--KPGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEIFV 1585
            W +   VK  GL++ + +EE K QE+ FE+ISSE SY  SL +LI  F ++ ++        +  +   Q  HLFSNI  +   S +F  +LE R  ++  I+D+SDIV K+A + FD ++ Y  N+ +Q     +L     T K ++ ++E+ P+C +L + SFL+LPMQR+ R+ LL+  +     P+     E    A+Q I K++ KC+E    ++  + +  I   L+F  KP   I      ++  GEV    +        +    +  + +L ++ L++T+  K E +Y V DY    EI V
Sbjct:  488 WSQLTVVKKSGLSEKLSQEERKRQEAIFELISSEHSYFHSLEILIRLFKDSAEL--------RETMSKMQHHHLFSNISDVCEASKEFFKELEERHEKNIVISDISDIVCKHAQSNFDPFITYCSNEVYQQRTLQKLLSTNPTFKEVLTKIEAHPDCRNLPMISFLILPMQRITRLPLLMDTI-CQKTPKTSRQYEDCKTALQEISKVVRKCNEGARTMERTEMLCTINSQLEFKIKPFPLISSSRW-MVKRGEVTSLVEG----VFLKRTTRQHLYLLLFNDVLIITR-KKSEDSYTVVDYALRDEISV 782          
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Medaka
Match: ngef (neuronal guanine nucleotide exchange factor [Source:NCBI gene;Acc:101175182])

HSP 1 Score: 90.1225 bits (222), Expect = 1.418e-18
Identity = 79/235 (33.62%), Postives = 128/235 (54.47%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKE-IATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK 1366
            W   E V+S GL   + + EI+ QE+ FE+++SEASY +SL +L   F   P+  L+ T      +       LFSNI ++   S +FL DLE R  E+  I+D+ DIV  +A   F V++ Y+ NQ +Q + Y  + +E  A  + + ELE       LS  SFL+LP QR+ R+ LL++ +   A+   +     + KA Q +E+I+ +C+E    +   + ++ I + L+FK
Sbjct:   56 WQNLEAVQSSGLLSRLSQNEIRMQEAMFELVTSEASYYKSLEILETHFLRNPR--LINT------LSQSDTHFLFSNIEEVMEASERFLMDLEHRIEEAILISDVCDIVFHHAEKHFKVFITYVINQVYQEKTYRRILEENQAFRETMAELEKHSCVRGLSFTSFLILPFQRITRLKLLVQNILKTAEEHSERETNAI-KAHQQLEQIVQECNEGVRKMSRTEELISIEKTLEFK 281          
BLAST of Neuronal guanine nucleotide exchange factor vs. Planmine SMEST
Match: SMESG000003812.1 (SMESG000003812.1)

HSP 1 Score: 1077.39 bits (2785), Expect = 0.000e+0
Identity = 574/577 (99.48%), Postives = 574/577 (99.48%), Query Frame = 2
Query:    2 MSTWVKQMRLKYEKLKLDRSNANSKKPVSPKDKTTSVRSNCERSQKKLESENGSFDSKNNVSQNSISNLGLKPSEIVNEHNICIYSDPESDSLYGSFRKRENVSSLNPGKSSENDIILRLKTGESEFQTIKRYESILRPPLFQHINVSKRRKENFEDKPRKTSLVATLIDAFNHQKISNNNQEALNDIDLVDCIFKDDRSRNSSRKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFKPGKKIKEQLGKLIHEGEVKRSNKNPXXXXXXXXXXXXXXWFILTSEYLLMTKLSK-KEVTYNVDDYCSSSEIFVEYETIEENGNIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLLSNS 1729
            MSTWVKQMRLKYEKLKLDRSNANSKKPVSPKDKT SVRSNCERSQKKLESENGSFDSKNNVSQNSISNLGLKPSEIVNE NICIYSDPESDSLYGSFRKRENVSSLNPGKSSENDIILRLKTGESEFQTIKRYESILRPPLFQHINVSKRRKENFEDKPRKTSLVATLIDAFNHQKISNNNQEALNDIDLVDCIFKDDRSRNSSRKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAKIIEELESQPECCSLSLDSFLLLPMQRLLRILLLLKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFKPGKKIKEQLGKLIHEGEVKRSNKNPSKKFMSESMKFKEFWFILTSEYLLMTKLSK KEVTYNVDDYCSSSEIFVEYETIEENGNIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLLSNS
Sbjct:    1 MSTWVKQMRLKYEKLKLDRSNANSKKPVSPKDKTASVRSNCERSQKKLESENGSFDSKNNVSQNSISNLGLKPSEIVNEDNICIYSDPESDSLYGSFRKRENVSSLNPGKSSENDIILRLKTGESEFQTIKRYESILRPPLFQHINVSKRRKENFEDKPRKTSLVATLIDAFNHQKISNNNQEALNDIDLVDCIFKDDRSRNSSRKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRFQSEAYNELKKEIATAKIIEELESQPECCSLSLDSFLLLPMQRLLRILLLLKAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFKPGKKIKEQLGKLIHEGEVKRSNKNPSKKFMSESMKFKEFWFILTSEYLLMTKLSKGKEVTYNVDDYCSSSEIFVEYETIEENGNIFQFKLQINRNSDVCDVYLIQTKNKESHKKWMNLLSNS 577          
BLAST of Neuronal guanine nucleotide exchange factor vs. Planmine SMEST
Match: SMESG000044434.1 (SMESG000044434.1)

HSP 1 Score: 131.724 bits (330), Expect = 1.298e-31
Identity = 117/346 (33.82%), Postives = 192/346 (55.49%), Query Frame = 2
Query:  581 IFKDDRSRNSSRKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCES-AKITDLSDIVTKYAVN-EF-DVYVPYIQNQRFQSEAYNELKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVRTNAQPQQ-------KHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFK-PGKKIKEQLGKLIHEGEVKRSNK--NPXXXXXXXXXXXXXXWFILTSEYLLMTKLSKKEVTYNVDDYCSSSEI 1579
            I KD +      K  K  ++ K +  L W   ++VKS G+   MKKEEI  QE+ FE+I+SEASYN SL  LI+ +Y   +  L+  N    II P +K HLFSNIL I T+S K L DLE R+ +   K+ DL+DI+ K+A + +F   Y+ Y+ NQ +Q  A   L ++    + +  ++S P+CC LSLDSFL LPMQRL R+ LL + +    +  +       K V+E   KA++ + +++  C ENK  ++++ R++++ + L+F+   + +      LI +GEV+ +    + +        +   F+ I+ SE ++  K  K +  + V ++C  S++
Sbjct:  375 ISKDQQEEALIEKQIKAIKDSKASNRLYWSNMDEVKSSGVLSAMKKEEIHLQEAIFEVITSEASYNISLDTLIEYYY---KNELLNANKHDSIINPVEKHHLFSNILLIKTVSLKLLKDLESRWSQQKPKMVDLADIILKHAEDKDFQQQYIFYLTNQSYQINALKALLQKEVFKQALYTIQSNPQCCKLSLDSFLALPMQRLTRLKLLTEVISKLMKQSKDLYETIPKEVVENNRKALEKLRELLSACEENKFKMEQKARLIDLCKFLEFRNSSRHVAIGSMDLIKDGEVRAAANQISSNALKKLSKKRQPTFYLIILSELVIFAK-KKSQTKFVVLEHCPRSKV 716          
BLAST of Neuronal guanine nucleotide exchange factor vs. Planmine SMEST
Match: SMESG000056271.1 (SMESG000056271.1)

HSP 1 Score: 109.768 bits (273), Expect = 1.317e-24
Identity = 87/246 (35.37%), Postives = 144/246 (58.54%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKI-TDLSDIVTKYAV-NEFDVYVPYIQNQRFQSEAYNELKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVR--TNAQPQQKHVIELVDK----AIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFKPGKK 1378
            W +  +V   G+ K + K EI+ QE+ FEII+SEASY RSL +L   F+++   S+ E    + I+ P  K H+FSN++ I   S   L DLE+R+ E   + +D+ DIV  + + ++F  YV Y++NQ++Q++A   L +     + + +LES  EC  LSLDS+L+LPMQRL R+ LL++AV    N +     + E V      A+  I+K+++  +  K ++D++  ++ +I  + F P  K
Sbjct:  287 WSDMPEVNESGILKVLSKNEIQLQEAMFEIITSEASYYRSLMILTKHFFSSELFSISEDK--ETIVSPIDKHHIFSNVILIMKTSLNLLNDLEQRWHEEKPVMSDICDIVLNHVISDDFQSYVTYLRNQQYQTQALKRLSENEYFKQQLSKLESSSECGKLSLDSYLMLPMQRLTRLKLLVEAVSKFQNIEGITNEISESVKNNAFIALDKIKKLLNTSNTEKGFMDQKSALISLINRIYFPPNVK 530          
BLAST of Neuronal guanine nucleotide exchange factor vs. Planmine SMEST
Match: SMESG000056271.1 (SMESG000056271.1)

HSP 1 Score: 109.768 bits (273), Expect = 1.569e-24
Identity = 87/246 (35.37%), Postives = 144/246 (58.54%), Query Frame = 2
Query:  665 WIETEQVKSKGLAKNMKKEEIKFQESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKI-TDLSDIVTKYAV-NEFDVYVPYIQNQRFQSEAYNELKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVR--TNAQPQQKHVIELVDK----AIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFKPGKK 1378
            W +  +V   G+ K + K EI+ QE+ FEII+SEASY RSL +L   F+++   S+ E    + I+ P  K H+FSN++ I   S   L DLE+R+ E   + +D+ DIV  + + ++F  YV Y++NQ++Q++A   L +     + + +LES  EC  LSLDS+L+LPMQRL R+ LL++AV    N +     + E V      A+  I+K+++  +  K ++D++  ++ +I  + F P  K
Sbjct:  287 WSDMPEVNESGILKVLSKNEIQLQEAMFEIITSEASYYRSLMILTKHFFSSELFSISEDK--ETIVSPIDKHHIFSNVILIMKTSLNLLNDLEQRWHEEKPVMSDICDIVLNHVISDDFQSYVTYLRNQQYQTQALKRLSENEYFKQQLSKLESSSECGKLSLDSYLMLPMQRLTRLKLLVEAVSKFQNIEGITNEISESVKNNAFIALDKIKKLLNTSNTEKGFMDQKSALISLINRIYFPPNVK 530          
BLAST of Neuronal guanine nucleotide exchange factor vs. Planmine SMEST
Match: SMESG000056271.1 (SMESG000056271.1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.033e-19
Identity = 79/223 (35.43%), Postives = 132/223 (59.19%), Query Frame = 2
Query:  734 QESQFEIISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNILKIYTISCKFLADLERRFCESAKI-TDLSDIVTKYAV-NEFDVYVPYIQNQRFQSEAYNELKKEIATAKIIEELESQPECCXXXXXXXXXXXXXXXXXXXXXXKAVR--TNAQPQQKHVIELVDK----AIQYIEKIIHKCSENKNYIDERQRMMEIIRHLDFKPGKK 1378
            Q++ FEII+SEASY RSL +L   F+++   S+ E    + I+ P  K H+FSN++ I   S   L DLE+R+ E   + +D+ DIV  + + ++F  YV Y++NQ++Q++A   L +     + + +LES  EC  LSLDS+L+LPMQRL R+ LL++AV    N +     + E V      A+  I+K+++  +  K ++D++  ++ +I  + F P  K
Sbjct:    5 QQAMFEIITSEASYYRSLMILTKHFFSSELFSISEDK--ETIVSPIDKHHIFSNVILIMKTSLNLLNDLEQRWHEEKPVMSDICDIVLNHVISDDFQSYVTYLRNQQYQTQALKRLSENEYFKQQLSKLESSSECGKLSLDSYLMLPMQRLTRLKLLVEAVSKFQNIEGITNEISESVKNNAFIALDKIKKLLNTSNTEKGFMDQKSALISLINRIYFPPNVK 225          
The following BLAST results are available for this feature:
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NGEF2.214e-2928.97neuronal guanine nucleotide exchange factor [Sourc... [more]
NGEF4.311e-2928.97neuronal guanine nucleotide exchange factor [Sourc... [more]
ARHGEF157.735e-2534.45Rho guanine nucleotide exchange factor 15 [Source:... [more]
ARHGEF159.177e-2533.86Rho guanine nucleotide exchange factor 15 [Source:... [more]
ARHGEF159.177e-2533.86Rho guanine nucleotide exchange factor 15 [Source:... [more]
back to top
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ephx-12.105e-2035.03EPHeXin (Eph-interacting GEF) homolog [Source:Uni... [more]
ephx-12.890e-2035.03EPHeXin (Eph-interacting GEF) homolog [Source:Uni... [more]
ephx-14.660e-2035.03EPHeXin (Eph-interacting GEF) homolog [Source:Uni... [more]
ephx-15.267e-2035.03EPHeXin (Eph-interacting GEF) homolog [Source:Uni... [more]
back to top
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Exn1.170e-1429.30gene:FBgn0261547 transcript:FBtr0302647[more]
Exn1.170e-1429.30gene:FBgn0261547 transcript:FBtr0302648[more]
Exn1.170e-1429.30gene:FBgn0261547 transcript:FBtr0302649[more]
Exn3.496e-1429.30gene:FBgn0261547 transcript:FBtr0302651[more]
Exn3.496e-1429.30gene:FBgn0261547 transcript:FBtr0302650[more]
back to top
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgef151.741e-2236.94Rho guanine nucleotide exchange factor (GEF) 15 [S... [more]
ngef2.769e-2229.01neuronal guanine nucleotide exchange factor [Sourc... [more]
ngef2.981e-2229.01neuronal guanine nucleotide exchange factor [Sourc... [more]
arhgef154.040e-2236.94Rho guanine nucleotide exchange factor (GEF) 15 [S... [more]
si:dkey-38p12.31.602e-1932.20si:dkey-38p12.3 [Source:ZFIN;Acc:ZDB-GENE-060810-1... [more]
back to top
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ARHGEF266.973e-2532.59Rho guanine nucleotide exchange factor 26 [Source:... [more]
ARHGEF268.022e-2532.59Rho guanine nucleotide exchange factor 26 [Source:... [more]
ARHGEF268.231e-2532.59Rho guanine nucleotide exchange factor 26 [Source:... [more]
NGEF1.975e-2327.11neuronal guanine nucleotide exchange factor [Sourc... [more]
NGEF2.349e-2327.11neuronal guanine nucleotide exchange factor [Sourc... [more]
back to top
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ngef9.389e-2928.69neuronal guanine nucleotide exchange factor [Sourc... [more]
Ngef2.112e-2828.69neuronal guanine nucleotide exchange factor [Sourc... [more]
Arhgef151.338e-2534.30Rho guanine nucleotide exchange factor (GEF) 15 [S... [more]
Arhgef151.338e-2534.30Rho guanine nucleotide exchange factor (GEF) 15 [S... [more]
Arhgef261.530e-2328.50Rho guanine nucleotide exchange factor (GEF) 26 [S... [more]
back to top
BLAST of Neuronal guanine nucleotide exchange factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RDX5|NGEF_PONAB1.358e-2828.97Ephexin-1 OS=Pongo abelii OX=9601 GN=NGEF PE=2 SV=... [more]
sp|Q8N5V2|NGEF_HUMAN2.070e-2828.97Ephexin-1 OS=Homo sapiens OX=9606 GN=NGEF PE=1 SV=... [more]
sp|Q8CHT1|NGEF_MOUSE1.586e-2728.69Ephexin-1 OS=Mus musculus OX=10090 GN=Ngef PE=1 SV... [more]
sp|Q5BKC9|NGEF_RAT6.226e-2728.97Ephexin-1 OS=Rattus norvegicus OX=10116 GN=Ngef PE... [more]
sp|Q5FWH6|ARHGF_MOUSE9.361e-2534.30Rho guanine nucleotide exchange factor 15 OS=Mus m... [more]
back to top
BLAST of Neuronal guanine nucleotide exchange factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A401PDJ31.706e-3132.03Uncharacterized protein OS=Scyliorhinus torazame O... [more]
A0A401T0V17.090e-3132.12Uncharacterized protein OS=Chiloscyllium punctatum... [more]
A0A5K4E9M88.033e-3134.07Putative guanine-nucleotide-exchange-factor OS=Sch... [more]
A0A3Q0KCF18.233e-3134.07Putative guanine-nucleotide-exchange-factor OS=Sch... [more]
G4V9798.821e-3134.07Putative guanine-nucleotide-exchange-factor OS=Sch... [more]
back to top
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:dkey-38p12.33.153e-2334.43rho guanine nucleotide exchange factor 15-like [So... [more]
arhgef161.152e-2128.61rho guanine nucleotide exchange factor 16 [Source:... [more]
arhgef161.152e-2128.61rho guanine nucleotide exchange factor 16 [Source:... [more]
ngef5.071e-2131.25neuronal guanine nucleotide exchange factor [Sourc... [more]
ARHGEF268.436e-1928.25Rho guanine nucleotide exchange factor 26 [Source:... [more]
back to top
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000490.16.095e-1828.57pep scaffold:Pmarinus_7.0:GL477825:44699:67115:1 g... [more]
back to top
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ROM25.953e-830.43Guanine nucleotide exchange factor (GEF) for Rho1p... [more]
ROM12.201e-728.33Guanine nucleotide exchange factor (GEF) for Rho1p... [more]
back to top
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO395958.466e-2026.04Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuronal guanine nucleotide exchange factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
arhgef166.179e-2429.53rho guanine nucleotide exchange factor 16 [Source:... [more]
arhgef166.179e-2429.53rho guanine nucleotide exchange factor 16 [Source:... [more]
si:dkey-38p12.34.385e-2132.97ephexin-1 [Source:NCBI gene;Acc:101161585][more]
ARHGEF261.199e-2030.97Rho guanine nucleotide exchange factor 26 [Source:... [more]
ngef1.418e-1833.62neuronal guanine nucleotide exchange factor [Sourc... [more]
back to top
BLAST of Neuronal guanine nucleotide exchange factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003812.10.000e+099.48SMESG000003812.1[more]
SMESG000044434.11.298e-3133.82SMESG000044434.1[more]
SMESG000056271.11.317e-2435.37SMESG000056271.1[more]
SMESG000056271.11.569e-2435.37SMESG000056271.1[more]
SMESG000056271.11.033e-1935.43SMESG000056271.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031446 ID=SMED30031446|Name=Neuronal guanine nucleotide exchange factor|organism=Schmidtea mediterranea sexual|type=transcript|length=2017bp
GATGTCCACATGGGTGAAGCAAATGAGATTAAAATATGAAAAACTAAAAC
TAGACAGATCTAATGCGAATTCAAAAAAACCGGTTTCACCTAAAGATAAA
ACAACATCTGTCAGATCAAATTGTGAGAGAAGTCAGAAGAAATTGGAATC
AGAAAATGGTTCTTTTGACAGTAAAAATAACGTATCACAAAATTCAATTT
CAAATTTAGGATTGAAGCCCTCAGAAATAGTTAATGAACACAATATTTGC
ATTTATTCTGACCCTGAATCAGACTCATTATATGGATCGTTCAGAAAGCG
TGAAAATGTCAGCAGCTTAAATCCTGGCAAATCTTCAGAAAATGATATCA
TTCTCAGATTAAAGACTGGAGAATCAGAATTTCAAACCATTAAAAGGTAC
GAATCGATTTTACGGCCCCCCTTATTTCAGCATATTAATGTGTCAAAACG
TCGCAAGGAAAATTTCGAAGATAAACCGAGAAAAACAAGTCTTGTGGCTA
CATTAATAGATGCATTTAATCACCAAAAGATTTCTAATAATAACCAAGAA
GCACTAAATGACATAGACCTTGTAGATTGCATTTTCAAAGACGACAGGTC
ACGAAACTCGTCTCGGAAGCCAGGAAAAATATGTCAGGAGTTGAAAGAAA
ATCGAAACTTGAAATGGATCGAAACAGAGCAAGTAAAATCAAAGGGCTTA
GCGAAAAATATGAAGAAAGAAGAAATCAAATTCCAGGAAAGTCAGTTTGA
AATAATATCATCGGAAGCTTCCTACAACAGAAGTTTGTCTGTTCTGATAG
ATAAATTCTACAATGCACCCCAAATGAGTCTAGTTGAAACCAATGGAATC
AAACCGATAATCAAGCCATACCAAAAGGAACATTTATTCTCAAACATTCT
CAAAATATACACCATTAGTTGCAAGTTCCTTGCCGATCTAGAAAGAAGGT
TTTGCGAATCCGCCAAAATCACAGACTTATCAGACATAGTCACAAAGTAT
GCCGTCAACGAATTTGATGTCTACGTGCCTTACATACAAAATCAAAGATT
TCAATCCGAAGCTTACAATGAACTCAAAAAGGAAATTGCAACTGCAAAAA
TAATTGAAGAGCTGGAAAGTCAACCCGAATGTTGTTCGCTCTCTCTGGAT
TCATTTCTACTGCTGCCTATGCAACGGTTATTGCGAATTTTATTGCTACT
CAAGGCTGTGAGAACAAATGCCCAACCTCAACAAAAACATGTCATTGAAC
TTGTGGATAAAGCCATTCAATATATTGAGAAAATTATTCACAAGTGCTCG
GAAAATAAGAATTATATCGACGAAAGACAAAGAATGATGGAAATAATTCG
ACACCTTGATTTCAAGCCGGGAAAGAAAATAAAAGAACAGCTGGGGAAGT
TAATACATGAAGGAGAAGTGAAACGAAGCAACAAGAATCCATCAAAGAAA
TTCATGTCAGAATCCATGAAATTCAAAGAATTTTGGTTCATCCTGACCTC
AGAATACTTGCTGATGACAAAACTGTCAAAAAAAGAAGTGACGTACAATG
TCGACGATTATTGCTCCTCGTCGGAAATCTTTGTGGAATATGAAACCATT
GAAGAGAATGGAAACATATTCCAATTCAAATTGCAAATTAATAGAAATTC
AGATGTGTGCGATGTATATCTGATTCAAACAAAAAATAAAGAGAGCCACA
AAAAGTGGATGAATTTATTATCGAATTCCTGAGAAAGGAGCGAGATAGTG
AAAATGCATATCATTTGTATATTTATTATCATTTCAGATGAAACTTTTTG
AATTTTCCAGGAAAAAATTTCAATTATTTTTTTATATATTCTACCAATAT
TTATAAAAATTTGTTGTTTTCAACTAATTTTCTAATAATTTATTATTAAT
AATTAAGTGAAATAAGTGAGTGTTAATACACCATTTCTAAATTGAATGAT
GGTGAATGACGTGGTAGTTTTGAGGTTTTATAGGATTGACAATATACCTT
AATATTGTGTGTAACTT
back to top

protein sequence of SMED30031446-orf-1

>SMED30031446-orf-1 ID=SMED30031446-orf-1|Name=SMED30031446-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=577bp
MSTWVKQMRLKYEKLKLDRSNANSKKPVSPKDKTTSVRSNCERSQKKLES
ENGSFDSKNNVSQNSISNLGLKPSEIVNEHNICIYSDPESDSLYGSFRKR
ENVSSLNPGKSSENDIILRLKTGESEFQTIKRYESILRPPLFQHINVSKR
RKENFEDKPRKTSLVATLIDAFNHQKISNNNQEALNDIDLVDCIFKDDRS
RNSSRKPGKICQELKENRNLKWIETEQVKSKGLAKNMKKEEIKFQESQFE
IISSEASYNRSLSVLIDKFYNAPQMSLVETNGIKPIIKPYQKEHLFSNIL
KIYTISCKFLADLERRFCESAKITDLSDIVTKYAVNEFDVYVPYIQNQRF
QSEAYNELKKEIATAKIIEELESQPECCSLSLDSFLLLPMQRLLRILLLL
KAVRTNAQPQQKHVIELVDKAIQYIEKIIHKCSENKNYIDERQRMMEIIR
HLDFKPGKKIKEQLGKLIHEGEVKRSNKNPSKKFMSESMKFKEFWFILTS
EYLLMTKLSKKEVTYNVDDYCSSSEIFVEYETIEENGNIFQFKLQINRNS
DVCDVYLIQTKNKESHKKWMNLLSNS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR000219DH-domain
IPR011993PH-like_dom_sf
IPR001849PH_domain
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0001886endothelial cell morphogenesis
GO:0043065positive regulation of apoptotic process
GO:0043547positive regulation of GTPase activity
GO:0051056regulation of small GTPase mediated signal transduction
GO:0097178ruffle assembly
Vocabulary: molecular function
TermDefinition
GO:0005089Rho guanyl-nucleotide exchange factor activity
GO:0005085guanyl-nucleotide exchange factor activity
Vocabulary: cellular component
TermDefinition
GO:0001726ruffle
GO:0005829cytosol
GO:0042995cell projection