Fasciclin-2

Overview
NameFasciclin-2
Smed IDSMED30031444
Length (bp)2569
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fasciclin-2 (SMED30031444) t-SNE clustered cells

Violin plots show distribution of expression levels for Fasciclin-2 (SMED30031444) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fasciclin-2 (SMED30031444) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fasciclin-2 (SMED30031444) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031444

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30031444SMESG000038431.1 dd_Smed_v4_7422_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30031444SMESG000038431.1 dd_Smed_v4_7422_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30031444SMESG000038431.1 dd_Smed_v4_7422_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031444SMESG000038431.1 dd_Smed_v4_7422_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031444SMESG000038431.1 dd_Smed_v4_7422_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30031444SMESG000038431.1 dd_Smed_v6_7422_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
pigment cellSMED30031444SMESG000038431.1 dd_Smed_v6_7422_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fasciclin-2 vs. Ensembl Human
Match: NCAM1 (neural cell adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:7656])

HSP 1 Score: 57.3806 bits (137), Expect = 1.086e-7
Identity = 58/229 (25.33%), Postives = 95/229 (41.48%), Query Frame = 3
Query:  762 GQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQS----YNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPP---YIIKPDLMKVTAKKNEQAYLKCMITGRILDD---KDVMFERFSKDDAKWIKVETND--DKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            GQ V L+C  + FP   + +  +   + Q  D       +    L I K+ K+ E  Y C           K  E+ A++ + V   P   Y+     M++     EQ  L C  +G  +     +       S++ A W + E  +  D + V    +    + +LT+K +Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  228 GQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAEN-------KAGEQDATIHLKVFAKPKITYVENQTAMEL----EEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVV---RSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 442          
BLAST of Fasciclin-2 vs. Ensembl Human
Match: NCAM1 (neural cell adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:7656])

HSP 1 Score: 57.3806 bits (137), Expect = 1.133e-7
Identity = 58/229 (25.33%), Postives = 95/229 (41.48%), Query Frame = 3
Query:  762 GQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQS----YNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPP---YIIKPDLMKVTAKKNEQAYLKCMITGRILDD---KDVMFERFSKDDAKWIKVETND--DKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            GQ V L+C  + FP   + +  +   + Q  D       +    L I K+ K+ E  Y C           K  E+ A++ + V   P   Y+     M++     EQ  L C  +G  +     +       S++ A W + E  +  D + V    +    + +LT+K +Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  228 GQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAEN-------KAGEQDATIHLKVFAKPKITYVENQTAMEL----EEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVV---RSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 442          
BLAST of Fasciclin-2 vs. Ensembl Human
Match: NCAM1 (neural cell adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:7656])

HSP 1 Score: 51.9878 bits (123), Expect = 4.711e-6
Identity = 55/225 (24.44%), Postives = 87/225 (38.67%), Query Frame = 3
Query:  762 GQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQS----YNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDR----KKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            GQ V L+C  + FP   + +  +   + Q  D       +    L I K+ K+ E  Y C           K  E+ A++ + V   P I   +  +   +  EQ  L C  +G  +                W     N    + T D     +    + +LT+K +Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  228 GQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAEN-------KAGEQDATIHLKVFAKPKITYVE-NQTAMELEEQVTLTCEASGDPIPS------------ITWRTSTRNISSEEKTLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 432          
BLAST of Fasciclin-2 vs. Ensembl Human
Match: NCAM1 (neural cell adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:7656])

HSP 1 Score: 51.9878 bits (123), Expect = 5.178e-6
Identity = 55/225 (24.44%), Postives = 87/225 (38.67%), Query Frame = 3
Query:  762 GQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQS----YNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDR----KKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            GQ V L+C  + FP   + +  +   + Q  D       +    L I K+ K+ E  Y C           K  E+ A++ + V   P I   +  +   +  EQ  L C  +G  +                W     N    + T D     +    + +LT+K +Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  228 GQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAEN-------KAGEQDATIHLKVFAKPKITYVE-NQTAMELEEQVTLTCEASGDPIPS------------ITWRTSTRNISSEEKTLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 432          
BLAST of Fasciclin-2 vs. Ensembl Human
Match: NCAM1 (neural cell adhesion molecule 1 [Source:HGNC Symbol;Acc:HGNC:7656])

HSP 1 Score: 51.9878 bits (123), Expect = 5.555e-6
Identity = 56/228 (24.56%), Postives = 88/228 (38.60%), Query Frame = 3
Query:  762 GQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQS----YNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPP---YIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDR----KKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            GQ V L+C  + FP   + +  +   + Q  D       +    L I K+ K+ E  Y C           K  E+ A++ + V   P   Y+     M++     EQ  L C  +G  +                W     N    + T D     +    + +LT+K +Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  228 GQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAEN-------KAGEQDATIHLKVFAKPKITYVENQTAMEL----EEQVTLTCEASGDPIPS------------ITWRTSTRNISSEEKTLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 432          
BLAST of Fasciclin-2 vs. Ensembl Fly
Match: Dscam1 (gene:FBgn0033159 transcript:FBtr0111083)

HSP 1 Score: 59.6918 bits (143), Expect = 1.275e-8
Identity = 53/209 (25.36%), Postives = 94/209 (44.98%), Query Frame = 3
Query:  798 FPAQAVIFPVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILT-LTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYPIRS 1421
            F  Q    P++T +  +      + + +L+I  + K+ + +YQC V     +      E +A LK+     P +I+    + T +     +LKC+  G      ++ +E     D K I    N+D+YQV       G++++ L I  V   D GL++C A +  G  +    L V  LP +     +  +A + + + C V+GYPI S
Sbjct:  363 FTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESA-----EASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPT--PEISWEL----DGKKI---ANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGETLIVTCPVAGYPIDS 557          
BLAST of Fasciclin-2 vs. Ensembl Fly
Match: Dscam1 (gene:FBgn0033159 transcript:FBtr0306784)

HSP 1 Score: 59.6918 bits (143), Expect = 1.297e-8
Identity = 53/209 (25.36%), Postives = 94/209 (44.98%), Query Frame = 3
Query:  798 FPAQAVIFPVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILT-LTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYPIRS 1421
            F  Q    P++T +  +      + + +L+I  + K+ + +YQC V     +      E +A LK+     P +I+    + T +     +LKC+  G      ++ +E     D K I    N+D+YQV       G++++ L I  V   D GL++C A +  G  +    L V  LP +     +  +A + + + C V+GYPI S
Sbjct:  363 FTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESA-----EASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPT--PEISWEL----DGKKI---ANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGETLIVTCPVAGYPIDS 557          
BLAST of Fasciclin-2 vs. Ensembl Fly
Match: Dscam1 (gene:FBgn0033159 transcript:FBtr0306779)

HSP 1 Score: 59.6918 bits (143), Expect = 1.297e-8
Identity = 53/209 (25.36%), Postives = 94/209 (44.98%), Query Frame = 3
Query:  798 FPAQAVIFPVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILT-LTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYPIRS 1421
            F  Q    P++T +  +      + + +L+I  + K+ + +YQC V     +      E +A LK+     P +I+    + T +     +LKC+  G      ++ +E     D K I    N+D+YQV       G++++ L I  V   D GL++C A +  G  +    L V  LP +     +  +A + + + C V+GYPI S
Sbjct:  366 FTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESA-----EASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPT--PEISWEL----DGKKI---ANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGETLIVTCPVAGYPIDS 560          
BLAST of Fasciclin-2 vs. Ensembl Fly
Match: Dscam1 (gene:FBgn0033159 transcript:FBtr0306769)

HSP 1 Score: 59.6918 bits (143), Expect = 1.298e-8
Identity = 53/209 (25.36%), Postives = 94/209 (44.98%), Query Frame = 3
Query:  798 FPAQAVIFPVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILT-LTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYPIRS 1421
            F  Q    P++T +  +      + + +L+I  + K+ + +YQC V     +      E +A LK+     P +I+    + T +     +LKC+  G      ++ +E     D K I    N+D+YQV       G++++ L I  V   D GL++C A +  G  +    L V  LP +     +  +A + + + C V+GYPI S
Sbjct:  363 FTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESA-----EASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPT--PEISWEL----DGKKI---ANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGETLIVTCPVAGYPIDS 557          
BLAST of Fasciclin-2 vs. Ensembl Fly
Match: Dscam1 (gene:FBgn0033159 transcript:FBtr0111070)

HSP 1 Score: 59.6918 bits (143), Expect = 1.308e-8
Identity = 53/209 (25.36%), Postives = 94/209 (44.98%), Query Frame = 3
Query:  798 FPAQAVIFPVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILT-LTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYPIRS 1421
            F  Q    P++T +  +      + + +L+I  + K+ + +YQC V     +      E +A LK+     P +I+    + T +     +LKC+  G      ++ +E     D K I    N+D+YQV       G++++ L I  V   D GL++C A +  G  +    L V  LP +     +  +A + + + C V+GYPI S
Sbjct:  366 FTCQYTGNPIKTVSWMKDGKAIGHSEPVLRIESVKKEDKGMYQCFVRNDQESA-----EASAELKLGGRFDPPVIRQAFQEETMEPGPSVFLKCVAGGNPT--PEISWEL----DGKKI---ANNDRYQVGQYVTVNGDVVSYLNITSVHANDGGLYKCIAKSKVGVAEHSAKLNVYGLPYIRQMEKKAIVAGETLIVTCPVAGYPIDS 560          
BLAST of Fasciclin-2 vs. Ensembl Zebrafish
Match: zgc:152904 (zgc:152904 [Source:ZFIN;Acc:ZDB-GENE-060929-856])

HSP 1 Score: 56.6102 bits (135), Expect = 1.327e-7
Identity = 51/183 (27.87%), Postives = 76/183 (41.53%), Query Frame = 3
Query:  867 NGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYM-AMKPVQINCFVSGYP 1412
             GK  L +  I +     Y C+ +        K     + L + V V P+I +  L  VTA +   A + C   G  L   ++ + R S   +     ++ D + +V   R + G  + LTI  VQ  D G F C A++  G  +K  FL +E  P   T  S  Y     PV I+C V   P
Sbjct:  233 GGKSTLTVKNIKQTDGGPYMCRASN-------KAGSSESQLFLKVFVQPHITQ--LRNVTAVEGSAAMISCTAEGEPL--PEISWRRASDGHSFTDGEKSKDGRVEV---RGRHGKSM-LTISGVQLSDWGRFDCEALSRIGGHQKSMFLDIEYAPKFQTNQSIFYSWEGNPVNISCEVKSNP 400          
BLAST of Fasciclin-2 vs. Ensembl Zebrafish
Match: ttn.1 (titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030616-413])

HSP 1 Score: 53.5286 bits (127), Expect = 1.507e-6
Identity = 43/136 (31.62%), Postives = 61/136 (44.85%), Query Frame = 3
Query: 1020 IKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETN---DDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAM--KPVQINCFVSGYP 1412
            ++ ++ +VTAK  + A LKC I GR + +             KW K         KY  T D    G   TLTI   Q ED GL+ C A+N AG+ +  G L +E  P+   P+ +   A     V+I+    G P
Sbjct: 26474 LRKEMDEVTAKLGQTATLKCQIIGRPVPE------------IKWYKGGKEIKEGRKYAATSD----GRNHTLTISTDQQEDEGLYTCKAVNEAGECETSGALVLEAAPLFPVPLKDKIFATCGSTVRIHVVYIGRP 26593          
BLAST of Fasciclin-2 vs. Ensembl Zebrafish
Match: ttn.1 (titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-030616-413])

HSP 1 Score: 53.5286 bits (127), Expect = 1.572e-6
Identity = 43/136 (31.62%), Postives = 61/136 (44.85%), Query Frame = 3
Query: 1020 IKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETN---DDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAM--KPVQINCFVSGYP 1412
            ++ ++ +VTAK  + A LKC I GR + +             KW K         KY  T D    G   TLTI   Q ED GL+ C A+N AG+ +  G L +E  P+   P+ +   A     V+I+    G P
Sbjct: 24781 LRKEMDEVTAKLGQTATLKCQIIGRPVPE------------IKWYKGGKEIKEGRKYAATSD----GRNHTLTISTDQQEDEGLYTCKAVNEAGECETSGALVLEAAPLFPVPLKDKIFATCGSTVRIHVVYIGRP 24900          
BLAST of Fasciclin-2 vs. Ensembl Zebrafish
Match: hmcn2 (hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765])

HSP 1 Score: 51.9878 bits (123), Expect = 3.912e-6
Identity = 61/236 (25.85%), Postives = 99/236 (41.95%), Query Frame = 3
Query:  759 EGQEVNLICTFK---TFPAQAVIFPVETNTLFQTIDQS----------YNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYII-KPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTP--VSEIYMAMK-PVQINCFVSGYPI 1415
            +GQ +NL  T K   T    A  F + T T+  T D             NGK +LKI ++  D    + C       T      E      I+V  PP I     + +VT    ++  ++C ++GR L   +     ++ D     +V + +    V F  K +     L +K V+  DRGL+QC A N AG   +   L ++  P++      SE+ + +  P  ++C V G P+
Sbjct: 1344 DGQLLNLTVTLKQPLTLGCDA--FGIPTPTISWTKDNRPVLETPGVYLQNGKRLLKIYRVQHDHAGRFSC-------TAQNSAGEAKREYTIEVQAPPVISGTSGVQEVTIMAGQEVDMQCRVSGRPLPSVE-----WTHDG----EVLSPNGDPHVEFLEKGQ----VLRVKSVRPRDRGLYQCVATNNAGTQTRQFRLTIQAAPLIRDSGEDSEVTVVLGFPAVLHCEVEGIPL 1557          
BLAST of Fasciclin-2 vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 55.4546 bits (132), Expect = 5.619e-7
Identity = 72/286 (25.17%), Postives = 110/286 (38.46%), Query Frame = 3
Query:  645 QYQELIDNQLRTGFYEFKWILYDPIDPKIELE-NELPILEGQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQSY----NGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNE-------QAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETN-DDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKP-VQINCFVSGYPIRSEEEIQLRVINQSS 1460
            +Y     N+  T       I  DP  PK  LE   +   +G E+ L C    +P   +I+    N +F      Y    NG  I+K   + +D   +Y+C  T    T      +   S+ + + VP         +VTA KNE       +  L C  TG              +    W K ++       +T D      + TL IK+ Q+ D G + C A+N AGK      L+V   PV      ++ M +   V + C   G P   E +I+ R +N +S
Sbjct:  577 EYNCFASNEGGTATASVTLIAQDP--PKAVLEPRNVTFTKGAEIKLKCLVTGYPTPHIIW--MHNDMFVRFSNRYIITHNGTFIIK-NAVERD-SGVYKCLATNAAGT------DHQTSVMVYIEVP---------QVTAVKNEMLVPVGSETTLACKATG------------IPRPLIHWYKGKSTLSPSALITIDSL----LGTLKIKNTQFSDAGHYVCIAVNDAGKANGKVSLRVGSPPVFTQTPGDVSMDIGSDVSLTCSAEGIP---EPKIKWRRLNHTS 822          

HSP 2 Score: 51.2174 bits (121), Expect = 9.600e-6
Identity = 53/206 (25.73%), Postives = 94/206 (45.63%), Query Frame = 3
Query:  978 TASLKIDVVV--PPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMA-MKPVQINCFVSGYPIRS----EEEIQLRVINQSSPIVIRLLGRKYDEMDGIQMSYEVAYQKKLVQ--GATYV 1568
            ++  +ID++V  PP I K +   +TAK N Q  L C +TG       + +    K +   I  + N + Y++           +L I     +D G++ C+A++ AG D+   +L V   P +    + I++  + P  I C VSG P  S    ++ IQL  I+ S     R+L     E+   ++S+   Y  + V   G+ ++
Sbjct: 3675 SSQRQIDLLVYDPPRI-KSEPTNITAKINIQTTLPCEVTGT--PKPKIQW----KKNGHPINTDLNQNMYRLLSSG-------SLVIISPSVDDTGIYVCSALSDAGDDEIDMYLSVHVPPTIADEAANIFVTKLSPAVIPCTVSGVPFPSVHWLKDSIQLPAISDS----YRILPSGSLEIPSSRLSHAGKYTCRAVNQVGSAHI 3862          
BLAST of Fasciclin-2 vs. Ensembl Xenopus
Match: eftud2 (elongation factor Tu GTP binding domain containing 2 [Source:Xenbase;Acc:XB-GENE-972643])

HSP 1 Score: 55.0694 bits (131), Expect = 6.271e-7
Identity = 72/286 (25.17%), Postives = 110/286 (38.46%), Query Frame = 3
Query:  645 QYQELIDNQLRTGFYEFKWILYDPIDPKIELE-NELPILEGQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQSY----NGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNE-------QAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETN-DDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKP-VQINCFVSGYPIRSEEEIQLRVINQSS 1460
            +Y     N+  T       I  DP  PK  LE   +   +G E+ L C    +P   +I+    N +F      Y    NG  I+K   + +D   +Y+C  T    T      +   S+ + + VP         +VTA KNE       +  L C  TG              +    W K ++       +T D      + TL IK+ Q+ D G + C A+N AGK      L+V   PV      ++ M +   V + C   G P   E +I+ R +N +S
Sbjct:  589 EYNCFASNEGGTATASVTLIAQDP--PKAVLEPRNVTFTKGAEIKLKCLVTGYPTPHIIW--MHNDMFVRFSNRYIITHNGTFIIK-NAVERD-SGVYKCLATNAAGT------DHQTSVMVYIEVP---------QVTAVKNEMLVPVGSETTLACKATG------------IPRPLIHWYKGKSTLSPSALITIDSL----LGTLKIKNTQFSDAGHYVCIAVNDAGKANGKVSLRVGSPPVFTQTPGDVSMDIGSDVSLTCSAEGIP---EPKIKWRRLNHTS 834          
BLAST of Fasciclin-2 vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 57.3806 bits (137), Expect = 9.267e-8
Identity = 59/233 (25.32%), Postives = 96/233 (41.20%), Query Frame = 3
Query:  762 GQEVNLICTFKTFPAQAVIF-----PVETNTLFQTIDQSY---NGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPP---YIIKPDLMKVTAKKNEQAYLKCMITGRILDD---KDVMFERFSKDDAKWIKVETND--DKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            GQ V L+C    FP   + +     P+E     +  D+ +   +    L I  + K+ E  Y C           K  E+ AS+ + V   P   Y+     M++     EQ  L C  +G  +     +       S++ A W + E  +  D + V    +    + +LT+K +Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  186 GQSVTLVCDADGFPEPTMSWTKDGEPIENE---EEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAEN-------KAGEQDASIHLKVFAKPKITYVENQTAMEL----EEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVV---RSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 401          
BLAST of Fasciclin-2 vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 53.9138 bits (128), Expect = 8.918e-7
Identity = 55/226 (24.34%), Postives = 84/226 (37.17%), Query Frame = 3
Query:  762 GQEVNLICTFKTFPAQAVIF-----PVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDR----KKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            GQ V L+C    FP   + +     P+E            +    L I  + K+ E  Y C           K  E+ AS+ + V   P I   +  +   +  EQ  L C  +G  +                W     N    + T D     +    + +LT+K +Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  228 GQSVTLVCDADGFPEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAEN-------KAGEQDASIHLKVFAKPKITYVE-NQTAMELEEQVTLTCEASGDPIPS------------ITWRTSTRNISSEEKTLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 433          
BLAST of Fasciclin-2 vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 53.5286 bits (127), Expect = 1.056e-6
Identity = 55/226 (24.34%), Postives = 84/226 (37.17%), Query Frame = 3
Query:  762 GQEVNLICTFKTFPAQAVIF-----PVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDR----KKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            GQ V L+C    FP   + +     P+E            +    L I  + K+ E  Y C           K  E+ AS+ + V   P I   +  +   +  EQ  L C  +G  +                W     N    + T D     +    + +LT+K +Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  228 GQSVTLVCDADGFPEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAEN-------KAGEQDASIHLKVFAKPKITYVE-NQTAMELEEQVTLTCEASGDPIPS------------ITWRTSTRNISSEEKTLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 433          
BLAST of Fasciclin-2 vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 53.5286 bits (127), Expect = 1.325e-6
Identity = 56/229 (24.45%), Postives = 85/229 (37.12%), Query Frame = 3
Query:  762 GQEVNLICTFKTFPAQAVIF-----PVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPP---YIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDR----KKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            GQ V L+C    FP   + +     P+E            +    L I  + K+ E  Y C           K  E+ AS+ + V   P   Y+     M++     EQ  L C  +G  +                W     N    + T D     +    + +LT+K +Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  228 GQSVTLVCDADGFPEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAEN-------KAGEQDASIHLKVFAKPKITYVENQTAMEL----EEQVTLTCEASGDPIPS------------ITWRTSTRNISSEEKTLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 433          
BLAST of Fasciclin-2 vs. Ensembl Mouse
Match: Ncam1 (neural cell adhesion molecule 1 [Source:MGI Symbol;Acc:MGI:97281])

HSP 1 Score: 53.5286 bits (127), Expect = 1.360e-6
Identity = 56/229 (24.45%), Postives = 85/229 (37.12%), Query Frame = 3
Query:  762 GQEVNLICTFKTFPAQAVIF-----PVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPP---YIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDR----KKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            GQ V L+C    FP   + +     P+E            +    L I  + K+ E  Y C           K  E+ AS+ + V   P   Y+     M++     EQ  L C  +G  +                W     N    + T D     +    + +LT+K +Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  228 GQSVTLVCDADGFPEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAEN-------KAGEQDASIHLKVFAKPKITYVENQTAMEL----EEQVTLTCEASGDPIPS------------ITWRTSTRNISSEEKTLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 433          
BLAST of Fasciclin-2 vs. UniProt/SwissProt
Match: sp|P31836|NCAM1_BOVIN (Neural cell adhesion molecule 1 OS=Bos taurus OX=9913 GN=NCAM1 PE=1 SV=1)

HSP 1 Score: 67.0106 bits (162), Expect = 5.826e-10
Identity = 60/228 (26.32%), Postives = 96/228 (42.11%), Query Frame = 3
Query:  762 GQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQSY---NGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPP---YIIKPDLMKVTAKKNEQAYLKCMITGRILDD---KDVMFERFSKDDAKWIKVETND--DKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            GQ V L+C  + FP   V +  +   +    D+ Y   +    L I K+ K+ E  Y C           K  E+ AS+ + V   P   Y+     M++     EQ  L C  +G  +     +       S++ A W + E  +  D + V    +    + +LT+K +Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  228 GQSVTLVCNAEGFPEPTVSWTKDGEQIENEEDEKYLFSDDSSELTIRKVDKNDEAEYVCIAEN-------KAGEQDASIHLKVFAKPKITYVENQTAMEL----EEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVV---RSHARVSSLTLKSIQYTDAGEYVCTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 441          
BLAST of Fasciclin-2 vs. UniProt/SwissProt
Match: sp|P13596|NCAM1_RAT (Neural cell adhesion molecule 1 OS=Rattus norvegicus OX=10116 GN=Ncam1 PE=1 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 2.359e-7
Identity = 58/230 (25.22%), Postives = 92/230 (40.00%), Query Frame = 3
Query:  762 GQEVNLICTFKTFPAQAVIF-----PVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPP---YIIKPDLMKVTAKKNEQAYLKCMITGRILDD---KDVMFERFSKDDAKWIKVETND--DKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            GQ V L+C    FP   + +     P+E            +    L I  + K+ E  Y C           K  E+ AS+ + V   P   Y+     M++     EQ  L C  +G  +     +       S++ A W + E  +  D + V    +    + +LT+K +Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  228 GQSVTLVCDADGFPEPTMSWTKDGEPIENEEEDDEKHIFSDDSSELTIRNVDKNDEAEYVCIAEN-------KAGEQDASIHLKVFAKPKITYVENQTAMEL----EEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVV---RSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 443          
BLAST of Fasciclin-2 vs. UniProt/SwissProt
Match: sp|P13591|NCAM1_HUMAN (Neural cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=NCAM1 PE=1 SV=3)

HSP 1 Score: 57.3806 bits (137), Expect = 5.214e-7
Identity = 58/229 (25.33%), Postives = 95/229 (41.48%), Query Frame = 3
Query:  762 GQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQS----YNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPP---YIIKPDLMKVTAKKNEQAYLKCMITGRILDD---KDVMFERFSKDDAKWIKVETND--DKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            GQ V L+C  + FP   + +  +   + Q  D       +    L I K+ K+ E  Y C           K  E+ A++ + V   P   Y+     M++     EQ  L C  +G  +     +       S++ A W + E  +  D + V    +    + +LT+K +Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  228 GQSVTLVCDAEGFPEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAEN-------KAGEQDATIHLKVFAKPKITYVENQTAMEL----EEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEKQETLDGHMVV---RSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 442          
BLAST of Fasciclin-2 vs. UniProt/SwissProt
Match: sp|P13590|NCAM1_CHICK (Neural cell adhesion molecule 1 OS=Gallus gallus OX=9031 GN=NCAM1 PE=1 SV=3)

HSP 1 Score: 53.9138 bits (128), Expect = 7.832e-6
Identity = 55/225 (24.44%), Postives = 88/225 (39.11%), Query Frame = 3
Query:  765 QEVNLICTFKTFPAQAVIF-----PVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRK----KEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYP 1412
            Q V L C    FP   + +     P+E     +    +Y+G  ++ I K+ K  E  Y C           K  E+ A++ + V   P I   +  K   +  +Q  L C  +G  +                W     N    + T D +        + +LT+K++Q+ D G + CTA N  G+D +  +L+V+  P L  PV+        V I C V  YP
Sbjct:  229 QSVTLACDADGFPEPTMTWTKDGEPIEQEDNEEKYSFNYDGSELI-IKKVDKSDEAEYICIAEN-------KAGEQDATIHLKVFAKPKITYVE-NKTAMELEDQITLTCEASGDPIPS------------ITWKTSTRNISNEEKTLDGRIVVRSHARVSSLTLKEIQYTDAGEYVCTASNTIGQDSQAMYLEVQYAPKLQGPVAVYTWEGNQVNITCEVFAYP 432          
BLAST of Fasciclin-2 vs. TrEMBL
Match: A0A0X3P3F5 (Ig-like domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR148966 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 3.843e-19
Identity = 159/752 (21.14%), Postives = 281/752 (37.37%), Query Frame = 3
Query:  270 IFSLKDEKXXXXXXXXXXXXXXAGTYKCKHDK-KLDLTKSI------SITLKDKTLIPTFHKVELYFP-----KNRPIKIECPLKDQQSFKSW---------------LYSIGKNNIYVNKPGKG----TNYEITEDKLSFTIMEN-AKEPIKVLWCQYQELIDN-----QLRTGFYEFKWILYDPID-------------------------------------------PKIELENELPILEGQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQSY--------------NGKVILKIPKITKDLEKIYQCKVTKFLSTVPFK----------------LVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETND---DK--------------YQVTFDRKKEG-NILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVL-YTPV-SEIYMAMKPVQINCFVSGYPI---------------------------------------RSEEE----IQLRVINQSSP----IVIRLLGRKYDEMDGIQMSYEVAYQKKLVQGATYVLECFYFDXXXXXXXXXXXXXXIASQPDIPKVSVLCSGSSGVAFQIERPHETIE---TKIVTKDELFFAPSTNFDSLTKKSSRII----------------------QVEKNAANKSQIYV--------LENLKPYTNYSFRW 1895
            ++ ++D++ RL+LRIDN +I ++G Y+C   K  LD+  S+      S+    + +IP   ++  +F       +  I + CPL   Q+  +W               L S    ++ V+  G G     N EI  + L   +++  + E  + LWC+++  +D+      L   +YE  W LYDPI+                                            ++EL ++  ++EG    L C F+  P  + + P +  + F+  D+S                G  ++ +   T   E        K ++T+PF+                 V   ASL ++V+  P I+  DLM         A L C++      +  + F   +   ++ +  E +    D+              Y+   D +K   + LT+ I+  Q E  G ++C   NAAG+ + VG ++V   P L   PV S  ++  +P+ I+C VSGYP+                                        +E E    + L++ N +      + I+L   +    +GI  +Y V     L+  AT   E  + D      + +  +   A+ P  P++  LC+G   V F +  P  + E   T  +    + FAPS+ F S +  +S+ I                       +EK+ A +             + NL P TNY+F W
Sbjct:   88 VYQMRDDRGRLVLRIDNASIRDSGVYRCHGQKGSLDVFLSVHPQEHFSLGKHGQPIIPLAARMIKHFKMFSSDNSEKIILHCPLTKAQTVVAWEWREPIPPDSQVARSLPSDASPSLTVSHSGPGIYSSGNVEIGPELLWVRVLDPFSPEAPRKLWCKFR--MDSLWKKKALDPSYYEIDWELYDPINVQLKMLNSSEKELYDHLGSSEPNIDYSDLYGSLGMEKERSSLRDRMELRSQPKLIEGYPAKLACVFRPIPTASSVRPAQVASWFRG-DRSLPQPPFHVNNSNVATEGISVISVRAYTVSSEAALGSG-DKNIATLPFENITCVVSSRVNDAHNYTVTSNASLTLEVIRQPKIVDVDLMSTECSLGGYAQLVCVVLANGKPNISIDFSSTAGQTSQPVGAEESSLGGDRGDWRQLTESYSLKIYRSEMDAEKPMLHRLTVVIRGAQREHHGAYRCHVTNAAGQAQYVGEIRVRSEPQLTIHPVQSTFFLGRRPLIISCLVSGYPLAVANPTALPARGLVTMSTASLMDEEGSSTLSPSNPELGDAAEAERFSPVSLKITNANMDTDQLVSIKLTSLRIGVYEGINATYSVVISYHLLNQATARCEYVHTDRTVISDEMEIKE---ATPPAKPQIVALCAGPGAVIFGVSNPPVSPENEPTDKIVSQRVLFAPSSEFHSASNLASKSIILDVEGQPRSETVDADEEAVQEALEKSPAQRKMSATDPPLVTVPITNLLPGTNYTFEW 832          
BLAST of Fasciclin-2 vs. TrEMBL
Match: A0A183SUS5 (Ig-like domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS7973 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 1.337e-12
Identity = 114/509 (22.40%), Postives = 203/509 (39.88%), Query Frame = 3
Query:  279 LKDEKXXXXXXXXXXXXXXAGTYKCKHDK-KLDLTKSI------SITLKDKTLIPTFHKVELYFP-----KNRPIKIECPLKDQQSFKSW---------------LYSIGKNNIYVN--KPG--KGTNYEITEDKLSFTIMEN-AKEPIKVLWCQYQELIDN-----QLRTGFYEFKWILYDPID-------------------------------------------PKIELENELPILEGQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQSY--------------NGKVILKIPKITKDLEKIYQCKVTKFLSTVPFK----------------LVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETND---DK--------------YQVTFDRKKEG-NILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVL-YTPV-SEIYMAMKPVQINCFVSGYPI 1415
            ++D++ RL+LRIDN +I ++G Y+C   K  LD+  S+      S+    + +IP   ++  +F       +  I + CPL   Q+  +W               L S    ++ V+  +PG     N EI  + L   +++  + E  + LWC+++  +D+      L   +YE  W LYDPI+                                            ++EL ++  ++EG    L C F+  P  + + P +  + F+  D+S                G  ++ +   T   E        K ++T+PF+                 V   ASL ++V+  P I+  DLM         A L C++      +  + F   +   ++ +  E +    D+              Y+   D +K   + LT+ I+  Q E  G ++C   NAAG+ + VG ++V   P L   PV S  ++  +P+ I+C VSGYP+
Sbjct:    1 MRDDRGRLVLRIDNASIRDSGVYRCHGQKGSLDVFLSVHPQEHFSVGKHGQPIIPLAARMIKHFKMFSSDNSEKIILHCPLTKAQTVVAWEWREPIPPDSQVARSLPSDASPSLTVSHSEPGIYSSGNVEIGPELLWVRVLDPFSPEAPRKLWCKFR--MDSLWKKKALDPSYYEIDWELYDPINVQLKMLNSSEKELYDHLGSSEPNIDYSDLYGSLGMEKERSSLRDRMELRSQPKLIEGYPAKLACVFRPIPTASSVRPAQVASWFRG-DRSLPQPPFHVNNSNVATEGISVISVRAYTVSSEAALGSG-DKNIATLPFENITCVVSSRVNDAHNYTVTSNASLTLEVIRQPKIVDVDLMSTECSLGGYAQLVCVVLANGKPNISIDFSSTAGQTSQPVGAEESSLGGDRGDWRQLTESYSLKIYRSEMDAEKPMLHRLTVVIRGAQREHHGAYRCHVTNAAGQAQYVGEIRVRSEPQLTIHPVQSTFFLGRRPLIISCLVSGYPL 505          
BLAST of Fasciclin-2 vs. TrEMBL
Match: G7YCS1 (Uncharacterized protein OS=Clonorchis sinensis OX=79923 GN=CLF_104993 PE=4 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 2.931e-12
Identity = 132/593 (22.26%), Postives = 237/593 (39.97%), Query Frame = 3
Query:  927 CKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDA--------KWIKVETNDDKYQVTF-----DRKKEG-NILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEI--YMAMKPVQINCFVSGYPIRSEEEIQLRVINQ---------------------SSPIVIRLLGRKYDEMDGIQM---------------SYEVAYQKKLVQGATYVLECFYFDXXXXXXXXXXXXXXIASQPDIPKVSVLCSGSSGVAFQIERP--HE-TIETKIVTKDELFFAPSTNFDSLTKKSSRIIQVEK------------------------NAANKSQ----IYVLENLKPYTNYSFRWDXXXXXXXXXXXXXXATTXXXXXXXXXXXXRFL-TTKNIIIVIVDWDEDCPY-KGANAAIRDVYIK----MKKENDDSNI------EWNWVE-------------TNFTMDVERKRLEFPIFMDKP----------QLNYEIEVTLRSALGNSEPIIESYQ-AKTVLAGSLFTCFPKCSGQNLFSSF 2348
            C VT  + + P   V   ASL I+V++ P II   L+       +   L C+    + +    M   FSK  +        +W  VE    +Y ++      DR+    + L L I DV+  D GL++CT  N AG+ +  G + V   P L     E   ++  KP   +C V+GYP+   +     V  +                     +S + ++++  + + MDG+++               +YEV   ++   G   V+ C Y    N+    +    + A++P  P +++LC+G   V F +  P  HE ++ T+ +   ++ FAP+  F +    +S ++ +                             NK+Q    I  ++ L   T Y F W S N F  S  +  +  T +L+ P   K++ F   T N + + V   + CPY  GA A + D+ ++    M  ++D S        EW  ++             +  T   + ++L      D P            NYE+++  R+    S+     Y+ ++TV + SL  C+P C+  ++  +F
Sbjct:  269 CAVTSEVKSNPVYKVTTNASLDIEVILVPQIINRTLLLAERSLEDAVKLTCVA---VANGPPEMLLEFSKTGSEQERNSTLQWQPVE---PRYGLSMRHIPPDRQMPTVHRLVLDISDVRRTDHGLYRCTVWNQAGRTQATGQVLVRSPPELSIIPQETNYFVGHKPWIASCHVTGYPLTRSQSTPSSVAEEETTPGDPGSKQAGVNSEGSAANSSVQMKIMTVEGERMDGVEINLTKYEANDFLGINATYEVHMNQRF--GNEAVIRCEYTHTDNRVVYQELFLRE-ATKPPAPNITLLCAGPRAVVFGVTNPRVHEGSLLTERIVTQKVIFAPAKTFHNSGGLASLLVYLNSEGQPSASPINRTANMTDDFAHATVTGPNKAQPQTAIIPVKGLMADTEYVFEWSSGNVFGLSAMVQFTLWTTRLENPPAIKNVFFHKPTNNFLRISVFLADPCPYGGGARAELSDLLVRYRQTMVNQSDPSKSSLIGVGEWTEMQVCQNLMGLDKTENSANTPGADEEQLGIKWAGDTPLPCEIPVEDAGDNYEVQLATRNRFDKSDWFTVIYRPSQTVQSASL--CYPTCTAAHVNPTF 850          
BLAST of Fasciclin-2 vs. TrEMBL
Match: A0A4S2M8H6 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003218 PE=4 SV=1)

HSP 1 Score: 81.2629 bits (199), Expect = 7.081e-12
Identity = 135/584 (23.12%), Postives = 230/584 (39.38%), Query Frame = 3
Query:  927 CKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGR-----ILDDKDVMFERFSKDDAKWIKVETNDDKYQVTF-----DRKKEG-NILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEI--YMAMKPVQINCFVSGYPIR---------SEEE-----------------------IQLRVIN----QSSPIVIRLLGRKYDEMDGIQMSYEVAYQKKLVQGATYVLECFYFDXXXXXXXXXXXXXXIASQPDIPKVSVLCSGSSGVAFQIERP--HE-TIETKIVTKDELFFAPSTNFDSLTKKSSRIIQVEK------------------------NAANKSQ----IYVLENLKPYTNYSFRWDXXXXXXXXXXXXXXATTXXXXXXXXXXXXRFL-TTKNIIIVIVDWDEDCPY-KGANAAIRDVYIK----MKKENDDSNIE----WNWVETN-----FTMDVERKRLEFPIFMDKPQL---------------------NYEIEVTLRSALGNSEPIIESYQ-AKTVLAGSLFTCFPKCSG 2327
            C VT  + + P   V   ASL I+V++ P II   L+       +   L C+         IL+      E+      +W  VE    +Y ++      DR+    + L L I DV+  D GL++CT  N AG+ +  G + V   P L     E   ++  KP   +C V+GYP+          +EEE                       +Q++++     +   + I L+  + ++  GI  +YEV   ++   G   V+ C Y    N+    +    + A++P  P +++LC+G   V F +  P  HE ++ T+ +   ++ FAP+  F +    +S ++ +                             NK+Q    I  ++ L   T Y F W S N F  S  +  +  T +L+ P   K++ F   T N + + V   + CPY  GA A + D+ ++    M  E+D S         W E         +D        P   D+ QL                     NYE+++  R+    S+     Y+ ++TV + SL  C+P C+ 
Sbjct:  447 CAVTSEVKSDPVYKVTTNASLDIEVILVPQIINRTLLLAERSLEDAVKLTCVAVANGPPEMILEFSKTGSEQERNSTLQWQPVEP---RYGLSMRHIPPDRQMPTVHRLVLDISDVRRTDHGLYRCTVWNQAGRTQATGQVLVRSPPELSIIPQETNYFVGHKPWIASCHVTGYPLTRSQTTPSSVAEEETTSGDQGSKQAGVNSEGSAANSSVQMKIMTVEGERMDGVEINLIKYEANDFLGINATYEVHMNQRF--GNEAVIRCEYIHTDNRVVYQELFLRE-ATKPPAPNITLLCAGPKAVVFGVTNPRVHEGSLLTERIVTQKVIFAPAKTFHNSGGLASLLVYLNSEGQPSASPINRTTNITDDFSHATVTGPNKAQPQTAIIPVKGLMADTEYVFEWSSGNVFGLSAMVQFTLWTTRLENPPVIKNVFFHKPTNNFLRISVFLADPCPYGGGARAELSDLLVRYRQTMVNESDPSKSSLIGVGEWTEMQVCQNLMGLDKTENSANSP-GADEEQLGIKWAGDTPLPCEIPVEDAGDNYEVQLATRNRFDKSDWFTVIYRPSQTVQSASL--CYPTCTA 1021          
BLAST of Fasciclin-2 vs. TrEMBL
Match: A0A4S2M762 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003218 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 1.463e-11
Identity = 115/481 (23.91%), Postives = 197/481 (40.96%), Query Frame = 3
Query:  927 CKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGR-----ILDDKDVMFERFSKDDAKWIKVETNDDKYQVTF-----DRKKEG-NILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEI--YMAMKPVQINCFVSGYPIR---------SEEE-----------------------IQLRVIN----QSSPIVIRLLGRKYDEMDGIQMSYEVAYQKKLVQGATYVLECFYFDXXXXXXXXXXXXXXIASQPDIPKVSVLCSGSSGVAFQIERP--HE-TIETKIVTKDELFFAPSTNFDSLTKKSSRIIQVEK------------------------NAANKSQ----IYVLENLKPYTNYSFRWDXXXXXXXXXXXXXXATTXXXXXXXXXXXXRFL-TTKNIIIVIVDWDEDCPY-KGANAAIRDVYIK----MKKENDDS 2111
            C VT  + + P   V   ASL I+V++ P II   L+       +   L C+         IL+      E+      +W  VE    +Y ++      DR+    + L L I DV+  D GL++CT  N AG+ +  G + V   P L     E   ++  KP   +C V+GYP+          +EEE                       +Q++++     +   + I L+  + ++  GI  +YEV   ++   G   V+ C Y    N+    +    + A++P  P +++LC+G   V F +  P  HE ++ T+ +   ++ FAP+  F +    +S ++ +                             NK+Q    I  ++ L   T Y F W S N F  S  +  +  T +L+ P   K++ F   T N + + V   + CPY  GA A + D+ ++    M  E+D S
Sbjct:  447 CAVTSEVKSDPVYKVTTNASLDIEVILVPQIINRTLLLAERSLEDAVKLTCVAVANGPPEMILEFSKTGSEQERNSTLQWQPVEP---RYGLSMRHIPPDRQMPTVHRLVLDISDVRRTDHGLYRCTVWNQAGRTQATGQVLVRSPPELSIIPQETNYFVGHKPWIASCHVTGYPLTRSQTTPSSVAEEETTSGDQGSKQAGVNSEGSAANSSVQMKIMTVEGERMDGVEINLIKYEANDFLGINATYEVHMNQRF--GNEAVIRCEYIHTDNRVVYQELFLRE-ATKPPAPNITLLCAGPKAVVFGVTNPRVHEGSLLTERIVTQKVIFAPAKTFHNSGGLASLLVYLNSEGQPSASPINRTTNITDDFSHATVTGPNKAQPQTAIIPVKGLMADTEYVFEWSSGNVFGLSAMVQFTLWTTRLENPPVIKNVFFHKPTNNFLRISVFLADPCPYGGGARAELSDLLVRYRQTMVNESDPS 921          
BLAST of Fasciclin-2 vs. Ensembl Cavefish
Match: ENSAMXT00000039609.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:23099432:23108344:-1 gene:ENSAMXG00000038764.1 transcript:ENSAMXT00000039609.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 5.157e-7
Identity = 48/157 (30.57%), Postives = 66/157 (42.04%), Query Frame = 3
Query: 1029 DLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETN---DDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYPIRSEEEIQLRVINQSSPIVIRLLGRK 1490
            ++ +VTAK  + A LKC I GR + +             KW K         KY  T D    G   TLTI   Q ED GL+ C A+N AG+ +  G L +E  P    P+ +   A       C   G  +R    I +  I +  P ++ L G K
Sbjct:   43 EMDEVTAKLGQTATLKCQIIGRPVPE------------IKWYKAGKEIKEGRKYAATSD----GRNHTLTISTEQQEDEGLYTCKAVNEAGECETSGTLVLEAAPQFPVPLKDKIFA------GC---GTTVR----IHVMYIGRPEPKIMWLHGSK 170          
BLAST of Fasciclin-2 vs. Ensembl Cavefish
Match: ENSAMXT00000051666.1 (pep primary_assembly:Astyanax_mexicanus-2.0:19:23098242:23107097:-1 gene:ENSAMXG00000038764.1 transcript:ENSAMXT00000051666.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.407e-6
Identity = 47/154 (30.52%), Postives = 68/154 (44.16%), Query Frame = 3
Query: 1020 IKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETN---DDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMA--MKPVQINCFVSGYPIRSEEEIQLRVINQSSPI 1466
            ++ ++ +VTAK  + A LKC I GR + +             KW K         KY  T D    G   TLTI   Q ED GL+ C A+N AG+ +  G L +E  P    P+ +   A     V+I+    G P     E ++  ++ S PI
Sbjct:   22 LRKEMDEVTAKLGQTATLKCQIIGRPVPE------------IKWYKAGKEIKEGRKYAATSD----GRNHTLTISTEQQEDEGLYTCKAVNEAGECETSGTLVLEAAPQFPVPLKDKIFAGCGTTVRIHVMYIGRP-----EPKIMWLHGSKPI 154          
BLAST of Fasciclin-2 vs. Ensembl Nematostella
Match: EDO29925 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T292])

HSP 1 Score: 67.781 bits (164), Expect = 8.915e-12
Identity = 60/250 (24.00%), Postives = 99/250 (39.60%), Query Frame = 3
Query:  714 PIDPKIELENELPILEGQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYPIRSEEEIQLRVINQSSP 1463
            P+   +  EN+   LEG EV+L C     PA ++ +  +         +  NG +I  I  ITK LE  Y C+    L          T    + V + P +       +T  +N  A + C  TG            F   +  W K+  + D  ++++D +       L IKDV++ DRG + C+A N  G+      + V+  P ++     I    +P             + +E+QLRV    +P
Sbjct:   74 PVAIVVRPENQTE-LEGNEVSLNCNTSGIPAPSITWYRQDGGYMPANHRVVNGDLI--ISNITKSLEGTYVCEAKNVLGA-------RTKEATVSVNIAPRLTSLHKTPLTIIENSTAVVPCTSTG------------FPTPEISWSKIGNSMDVSRMSYDSQ------ALIIKDVRYSDRGTYVCSATNEEGRVNGTVTVIVQVAPRVHQQPKAIEFGYRP-------------ASKELQLRVFGFPTP 282          
BLAST of Fasciclin-2 vs. Ensembl Nematostella
Match: EDO46350 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQE6])

HSP 1 Score: 66.2402 bits (160), Expect = 3.596e-11
Identity = 66/275 (24.00%), Postives = 108/275 (39.27%), Query Frame = 3
Query:  714 PIDPKIELENELPILEGQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYPIRSEEEIQLRV-------INQSSPIVIRLLGRKYDEMDGIQM 1517
            P+   +  EN+   LEG EV+L C     PA ++ +  +         +  NG +I  I  ITK LE  Y C+    L          T    + V + P +       +T  +N  A + C  TG            F   +  W K+  + D  ++++D +       L IKDV++ DRG + C+A N  G+      + V+  P ++     I    +P             + +E+QLRV       I  S P  +R    + ++ DG  M
Sbjct:  420 PVAIVVRPENQTE-LEGNEVSLNCNASGIPAPSITWYRQDGGYMPVNHRVVNGDLI--ISNITKSLEGTYVCEAKNVLGA-------RTKEATVLVNIAPRLTSLHKTPLTIVENSTAVVPCTSTG------------FPTPEISWSKIGNSMDVSRMSYDSQ------ALIIKDVRYSDRGTYVCSATNEEGRVNGTVTVIVQVAPRVHQQPKAIEFGYRP-------------ASKELQLRVFGFPPPNITWSGP-ALRHSKSRVNQSDGSLM 652          
BLAST of Fasciclin-2 vs. Ensembl Medaka
Match: zgc:152904 (neural cell adhesion molecule 2 [Source:NCBI gene;Acc:101169522])

HSP 1 Score: 63.5438 bits (153), Expect = 7.193e-10
Identity = 62/221 (28.05%), Postives = 90/221 (40.72%), Query Frame = 3
Query:  765 QEVNLICTFKTFPAQAVIFPVETNTLFQ----TIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYM-AMKPVQINCFVSGYP 1412
            + V   C     P  AV +  +   L      T D+   G+  L I  I +     Y CK T        K   +   L + V V P+I +  L  VTA +   A + C+  G  L   D+ + R S   +    V+  D +++V   R + G  + LTI  V+  D G F C A +  G  +K  FL +E +P   T  S  Y     PV I+C V   P
Sbjct:  160 ESVTFTCITSGSPEPAVTWHRKGQQLEPSEQYTFDKKEGGRSTLTIRNIRQTDGGAYACKATN-------KAGSQERELFLKVFVQPHITQ--LKNVTAVEGSAAMISCVAEGEPL--PDISWRRASDGQSFMDGVKNRDGRFEV---RGRHGKSV-LTISGVRLTDLGRFDCEAQSRIGGHQKSMFLDIEYVPKFLTNQSIFYSWEGNPVNISCDVMSNP 365          

HSP 2 Score: 55.8398 bits (133), Expect = 1.717e-7
Identity = 49/179 (27.37%), Postives = 83/179 (46.37%), Query Frame = 3
Query:  882 LKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYI-IKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYPI 1415
            L+I ++TK  E +Y+C+     ++V  +   +   + + V VPP + +       TA   E     C+ +G    +  V + R      K  ++E ++   Q TFD KKEG   TLTI++++  D G + C A N AG  ++  FLKV   P +    +   +      I+C   G P+
Sbjct:  105 LQIHQVTKADEGVYRCE-----ASVEARGEIDFVDIAVVVNVPPVLSVFQQSFNATADYQESVTFTCITSGS--PEPAVTWHR------KGQQLEPSE---QYTFD-KKEGGRSTLTIRNIRQTDGGAYACKATNKAGSQERELFLKVFVQPHITQLKNVTAVEGSAAMISCVAEGEPL 266          
BLAST of Fasciclin-2 vs. Ensembl Medaka
Match: zgc:152904 (neural cell adhesion molecule 2 [Source:NCBI gene;Acc:101169522])

HSP 1 Score: 63.1586 bits (152), Expect = 8.955e-10
Identity = 62/221 (28.05%), Postives = 90/221 (40.72%), Query Frame = 3
Query:  765 QEVNLICTFKTFPAQAVIFPVETNTLFQ----TIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYM-AMKPVQINCFVSGYP 1412
            + V   C     P  AV +  +   L      T D+   G+  L I  I +     Y CK T        K   +   L + V V P+I +  L  VTA +   A + C+  G  L   D+ + R S   +    V+  D +++V   R + G  + LTI  V+  D G F C A +  G  +K  FL +E +P   T  S  Y     PV I+C V   P
Sbjct:  225 ESVTFTCITSGSPEPAVTWHRKGQQLEPSEQYTFDKKEGGRSTLTIRNIRQTDGGAYACKATN-------KAGSQERELFLKVFVQPHITQ--LKNVTAVEGSAAMISCVAEGEPL--PDISWRRASDGQSFMDGVKNRDGRFEV---RGRHGKSV-LTISGVRLTDLGRFDCEAQSRIGGHQKSMFLDIEYVPKFLTNQSIFYSWEGNPVNISCDVMSNP 430          

HSP 2 Score: 56.225 bits (134), Expect = 1.469e-7
Identity = 49/179 (27.37%), Postives = 83/179 (46.37%), Query Frame = 3
Query:  882 LKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYI-IKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYPI 1415
            L+I ++TK  E +Y+C+     ++V  +   +   + + V VPP + +       TA   E     C+ +G    +  V + R      K  ++E ++   Q TFD KKEG   TLTI++++  D G + C A N AG  ++  FLKV   P +    +   +      I+C   G P+
Sbjct:  170 LQIHQVTKADEGVYRCE-----ASVEARGEIDFVDIAVVVNVPPVLSVFQQSFNATADYQESVTFTCITSGS--PEPAVTWHR------KGQQLEPSE---QYTFD-KKEGGRSTLTIRNIRQTDGGAYACKATNKAGSQERELFLKVFVQPHITQLKNVTAVEGSAAMISCVAEGEPL 331          
BLAST of Fasciclin-2 vs. Ensembl Medaka
Match: zgc:152904 (neural cell adhesion molecule 2 [Source:NCBI gene;Acc:101169522])

HSP 1 Score: 63.1586 bits (152), Expect = 9.141e-10
Identity = 62/221 (28.05%), Postives = 90/221 (40.72%), Query Frame = 3
Query:  765 QEVNLICTFKTFPAQAVIFPVETNTLFQ----TIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYM-AMKPVQINCFVSGYP 1412
            + V   C     P  AV +  +   L      T D+   G+  L I  I +     Y CK T        K   +   L + V V P+I +  L  VTA +   A + C+  G  L   D+ + R S   +    V+  D +++V   R + G  + LTI  V+  D G F C A +  G  +K  FL +E +P   T  S  Y     PV I+C V   P
Sbjct:  225 ESVTFTCITSGSPEPAVTWHRKGQQLEPSEQYTFDKKEGGRSTLTIRNIRQTDGGAYACKATN-------KAGSQERELFLKVFVQPHITQ--LKNVTAVEGSAAMISCVAEGEPL--PDISWRRASDGQSFMDGVKNRDGRFEV---RGRHGKSV-LTISGVRLTDLGRFDCEAQSRIGGHQKSMFLDIEYVPKFLTNQSIFYSWEGNPVNISCDVMSNP 430          

HSP 2 Score: 55.8398 bits (133), Expect = 1.808e-7
Identity = 49/179 (27.37%), Postives = 83/179 (46.37%), Query Frame = 3
Query:  882 LKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYI-IKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYPI 1415
            L+I ++TK  E +Y+C+     ++V  +   +   + + V VPP + +       TA   E     C+ +G    +  V + R      K  ++E ++   Q TFD KKEG   TLTI++++  D G + C A N AG  ++  FLKV   P +    +   +      I+C   G P+
Sbjct:  170 LQIHQVTKADEGVYRCE-----ASVEARGEIDFVDIAVVVNVPPVLSVFQQSFNATADYQESVTFTCITSGS--PEPAVTWHR------KGQQLEPSE---QYTFD-KKEGGRSTLTIRNIRQTDGGAYACKATNKAGSQERELFLKVFVQPHITQLKNVTAVEGSAAMISCVAEGEPL 331          
BLAST of Fasciclin-2 vs. Ensembl Medaka
Match: dscama (Down syndrome cell adhesion molecule homolog [Source:NCBI gene;Acc:101158128])

HSP 1 Score: 51.6026 bits (122), Expect = 4.276e-6
Identity = 81/354 (22.88%), Postives = 152/354 (42.94%), Query Frame = 3
Query:  339 GTYKCKH--DKKLDLTKSISITLKDKTLIPTFHKVELYFPK---NRPIKIECPL--KDQQSFKSWLYSIGKNNIYVNKPGKG--TNYEITEDKLSFTIMENAKEPIKVLWCQYQELIDNQLRTGFYEFKWILYDPIDPKIELENELPILEGQEVNLICTFKTFPAQAVIF------------PVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIK-PDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLP 1334
            G Y C      +L   +S+ IT+K   + PT H  E  FP+    + + I C +   DQ  F +W            K G+    +  +T D + FT          +    Y  +  NQ     ++ + I+  P    ++ +++  I  G+ V L C+ + +P   + +            P+  N+ F+ I+   NG +++K   + ++    Y C+V+  +        + + S+ ++V +P  I   P+     A + E+  + C   G    +K +M  R+ K++ + I  ET+  +Y V+     +  + TL I     ED G F C AIN+ G+D+ +  L V++ P
Sbjct:  571 GEYTCNVLVQPQLSTHQSVYITVK---VPPTIHPFE--FPRFSIGQRVFIPCVVMSGDQPVFITW-----------QKDGRPIPASLGVTIDNIDFTSSLRVSNLTLMHNGNYTCIARNQAAAVEHQSELIVRVPPKFVVQPKDQDGIY-GKSVTLNCSAQGYPVPTIQWEYSKGAGVPQFKPIALNSGFR-IEVLVNGSLLIK--HVLEEDSGFYLCRVSNDVG------ADVSKSMYLNVKIPAMITSYPN--TTLATQGEEKKMSCTAHG----EKPIMV-RWEKEE-RIINPETS--RYVVSVKEAGDEVVSTLQIMPTVREDSGFFSCHAINSYGEDRGIIQLTVQEPP 888          
BLAST of Fasciclin-2 vs. Planmine SMEST
Match: SMESG000038431.1 (SMESG000038431.1)

HSP 1 Score: 1441.4 bits (3730), Expect = 0.000e+0
Identity = 767/768 (99.87%), Postives = 768/768 (100.00%), Query Frame = 3
Query:   96 CCKDPQKITFLPPFNDAENFGVNKGEDIVIVCCHPDGADYLKWEDYNQKIISYKSKSGIFSLKDEKXXXXXXXXXXXXXXAGTYKCKHDKKLDLTKSISITLKDKTLIPTFHKVELYFPKNRPIKIECPLKDQQSFKSWLYSIGKNNIYVNKPGKGTNYEITEDKLSFTIMENAKEPIKVLWCQYQELIDNQLRTGFYEFKWILYDPIDPKIELENELPILEGQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCFVSGYPIRSEEEIQLRVINQSSPIVIRLLGRKYDEMDGIQMSYEVAYQKKLVQGATYVLECFYFDXXXXXXXXXXXXXXIASQPDIPKVSVLCSGSSGVAFQIERPHETIETKIVTKDELFFAPSTNFDSLTKKSSRIIQVEKNAANKSQIYVLENLKPYTNYSFRWDXXXXXXXXXXXXXXATTXXXXXXXXXXXXRFLTTKNIIIVIVDWDEDCPYKGANAAIRDVYIKMKKENDDSNIEWNWVETNFTMDVERKRLEFPIFMDKPQLNYEIEVTLRSALGNSEPIIESYQAKTVLAGSLFTCFPKCSGQNLFSSFPLLKCAIIAYLLSFLIL 2399
            CCKDPQKITFLPPFNDAENFGVNKGEDIVIVCCHPDGADYLKWEDYNQKIISYKSKSGIFSLKDEKNRLILRIDNINITNAGTYKCKHDKKLDLTKSISITLKDKTLIPTFHKVELYFPKNRPIKIECPLKDQQSFKSWLYSIGKNNIYVNKPGKGTNYEITEDKLSFTIMENAKEPIKVLWCQYQELIDNQLRTGFYEFKWILYDPIDPKIELENELPILEGQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVL+TPVSEIYMAMKPVQINCFVSGYPIRSEEEIQLRVINQSSPIVIRLLGRKYDEMDGIQMSYEVAYQKKLVQGATYVLECFYFDNQNKRQQNKNIKLKIASQPDIPKVSVLCSGSSGVAFQIERPHETIETKIVTKDELFFAPSTNFDSLTKKSSRIIQVEKNAANKSQIYVLENLKPYTNYSFRWDSYNSFQFSNSLNLSATTKKLQPPSKPKSLRFLTTKNIIIVIVDWDEDCPYKGANAAIRDVYIKMKKENDDSNIEWNWVETNFTMDVERKRLEFPIFMDKPQLNYEIEVTLRSALGNSEPIIESYQAKTVLAGSLFTCFPKCSGQNLFSSFPLLKCAIIAYLLSFLIL
Sbjct:   17 CCKDPQKITFLPPFNDAENFGVNKGEDIVIVCCHPDGADYLKWEDYNQKIISYKSKSGIFSLKDEKNRLILRIDNINITNAGTYKCKHDKKLDLTKSISITLKDKTLIPTFHKVELYFPKNRPIKIECPLKDQQSFKSWLYSIGKNNIYVNKPGKGTNYEITEDKLSFTIMENAKEPIKVLWCQYQELIDNQLRTGFYEFKWILYDPIDPKIELENELPILEGQEVNLICTFKTFPAQAVIFPVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFLSTVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRILDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQWEDRGLFQCTAINAAGKDKKVGFLKVEKLPVLFTPVSEIYMAMKPVQINCFVSGYPIRSEEEIQLRVINQSSPIVIRLLGRKYDEMDGIQMSYEVAYQKKLVQGATYVLECFYFDNQNKRQQNKNIKLKIASQPDIPKVSVLCSGSSGVAFQIERPHETIETKIVTKDELFFAPSTNFDSLTKKSSRIIQVEKNAANKSQIYVLENLKPYTNYSFRWDSYNSFQFSNSLNLSATTKKLQPPSKPKSLRFLTTKNIIIVIVDWDEDCPYKGANAAIRDVYIKMKKENDDSNIEWNWVETNFTMDVERKRLEFPIFMDKPQLNYEIEVTLRSALGNSEPIIESYQAKTVLAGSLFTCFPKCSGQNLFSSFPLLKCAIIAYLLSFLIL 784          
The following BLAST results are available for this feature:
BLAST of Fasciclin-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NCAM11.086e-725.33neural cell adhesion molecule 1 [Source:HGNC Symbo... [more]
NCAM11.133e-725.33neural cell adhesion molecule 1 [Source:HGNC Symbo... [more]
NCAM14.711e-624.44neural cell adhesion molecule 1 [Source:HGNC Symbo... [more]
NCAM15.178e-624.44neural cell adhesion molecule 1 [Source:HGNC Symbo... [more]
NCAM15.555e-624.56neural cell adhesion molecule 1 [Source:HGNC Symbo... [more]
back to top
BLAST of Fasciclin-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fasciclin-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dscam11.275e-825.36gene:FBgn0033159 transcript:FBtr0111083[more]
Dscam11.297e-825.36gene:FBgn0033159 transcript:FBtr0306784[more]
Dscam11.297e-825.36gene:FBgn0033159 transcript:FBtr0306779[more]
Dscam11.298e-825.36gene:FBgn0033159 transcript:FBtr0306769[more]
Dscam11.308e-825.36gene:FBgn0033159 transcript:FBtr0111070[more]
back to top
BLAST of Fasciclin-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zgc:1529041.327e-727.87zgc:152904 [Source:ZFIN;Acc:ZDB-GENE-060929-856][more]
ttn.11.507e-631.62titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
ttn.11.572e-631.62titin, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GEN... [more]
hmcn23.912e-625.85hemicentin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-9765... [more]
back to top
BLAST of Fasciclin-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
eftud25.619e-725.17elongation factor Tu GTP binding domain containing... [more]
eftud26.271e-725.17elongation factor Tu GTP binding domain containing... [more]
back to top
BLAST of Fasciclin-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ncam19.267e-825.32neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
Ncam18.918e-724.34neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
Ncam11.056e-624.34neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
Ncam11.325e-624.45neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
Ncam11.360e-624.45neural cell adhesion molecule 1 [Source:MGI Symbol... [more]
back to top
BLAST of Fasciclin-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|P31836|NCAM1_BOVIN5.826e-1026.32Neural cell adhesion molecule 1 OS=Bos taurus OX=9... [more]
sp|P13596|NCAM1_RAT2.359e-725.22Neural cell adhesion molecule 1 OS=Rattus norvegic... [more]
sp|P13591|NCAM1_HUMAN5.214e-725.33Neural cell adhesion molecule 1 OS=Homo sapiens OX... [more]
sp|P13590|NCAM1_CHICK7.832e-624.44Neural cell adhesion molecule 1 OS=Gallus gallus O... [more]
back to top
BLAST of Fasciclin-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3P3F53.843e-1921.14Ig-like domain-containing protein (Fragment) OS=Sc... [more]
A0A183SUS51.337e-1222.40Ig-like domain-containing protein OS=Schistocephal... [more]
G7YCS12.931e-1222.26Uncharacterized protein OS=Clonorchis sinensis OX=... [more]
A0A4S2M8H67.081e-1223.12Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2M7621.463e-1123.91Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Fasciclin-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSAMXT00000039609.15.157e-730.57pep primary_assembly:Astyanax_mexicanus-2.0:19:230... [more]
ENSAMXT00000051666.11.407e-630.52pep primary_assembly:Astyanax_mexicanus-2.0:19:230... [more]
back to top
BLAST of Fasciclin-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fasciclin-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fasciclin-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO299258.915e-1224.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO463503.596e-1124.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fasciclin-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
zgc:1529047.193e-1028.05neural cell adhesion molecule 2 [Source:NCBI gene;... [more]
zgc:1529048.955e-1028.05neural cell adhesion molecule 2 [Source:NCBI gene;... [more]
zgc:1529049.141e-1028.05neural cell adhesion molecule 2 [Source:NCBI gene;... [more]
dscama4.276e-622.88Down syndrome cell adhesion molecule homolog [Sour... [more]
back to top
BLAST of Fasciclin-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000038431.10.000e+099.87SMESG000038431.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031444 ID=SMED30031444|Name=Fasciclin-2|organism=Schmidtea mediterranea sexual|type=transcript|length=2569bp
TCTATATAAATCTTATATGAGAAATTTTATTGTTAAATATTACAAATATG
AAGATTGTTTATATACTTATTTTGACAATAATCAATCTCTATTTATGTTG
TAAAGATCCTCAAAAAATTACTTTTCTCCCTCCATTTAACGATGCAGAAA
ATTTCGGTGTTAATAAAGGTGAGGATATTGTTATCGTGTGCTGTCACCCA
GACGGAGCTGATTATTTAAAATGGGAAGATTATAATCAAAAAATTATATC
TTATAAAAGTAAAAGTGGAATTTTCAGCTTGAAAGATGAGAAAAATCGAT
TAATTTTGAGAATTGACAATATTAATATTACAAATGCTGGGACATATAAA
TGTAAACATGATAAAAAATTGGATTTGACCAAATCCATTAGTATAACTTT
GAAAGATAAAACTCTGATTCCAACATTTCATAAAGTTGAATTGTATTTCC
CGAAAAATCGTCCTATTAAAATTGAATGTCCTTTAAAAGATCAACAGTCT
TTTAAATCTTGGTTATACTCAATAGGAAAAAACAATATTTACGTGAATAA
ACCTGGTAAAGGAACTAATTATGAAATAACCGAAGATAAACTGTCATTTA
CAATCATGGAAAATGCAAAGGAACCCATCAAAGTTCTCTGGTGTCAATAC
CAAGAGCTGATTGACAATCAATTGAGAACTGGTTTCTATGAATTCAAATG
GATATTATACGATCCAATCGATCCGAAAATTGAATTGGAAAATGAATTAC
CAATATTGGAAGGCCAAGAAGTCAATCTGATATGTACTTTCAAAACGTTC
CCCGCTCAAGCTGTTATATTTCCAGTAGAAACCAATACTTTATTTCAGAC
TATTGATCAAAGCTACAATGGCAAAGTCATATTGAAGATTCCGAAGATTA
CGAAAGATCTCGAAAAAATATATCAATGTAAAGTCACCAAATTCTTGAGT
ACTGTCCCATTCAAACTAGTCGAAGAAACTGCTAGCTTGAAAATTGATGT
TGTCGTTCCGCCATATATTATCAAACCGGATTTAATGAAAGTGACTGCGA
AAAAAAACGAACAGGCTTATCTGAAATGCATGATAACTGGAAGAATTCTC
GATGACAAAGATGTGATGTTTGAAAGGTTTTCAAAGGACGATGCCAAATG
GATAAAGGTGGAGACGAATGATGACAAATATCAAGTGACATTCGATCGGA
AAAAAGAAGGAAATATTTTGACTTTGACTATTAAAGATGTGCAATGGGAA
GATCGAGGATTATTTCAATGCACTGCAATTAATGCTGCGGGTAAAGACAA
GAAAGTTGGTTTTCTGAAAGTTGAAAAACTTCCAGTATTATATACACCAG
TTTCTGAAATCTATATGGCTATGAAACCCGTTCAAATTAACTGTTTTGTG
TCAGGATATCCAATAAGATCTGAAGAAGAAATTCAACTAAGAGTTATAAA
CCAATCATCGCCAATCGTAATACGACTTCTTGGCAGAAAATATGATGAAA
TGGATGGTATACAAATGTCTTATGAAGTAGCTTATCAAAAAAAATTAGTA
CAAGGTGCTACATATGTCTTAGAATGCTTTTATTTTGATAATCAAAATAA
AAGACAACAAAATAAAAATATTAAACTCAAGATTGCCAGTCAGCCAGATA
TTCCTAAAGTTTCTGTTTTATGCTCTGGATCGTCTGGGGTCGCATTTCAA
ATTGAAAGGCCTCATGAAACTATTGAAACAAAAATTGTAACTAAAGATGA
ATTATTTTTTGCTCCATCAACAAATTTTGATTCATTAACAAAGAAATCTT
CACGAATTATTCAGGTAGAAAAAAATGCAGCCAACAAATCTCAAATATAT
GTATTGGAGAACCTAAAGCCATATACAAATTATTCATTTCGATGGGATTC
ATATAATTCTTTTCAATTTTCAAATTCTTTGAATTTGTCAGCGACTACAA
AAAAACTTCAGCCCCCTTCAAAACCAAAATCACTAAGATTTTTGACAACA
AAGAATATTATCATAGTAATTGTTGATTGGGATGAAGATTGTCCATACAA
AGGAGCAAATGCAGCTATCAGAGATGTATATATTAAAATGAAGAAAGAAA
ACGATGATTCTAACATTGAATGGAATTGGGTTGAGACTAATTTTACAATG
GATGTAGAAAGAAAACGTCTCGAATTTCCGATTTTTATGGATAAACCACA
ATTGAATTACGAGATTGAAGTTACCCTAAGAAGTGCACTAGGTAATTCTG
AACCCATCATCGAATCTTATCAAGCTAAAACTGTCTTGGCCGGATCTTTG
TTTACATGTTTTCCTAAATGCTCAGGCCAAAATTTATTTTCAAGTTTCCC
TTTATTAAAATGTGCAATAATCGCTTATTTGTTATCATTTCTAATTTTGT
AACTTTTCGGAAATTTTGAAATGGAATCTTACATTGCTATGGAATTATAA
ATGAAGCATGCAAATTTGTATCTGTATATCATCTCATGAAGTTTATACAT
TAGTTTTGATTTTTGATTTTGTCCTAATTATTTTTATTAAAGATCCTTAT
GCTTGTTATTTCTCGTTTG
back to top

protein sequence of SMED30031444-orf-1

>SMED30031444-orf-1 ID=SMED30031444-orf-1|Name=SMED30031444-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=785bp
MKIVYILILTIINLYLCCKDPQKITFLPPFNDAENFGVNKGEDIVIVCCH
PDGADYLKWEDYNQKIISYKSKSGIFSLKDEKNRLILRIDNINITNAGTY
KCKHDKKLDLTKSISITLKDKTLIPTFHKVELYFPKNRPIKIECPLKDQQ
SFKSWLYSIGKNNIYVNKPGKGTNYEITEDKLSFTIMENAKEPIKVLWCQ
YQELIDNQLRTGFYEFKWILYDPIDPKIELENELPILEGQEVNLICTFKT
FPAQAVIFPVETNTLFQTIDQSYNGKVILKIPKITKDLEKIYQCKVTKFL
STVPFKLVEETASLKIDVVVPPYIIKPDLMKVTAKKNEQAYLKCMITGRI
LDDKDVMFERFSKDDAKWIKVETNDDKYQVTFDRKKEGNILTLTIKDVQW
EDRGLFQCTAINAAGKDKKVGFLKVEKLPVLYTPVSEIYMAMKPVQINCF
VSGYPIRSEEEIQLRVINQSSPIVIRLLGRKYDEMDGIQMSYEVAYQKKL
VQGATYVLECFYFDNQNKRQQNKNIKLKIASQPDIPKVSVLCSGSSGVAF
QIERPHETIETKIVTKDELFFAPSTNFDSLTKKSSRIIQVEKNAANKSQI
YVLENLKPYTNYSFRWDSYNSFQFSNSLNLSATTKKLQPPSKPKSLRFLT
TKNIIIVIVDWDEDCPYKGANAAIRDVYIKMKKENDDSNIEWNWVETNFT
MDVERKRLEFPIFMDKPQLNYEIEVTLRSALGNSEPIIESYQAKTVLAGS
LFTCFPKCSGQNLFSSFPLLKCAIIAYLLSFLIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000103central nervous system
PLANA:0000418head
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR036116FN3_sf
IPR003599Ig_sub
IPR003598Ig_sub2
IPR013098Ig_I-set
IPR013783Ig-like_fold
IPR007110Ig-like_dom
IPR003961FN3_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007155cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 48..118
e-value: 0.95
score: 7.3
coord: 344..424
e-value: 0.065
score: 18.5
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 240..326
e-value: 3.9
score: 15.0
coord: 42..128
e-value: 0.38
score: 19.8
coord: 338..435
e-value: 0.0083
score: 25.3
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 338..434
e-value: 1.5E-7
score: 31.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 538..656
e-value: 1.1E-5
score: 27.6
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 39..128
e-value: 6.6E-6
score: 28.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 327..437
e-value: 1.7E-11
score: 46.3
NoneNo IPR availablePANTHERPTHR12231CTX-RELATED TYPE I TRANSMEMBRANE PROTEINcoord: 41..642
NoneNo IPR availableCDDcd00096Igcoord: 376..426
e-value: 1.68611E-5
score: 41.4589
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 30..124
score: 7.304
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 330..430
score: 9.863
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 42..123
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 233..331
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 328..438
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 605..745