Protocadherin-1

Overview
NameProtocadherin-1
Smed IDSMED30031442
Length (bp)3218
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin-1 (SMED30031442) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30031442) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin-1 (SMED30031442) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin-1 (SMED30031442) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031442

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30031442SMESG000042783.1 dd_Smed_v4_17621_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031442SMESG000042783.1 dd_Smed_v4_17621_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031442SMESG000042783.1 dd_Smed_v4_17621_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031442SMESG000042783.1 dd_Smed_v4_17621_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30031442SMESG000042783.1 dd_Smed_v4_13423_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031442SMESG000042783.1 dd_Smed_v4_13423_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031442SMESG000042783.1 dd_Smed_v4_13423_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30031442SMESG000042783.1 dd_Smed_v6_13423_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30031442SMESG000042783.1 dd_Smed_v6_17621_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 231.491 bits (589), Expect = 7.473e-62
Identity = 179/610 (29.34%), Postives = 292/610 (47.87%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFS-SPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKT 2255
            NDN+P F        I EN+ I S   +P+A D D  P GV SYE++   E  +++   + ED  + KQP LIV   +DRE  D  + T+   DGG PPR     + + VLD ND  P+F +  YE ++ E+   G  ++ ++  D D G N +I   F  +  + ++   +L +    + ++    +D E ++   F+++AKD G  P+S+ A V V V ++ND+ P I        ++ Q     I+E   ++  + LV+V+D D+ +  ++TC +          A +T +  +++K Y +++    D E    + + IV  D+ G   L  TN L+V + D+NDNAPVF+ S       + N+  E++      I A+D D G N  + Y +       K  F+I   TG ++    LD E+ +   +++ A D G P    +  ++VNV D NDN P+  LS Y+F + EN P  + VG V V D D   N +              L   Q  +  F I N +G I + +  DRE  S   F + A     +D G      +     + VT+N+LD+NDN+P +        K + P+    +T
Sbjct:  162 NDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAED-QEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAP-EVVRRLLRLDRNTGLITVQ--GPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGL-VTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGS--DSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS-GNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIA----EITASDADSGSNAELVYSLEP-EPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQ------------LSVEQ-DNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKA-----VDGGVPPRSAY-----VGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGET 735          

HSP 2 Score: 141.739 bits (356), Expect = 1.580e-33
Identity = 160/567 (28.22%), Postives = 243/567 (42.86%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLS----QTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRE-TKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDP--------ILATDKDEGENGTVEYYISNVV------------DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK--NNDY 2369
            ++V D ND  P F+  +  + I E+   G         D+D+G NG  S    +    + Q  F L     Q      L ++  LD E  + Y   +  +D G PPR+S+AL+ V V + ND+ P     +F +P  +      ++E +     +  VK  D D  A++   EIE +   F+        +L  +R T  I  +   DRE   TL F S++  D  G N      ++ V +KD+NDNAP     R  G+V     + +  I++D         +  +D+DEGEN  V   ++  V            D  K YF        ++T   LDYEK+K  +IEI A D G P  SS+  L V V D NDN P    S       EN   G  + ++  +D D+  N + +      L P P       A  +FTI  E+G+I  K  LDRE        ++A+     D G    +        +V VN+LD NDN P  ML             +F        + P   VT     +D D+GEN++V+++++  N D+
Sbjct:  156 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGP--EAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAP-----KFERPSYE----AELSENSPIGHSVIQVKANDSDQGANA---EIEYT---FHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRF-SVLAKD-RGTNPKSARAQVVVTVKDMNDNAPTIEI-RGIGLVTHQ--DGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYF--------LQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYS----LEPEPA------AKGLFTISPETGEIQVKTSLDREQRESYELKVVAA-----DRGSPSLQG-----TATVLVNVLDCNDNDPKFMLSG----------YNFSVMENMPALSPVGMVTV----IDGDKGENAQVQLSVEQDNGDF 658          

HSP 3 Score: 88.9669 bits (219), Expect = 3.522e-17
Identity = 88/319 (27.59%), Postives = 142/319 (44.51%), Query Frame = 3
Query: 1446 EVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSI-------DKNTGVVKTILG-LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            ++ ++DINDN P F+SP     + EN    I ++   P LA+D+D G NG   Y +     + +  F +       +K   ++  ++G LD E+     + I  +D G P R+SS  L V V DTNDN P+ +   Y  EL EN PIG  V +V   D D   N +      +           +   ++  +D  +G I  +  +DRE  S + F+++A      D G +       +    V V + D NDN+P + ++    +  V  +      S  E++  E  V    +  D DEGEN+ V   +  +  F L
Sbjct:  155 QIEVQDINDNTPNFASPVITLAIPEN--TNIGSLFPIP-LASDRDAGPNGVASYEL-QAGPEAQELFGLQVAEDQEEKQPQLI--VMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQ---------APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAK-----DRGTN-----PKSARAQVVVTVKDMNDNAPTIEIRG---IGLVTHQDGMANIS--EDVAEETAVALVQV-SDRDEGENAAVTCVVAGDVPFQL 442          

HSP 4 Score: 69.3218 bits (168), Expect = 3.381e-11
Identity = 59/223 (26.46%), Postives = 93/223 (41.70%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQF---SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFV 1091
            NDN P F    Y   ++EN    S + +    D D          +E+ N +F           + N    ++     DRE      F L AVDGG PPR     + + VLDEND  P     S   +++   ++ + G  +  +  ED DSG N ++  + A      +   FQ+    H  A+ L  +++      +   +   D G+PPR  TALV ++V
Sbjct:  606 NDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDF----------VIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRL-GETVSQVAAEDFDSGVNAELIYSIAGGNPYGL---FQIGS--HSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 812          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 231.876 bits (590), Expect = 1.052e-61
Identity = 179/610 (29.34%), Postives = 292/610 (47.87%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFS-SPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKT 2255
            NDN+P F        I EN+ I S   +P+A D D  P GV SYE++   E  +++   + ED  + KQP LIV   +DRE  D  + T+   DGG PPR     + + VLD ND  P+F +  YE ++ E+   G  ++ ++  D D G N +I   F  +  + ++   +L +    + ++    +D E ++   F+++AKD G  P+S+ A V V V ++ND+ P I        ++ Q     I+E   ++  + LV+V+D D+ +  ++TC +          A +T +  +++K Y +++    D E    + + IV  D+ G   L  TN L+V + D+NDNAPVF+ S       + N+  E++      I A+D D G N  + Y +       K  F+I   TG ++    LD E+ +   +++ A D G P    +  ++VNV D NDN P+  LS Y+F + EN P  + VG V V D D   N +              L   Q  +  F I N +G I + +  DRE  S   F + A     +D G      +     + VT+N+LD+NDN+P +        K + P+    +T
Sbjct:  162 NDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAED-QEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAP-EVVRRLLRLDRNTGLITVQ--GPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGL-VTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGS--DSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS-GNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIA----EITASDADSGSNAELVYSL-EPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQ------------LSVEQ-DNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKA-----VDGGVPPRSAY-----VGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGET 735          

HSP 2 Score: 142.51 bits (358), Expect = 1.172e-33
Identity = 160/567 (28.22%), Postives = 243/567 (42.86%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLS----QTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRE-TKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDP--------ILATDKDEGENGTVEYYISNVV------------DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK--NNDY 2369
            ++V D ND  P F+  +  + I E+   G         D+D+G NG  S    +    + Q  F L     Q      L ++  LD E  + Y   +  +D G PPR+S+AL+ V V + ND+ P     +F +P  +      ++E +     +  VK  D D  A++   EIE +   F+        +L  +R T  I  +   DRE   TL F S++  D  G N      ++ V +KD+NDNAP     R  G+V     + +  I++D         +  +D+DEGEN  V   ++  V            D  K YF        ++T   LDYEK+K  +IEI A D G P  SS+  L V V D NDN P    S       EN   G  + ++  +D D+  N + +      L P P       A  +FTI  E+G+I  K  LDRE        ++A+     D G    +        +V VN+LD NDN P  ML             +F        + P   VT     +D D+GEN++V+++++  N D+
Sbjct:  156 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGP--EAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAP-----KFERPSYE----AELSENSPIGHSVIQVKANDSDQGANA---EIEYT---FHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRF-SVLAKD-RGTNPKSARAQVVVTVKDMNDNAPTIEI-RGIGLVTHQ--DGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYF--------LQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYS----LEPEPA------AKGLFTISPETGEIQVKTSLDREQRESYELKVVAA-----DRGSPSLQG-----TATVLVNVLDCNDNDPKFMLSG----------YNFSVMENMPALSPVGMVTV----IDGDKGENAQVQLSVEQDNGDF 658          

HSP 3 Score: 89.3521 bits (220), Expect = 2.659e-17
Identity = 88/319 (27.59%), Postives = 142/319 (44.51%), Query Frame = 3
Query: 1446 EVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSI-------DKNTGVVKTILG-LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            ++ ++DINDN P F+SP     + EN    I ++   P LA+D+D G NG   Y +     + +  F +       +K   ++  ++G LD E+     + I  +D G P R+SS  L V V DTNDN P+ +   Y  EL EN PIG  V +V   D D   N +      +           +   ++  +D  +G I  +  +DRE  S + F+++A      D G +       +    V V + D NDN+P + ++    +  V  +      S  E++  E  V    +  D DEGEN+ V   +  +  F L
Sbjct:  155 QIEVQDINDNTPNFASPVITLAIPEN--TNIGSLFPIP-LASDRDAGPNGVASYEL-QAGPEAQELFGLQVAEDQEEKQPQLI--VMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQ---------APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAK-----DRGTN-----PKSARAQVVVTVKDMNDNAPTIEIRG---IGLVTHQDGMANIS--EDVAEETAVALVQV-SDRDEGENAAVTCVVAGDVPFQL 442          

HSP 4 Score: 68.9366 bits (167), Expect = 4.437e-11
Identity = 59/223 (26.46%), Postives = 93/223 (41.70%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQF---SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFV 1091
            NDN P F    Y   ++EN    S + +    D D          +E+ N +F           + N    ++     DRE      F L AVDGG PPR     + + VLDEND  P     S   +++   ++ + G  +  +  ED DSG N ++  + A      +   FQ+    H  A+ L  +++      +   +   D G+PPR  TALV ++V
Sbjct:  606 NDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDF----------VIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRL-GETVSQVAAEDFDSGVNAELIYSIAGGNPYGL---FQIGS--HSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 812          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 214.927 bits (546), Expect = 2.984e-56
Identity = 209/701 (29.81%), Postives = 316/701 (45.08%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDD-NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVR---VTMKNNDYFSLTPDYGMLCAMEK--LPPIGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       I ENS INS+ +LP A D D    GV++YE+ K    F +    + E    +K P LIV+ ++DRE  D     +   DGG P R     + + V D ND  P F +   E+ I E+   G  +  L   D D G N KI  +F++  +   +  F L+ T   + +K    LD E    +   ++A D G  P  + A+V V VT+VND+ P+I       P++     + ++E    +  I L+ VTD D +    +TC  +  +  F L  + +N  L     Y        D E+   + + ++ +D  G   L Q+  L + +KD NDNAPVF+       + EN    I  +    + ATD D G N  + Y +     D    FS+D+ TG++  +  LD EK       I AKD GVP  +S+V + V++ D NDN P    + Y F + EN P    VG + VTD D   N+              TL      D  FTID+++G I   +  DRE      F + A         +D  R  R +    VT+N++D NDN P+ +      V   N     +  STN        V F  I VD D G N++VR   V     D F++  + G +  MEK  +  +G ++ ++ A D    +S     ++N+ + E
Sbjct:  165 NDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLD---VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIK--EPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTCFTD-HEIPFRLRPVFSNQFLLENAAY-------LDYESTKEYAIKLLAADA-GKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMK---VSATDADSGPNAEINYLLG---PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAV------------TLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKA---------EDGGRVSRSS-SAKVTINVVDVNDNKPVFI------VPPYNYSYELVLPSTN-----PGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 806          

HSP 2 Score: 73.9442 bits (180), Expect = 1.623e-12
Identity = 79/267 (29.59%), Postives = 118/267 (44.19%), Query Frame = 3
Query: 1440 KLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILG-----------LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLK 2204
            K+  +I+DINDNAP+F +      + EN  +N   T+      A D D G NG   Y +       +N F +D    V++T  G           LD E+     +++  +D G P RSS+  L V+V DTNDN P    +     + EN P+GT V +++ TD D   N K        +        S  A ++F ++  +G I  K  LDRE +      ++AS     D G    R         V VN+ D NDN P + ++
Sbjct:  156 KIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPA----AVDPDVGINGVQNYELIK----SQNIFGLD----VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLV--------SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS-----DGGLMPARAM-------VLVNVTDVNDNVPSIDIR 390          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 213.001 bits (541), Expect = 6.332e-56
Identity = 209/701 (29.81%), Postives = 316/701 (45.08%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDD-NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVR---VTMKNNDYFSLTPDYGMLCAMEK--LPPIGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       I ENS INS+ +LP A D D    GV++YE+ K    F +    + E    +K P LIV+ ++DRE  D     +   DGG P R     + + V D ND  P F +   E+ I E+   G  +  L   D D G N KI  +F++  +   +  F L+ T   + +K    LD E    +   ++A D G  P  + A+V V VT+VND+ P+I       P++     + ++E    +  I L+ VTD D +    +TC  +  +  F L  + +N  L     Y        D E+   + + ++ +D  G   L Q+  L + +KD NDNAPVF+       + EN    I  +    + ATD D G N  + Y +     D    FS+D+ TG++  +  LD EK       I AKD GVP  +S+V + V++ D NDN P    + Y F + EN P    VG + VTD D   N+              TL      D  FTID+++G I   +  DRE      F + A         +D  R  R +    VT+N++D NDN P+ +      V   N     +  STN        V F  I VD D G N++VR   V     D F++  + G +  MEK  +  +G ++ ++ A D    +S     ++N+ + E
Sbjct:  154 NDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLD---VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIK--EPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTCFTD-HEIPFRLRPVFSNQFLLENAAY-------LDYESTKEYAIKLLAADA-GKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMK---VSATDADSGPNAEINYLLG---PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAV------------TLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKA---------EDGGRVSRSS-SAKVTINVVDVNDNKPVFI------VPPYNYSYELVLPSTN-----PGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 795          

HSP 2 Score: 72.0182 bits (175), Expect = 5.536e-12
Identity = 79/267 (29.59%), Postives = 118/267 (44.19%), Query Frame = 3
Query: 1440 KLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILG-----------LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLK 2204
            K+  +I+DINDNAP+F +      + EN  +N   T+      A D D G NG   Y +       +N F +D    V++T  G           LD E+     +++  +D G P RSS+  L V+V DTNDN P    +     + EN P+GT V +++ TD D   N K        +        S  A ++F ++  +G I  K  LDRE +      ++AS     D G    R         V VN+ D NDN P + ++
Sbjct:  145 KIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPA----AVDPDVGINGVQNYELIK----SQNIFGLD----VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLV--------SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS-----DGGLMPARAM-------VLVNVTDVNDNVPSIDIR 379          
BLAST of Protocadherin-1 vs. Ensembl Human
Match: PCDH11Y (protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:HGNC:15813])

HSP 1 Score: 213.001 bits (541), Expect = 6.332e-56
Identity = 209/701 (29.81%), Postives = 316/701 (45.08%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDD-NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVR---VTMKNNDYFSLTPDYGMLCAMEK--LPPIGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       I ENS INS+ +LP A D D    GV++YE+ K    F +    + E    +K P LIV+ ++DRE  D     +   DGG P R     + + V D ND  P F +   E+ I E+   G  +  L   D D G N KI  +F++  +   +  F L+ T   + +K    LD E    +   ++A D G  P  + A+V V VT+VND+ P+I       P++     + ++E    +  I L+ VTD D +    +TC  +  +  F L  + +N  L     Y        D E+   + + ++ +D  G   L Q+  L + +KD NDNAPVF+       + EN    I  +    + ATD D G N  + Y +     D    FS+D+ TG++  +  LD EK       I AKD GVP  +S+V + V++ D NDN P    + Y F + EN P    VG + VTD D   N+              TL      D  FTID+++G I   +  DRE      F + A         +D  R  R +    VT+N++D NDN P+ +      V   N     +  STN        V F  I VD D G N++VR   V     D F++  + G +  MEK  +  +G ++ ++ A D    +S     ++N+ + E
Sbjct:  154 NDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLD---VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIK--EPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTCFTD-HEIPFRLRPVFSNQFLLENAAY-------LDYESTKEYAIKLLAADA-GKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMK---VSATDADSGPNAEINYLLG---PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAV------------TLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKA---------EDGGRVSRSS-SAKVTINVVDVNDNKPVFI------VPPYNYSYELVLPSTN-----PGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 795          

HSP 2 Score: 72.0182 bits (175), Expect = 5.536e-12
Identity = 79/267 (29.59%), Postives = 118/267 (44.19%), Query Frame = 3
Query: 1440 KLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILG-----------LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLK 2204
            K+  +I+DINDNAP+F +      + EN  +N   T+      A D D G NG   Y +       +N F +D    V++T  G           LD E+     +++  +D G P RSS+  L V+V DTNDN P    +     + EN P+GT V +++ TD D   N K        +        S  A ++F ++  +G I  K  LDRE +      ++AS     D G    R         V VN+ D NDN P + ++
Sbjct:  145 KIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPA----AVDPDVGINGVQNYELIK----SQNIFGLD----VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLV--------SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS-----DGGLMPARAM-------VLVNVTDVNDNVPSIDIR 379          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 166.007 bits (419), Expect = 4.615e-41
Identity = 181/711 (25.46%), Postives = 298/711 (41.91%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVN-DSPP---------NIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPM-------MMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRV-TMKNNDYFSLTPDYGMLCAMEKLPPIGDYKTVIVAEDGDFNNSRKQEFLINIHI 2510
            NDN+P+F ++    EI E +++ +  +LP   D D   F V  + I + N N    FKL +    +  Q  L+V  Q+DREF D+ E  + A DGGKP + G+ +  ++++D ND  P FS+  Y   +  +   G  L+ ++  D D G N +IS +   ++     N F +SQ+  GV     S L   T   +   +VA D G P  SS+A+V + V      SPP         N      N  +    AR+ I +   +D  + L+          S  C  +T Q   YL  L    +L              DRET + H +  +    E   Q+   +   + I DINDNAP + S + +  +  NR           + A D D G+NG + Y   +V+D      SIDK TG +     +D      +   + A+D G P  S+ ++++ ++ DT    P+ + + +  E+ E+ PIGT + KV   +     + +                + Q  D+  T+D  SG +  +   D E        +IA+N N             +T    +++ + D NDN P+       + +++ P+     PE   +  S +                D+D G   +V    +  +  FS+ P  G + A + L   G +  V+ A+DG   +S       NIHI
Sbjct:  116 NDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNN--VFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSN-FAISQS--GVITTTASLLPAST---HDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQ-QYRDTKLRLI--------GSSALCPQQTDQAHVYL--LLLCGIL--------------DRETASEHHLKFLL---EKDGQIIIEHPQLLTIGDINDNAPQWHSSQIH--ISLNRTQG----GSRTLTAKDPDLGQNGWIRY---SVLD--TELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRY-------------SLQNQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNAN------------SETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPK-----PEEPLLVVSAS----------------DMDSGTFGEVSYHILSESSSFSINPVTGEVFAQKPLAR-GRFHLVVSAKDGGGQSSENSA---NIHI 729          

HSP 2 Score: 112.464 bits (280), Expect = 1.060e-24
Identity = 142/548 (25.91%), Postives = 237/548 (43.25%), Query Frame = 3
Query:  624 VDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLV--AKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTN-AVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKT 2255
            VD     + ++   D E     + T+IA +           I LK  D ND  P F    Y + ++E       LL +   D DSG  G++S +  S ++         S +++ V  ++ ++   + + +  F+LV  AKD G     ++A + + V + +   P             Q++R      TT+D++  +         A      +   + S Y      N ++ E+     +   +D D     L  +       E  NQ     ++ + I+D NDN P FSS      ++E+ +++E   +    + A+DKD+ +NG V Y I  +     +   ID+ TG + T   LDYE  ++  + + A DLG+P RSS++ L ++V D NDN PE + S+Y+ E+ EN P  T VGKV   DKD+             L  G  +       + F ID + G +YTK  +DRE+ S +  +I+A      D G         +   S  +++LD NDN P  +      V A +P  + I T
Sbjct:  588 VDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSETSTSLISIRLK--DVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESS---------SFSINPVTGEVFAQ---KPLARGRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTP-------------QFSRSKYEIRTTEDILPGI---------AIGSVGAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTVLLNIQATLPSGES-NQ----TQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYV----VQASDKDKKKNGEVRYSI--ISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIVGKVVARDKDS-------------LENGQIVYRITNGSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAE-----DKGVP-----PRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLSTAIGT 1065          

HSP 3 Score: 106.686 bits (265), Expect = 6.448e-23
Identity = 129/491 (26.27%), Postives = 208/491 (42.36%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAK-DFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKD 1901
            NDN P F    Y+  + E  K    + +  A D D   FG  SY I   + +F +   +  E F   ++P+             R    + A DGG    +    I + V+D++   PQFS+  YEI+  E  + G+ +          G+ G +S    S  + D  + F + +    + +     LD +  +    N+ A    G+   S+   V +F+ + ND+PP     QF    S     I I E         +V+ +D D + +    E+  S     +++   +++  ++ T ++ +    D E    + + +  +D  GI        L + + D+NDNAP F    Y   V EN   + +      ++A DKD  ENG + Y I+N       YF ID+  G V T   +D E I HV I I A+D GVP RSS+    ++V D NDN P   LS     +    P+ T +G +   D D
Sbjct:  635 NDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSESSSFSIN-PVTGEVFA--QKPLAR----------GRFHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAI----------GSVGAMSKVKYSIYSGDQDHNFSIDEDTGKIYVT--RYLDADVHDTVLLNIQATLPSGE---SNQTQVVIFIEDHNDNPP-----QF----SSSLVEISIREDLKLHEPFYVVQASDKDKKKNG---EVRYS----IISSHPGSSIEIDQFTGQLSTGSLLDYEATRNYKLRVKATDL-GIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPKTIV---GKVVARDKDSLENGQIVYRITN----GSEYFGIDEKLGNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSC-LSITPIVVPAGSPLSTAIGTIVAMDPD 1072          

HSP 4 Score: 84.7297 bits (208), Expect = 3.802e-16
Identity = 102/398 (25.63%), Postives = 165/398 (41.46%), Query Frame = 3
Query:  738 KTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASS---TNQDI-QNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDN-QADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDP-------ILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNV-KDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVT 1892
            +T++++ + D ND  PQFS  + EI I+E          ++  DKD   NG++  +  SS   ++ +I Q T QLS           S LDYE    Y   + A D G PPRSS   + + V +VND+ P            K +  + + E +    ++  V   D D+ +   I   I    E F +          + K   + +K   DRE  +   +SIV  D +G+     T    + + D+NDN P   S           +  IV     P       I+A D D+G NG+V Y        +++   + K+ G V     L+    +H  + +   D GVP +S    + V + K + D Q +     Y  E+ ++ P G  +  +N T
Sbjct:  820 QTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGSSIEIDQFTGQLSTG---------SLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPE---------FEKSWYTMEVLENSPPKTIVGKVVARDKDSLENGQIVYRITNGSEYFGI----------DEKLGNVYTKRSIDREVISHVDISIVAED-KGVPPRSSTASARISVLDVNDNPPSCLS-----------ITPIVVPAGSPLSTAIGTIVAMDPDKGLNGSVLYRA-----QLQSSLFVVKSNGDVYLRRQLNASDERHQRLSVIVSDQGVPRKSVVCHVPVRISKGSADIQIQEPFQKY-IEIPKSCPTGCRLTTLNAT 1171          

HSP 5 Score: 73.9442 bits (180), Expect = 6.888e-13
Identity = 96/421 (22.80%), Postives = 186/421 (44.18%), Query Frame = 3
Query:  444 PTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDI------QNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFV--TNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDD-DNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRY-YGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVK 1676
            P F +  +  E++ENSKI  +I      ++ +       Y I+ P           ++ F  +K   L V   IDRE     EF +   +     +K + K  + VLDEND  P F+ + Y + +K+S   G ++  +   D+DSG NG++S    S  + +I        + QL++          ++LD      +   + A+D G P R++   V+V +  ++ + S P  V   +          +++ E T+   V+  ++ ++    + D +   ++  Q    ++           KT E+  K   D E++ +  +S+  S ++G N       L+++++ +++ APVF+   Y   I       E V      + A D+D G +G V+Y IS    D ++   I+++TG+++
Sbjct: 2129 PGFEKAEFRFEVMENSKIGLQIGNLSGEESREF-----HYRIQDPE---------ASKIFSIDKFGRLFVAGPIDREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIGQIMASDQDSGENGRVSYRILSGNDLNIVTLNPDTGSIQLNEWND-------AQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVLPVY---------EVHVLEDTSVGTVLQKIRASNRLGMRNDGLLYSLKEHQGKLGIDV----------KTGELTLKTHLDWESEPI--ISMYLSVSDG-NGRSAVVPLKIVVEPVDEFAPVFTKSSYTLQIPISTPAGESV----GQMQAIDEDGGVHGVVKYSIS----DRQSTVKIEEHTGIIR 2498          

HSP 6 Score: 60.4622 bits (145), Expect = 8.361e-9
Identity = 107/470 (22.77%), Postives = 174/470 (37.02%), Query Frame = 3
Query:  663 IDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQF-SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPIS--KQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVF--SSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYY-ISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYEN--EPI----GTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVV 2036
            +DRE        +I  DGG   R     + + V D+ND +PQ  +    E++I ES   G  L   R  D D G NGK S        +D   +  L      + L+ +S L       +   L   D G P       VE  +   N +P      +   P+   KQ     I+EG  +   I                 + E +  ++ +     ++         I++ ++ DRE    + + ++ +   G  Q   T +++V + ++NDN P F  S PR        RV E + +         KD      + Y+ +S+       +F+ID+ TG +     LD+E +   ++ I A D       +   L + V D NDN P      +S  LY+    P     G    K+   D D                   T    Q +  IF +  ESG ++ KV+
Sbjct: 1687 LDREASQEHLLIIILTDGGS--RNDSCTVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGKFSFELL----EDSSGSLDLVPETGDLVLRRLSSL-----QSWKIKLRVVDHGVP----GLYVEKNLEISNRNPQT----EAKAPLEFLKQTYLSTIDEGLPRGQFIA--------------KLQPELAGLTYSIVEGNIDSAFSVDSEGVIRTNLELDREILERYSLKVIGT---GSGQQIGT-RVDVRVNNLNDNVPSFPMSKPR--------RVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSF---DTFTNLTIFVSDINDNAPT-----FSKPLYQTTVSPATFSPGQPFAKIEAHDLDARGAL--------------TYSLGQGSSSIFRVAPESGALFMKVL 2089          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 144.436 bits (363), Expect = 2.048e-34
Identity = 128/492 (26.02%), Postives = 225/492 (45.73%), Query Frame = 3
Query:  438 NSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKD--PILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTD 1907
            N+  F ++ Y KE+ E++ I + I+   A  A   P     Y +  P ++      L T D +  +   + +   +DRE +D+    + A +   P     T +++ VLD  D  P F +  Y  +I+E    G  +L +   D DSG NG+I  +      +++     L+       ++  + LD ET++    +++A D G P R STA+VE+ V +VND+ P      +N         + I E  T   VI  VK TD+D   +    ++  S  S   + +    +  +     ++ +ID     K     +++ +       L  T  L + + DIND+AP   + +    ++EN     V I ++   + A D+D G NG ++Y +    D     F ID+++G++KT   LD E     S++++A+D+G P  ++S  + V +KD NDN P  D   Y+  + E  P G+ +  +   D D D
Sbjct:  161 NAVHFQQEKYVKELPEDTPIETIIASVKASHASSQPL---YYSMVAPQDSRSQ--NLFTLDTMSGE---IRLAKSMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNL-----LAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYN---------VTILENITIPAVIATVKATDEDFGTNG---KVHYSMASS--SGIGGLTIDYSTGEVTLRERID----AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEEN-----VAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDED 611          

HSP 2 Score: 129.028 bits (323), Expect = 8.750e-30
Identity = 157/597 (26.30%), Postives = 252/597 (42.21%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDR----IEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFY--LNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFS-SPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEIS----VTVNILDKNDNSP 2189
            NDN+P F   +Y   ILEN  I + I+   A D D   FG           N  V++ + +   +              RE ID     I   + A DG +P       + + V+D ND  P        I ++E+   G E+  +   D+DSG NG I  +   S +  I     L        +K    LD ET  +YS  + A+D G P  +++  + V + ++ND+ P     ++N  IS++  R           +I L  V +D++Q   IT  IE +    +  L+     A+L    + E+K +   D + +    V I  +D  G   L+    + V I D+N +AP F+  P    I + + +   V   K    A D D G+N  + Y I     D   +F ID ++G +     LD E     S+ ++A D   P  ++S ++ V + D NDN P+   S Y+  + E+ P+GT   +V+  D D   N        +         +S P+ Q+F +D  SG +     LDRE      FA+I            +F + R T  +S    +T+ + D NDN+P
Sbjct:  369 NDNAPVFASDSYNVTILENITIPAVIATVKATDED---FGT----------NGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGL--------IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPR--------GSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILS--VSGELKRQ---DHKVR----VEISATDQGG---LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLK----AEDHDRGDNARIVYSI-----DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNE--------SSSSPSIQLFRLDRTSGTLRVSSKLDREQ-----FAVIV---------LPIFARDRGTPSLSAASEITLTLSDVNDNAP 890          

HSP 3 Score: 122.865 bits (307), Expect = 7.542e-28
Identity = 125/493 (25.35%), Postives = 212/493 (43.00%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFV-DNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMK-NYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKD 1901
            ND++PT         + EN  I   +    A D D  P G+  Y +E             +EDF+ D    ++     +DRE   R    + A D G P     T I + + D ND  P F +  Y + I E    G +++ L+  D D   + KI+     + ++++ +   +     G  L +  +L  +  +K    + A D  Q       +V VF+ +VN +P     Y  + P S     + I E +     +  +K  D D   ++ I   I++SQ  F ++            + +I    D DRE +    V +  SD      L  + ++EVI+ DINDN+P F+S  Y   + E+     V  +   + A D D G NG V+Y+++          F +D+ +G ++    LD E+   + + I A+D G P  S++ ++ + + D NDN P  +   Y   + EN P+G+ VG +   D D
Sbjct:  473 NDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG------------SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEA-DREVFSILDIGD--QGAILSVSGELKRQD-HKVRVEISATD--QGGLQGRCVVNVFIDDVNSAP-----YFNDHPFS-----VKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ-FFRIDP----------SSGDISVSSDLDREDRATFSVIVTASD-HASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIP---VGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDAD 920          

HSP 4 Score: 117.472 bits (293), Expect = 3.518e-26
Identity = 149/596 (25.00%), Postives = 249/596 (41.78%), Query Frame = 3
Query:  435 DNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQF------NKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKEN--RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNV-KDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPN--PLDYGKDLFRQFRDTMEISVTVNILDKNDNSP 2189
            DNSP F + +Y+ EI E++ I + +    A D D    G   Y + + N        L+    ++ K  ++     +DRE +  I   +IA D G P R+    + + V+D ND  P F+   Y + I E+      +  ++  D+D G NGK+  + ASS+         +  +   V L+   ++D +  +  +  + AKD  QP  SST  + + V ++ND  P ++  Q       N  I ++  R+Y                 D+D+  + I        E F +          +  +  IK+    DRET   + + +   D  G   L  +  + V++KDINDNAP F    Y   + E   R ++I+T+      A D DE +   + Y I     ++ +   I  + G + ++ G    +   V +EISA D G        + +VNV  D  ++ P  +   +S ++ E+ PIG  V  +   D D   N +              +  S  + Q F ID  SG I     LDRE  +     + AS+    PL+           + +I V ++  D NDNSP
Sbjct:  265 DNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGK-----NLLA---INAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSG---IGGLTIDYSTGEVTLR--ERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVY---------------AIDEDSGPNGIIKYSMEGSEDFII----------DEDSGLIKTTKLLDRETTARYSLKVTARDM-GTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLK-----AVDNDEDQK--ITYRIEEADREVFSILDIG-DQGAILSVSGELKRQDHKVRVEISATDQG----GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNAR--------------IVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLN----------TSTQIEVILD--DINDNSP 782          

HSP 5 Score: 95.5153 bits (236), Expect = 1.726e-19
Identity = 122/500 (24.40%), Postives = 216/500 (43.20%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE----NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNT---GVVK--TILGLDYE-KIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKD 1901
            NDN+PTF +K Y   I E     S+I    A D D+      +Y IE+ +      F ++    + ++  IL V  ++ R+   ++   + A D G    +G+  ++   +D+ +  P F+   + +KI E    G  ++ L+ ED D G+N +I  +  SS        F++  +   +++   S LD E    +S  + A D   PP +++  +EV + ++ND+ P      +   IS+      I  GT+       V   D D   + I          ++LN   ++  ++    +R +  ++     DRE   +  + I   D  G   L   +++ + + D+NDNAP F    Y   + EN     V      I+A D DEG+N  + + I    D     F I+++    GVV+  T    DYE K      E+ A    +   SS+V + ++V D NDN+P +         ++N  +   +G +   D D
Sbjct:  575 NDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREV---FSILD---IGDQGAILSVSGELKRQ-DHKVRVEISATDQGG--LQGRC-VVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS------QFFRIDPSSGDISVS--SDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISED-----IPVGTS----FLQVSAIDADIGPNGIV--------DYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARD-RGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAEN---SPVGSTVGTIVARDADEGDNADISFRIFGGAD--AKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQL---SSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD 1028          

HSP 6 Score: 92.4337 bits (228), Expect = 1.518e-18
Identity = 86/356 (24.16%), Postives = 156/356 (43.82%), Query Frame = 3
Query: 1335 EIKSKIDFDRETKTLHFVSIVCSDTEGIN-QLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGML 2399
            EI+     DRE    H + +  +  E ++  +  +  + V + D+ DN+P+F    Y+G ++E+       ++   + A D D GENG +EY +     + KN  +I+  +GV++T   LD E +  + +++ A D G P R S+  + + V D NDN P      Y+  + EN  I   +  V  TD+D   N K                 S       TID  +G++  +  +D + +S I   I A +            Q   +  + +T+N++D ND++P ++   K               +  EN+     V   Y  +D D G N  ++ +M+ ++ F +  D G++
Sbjct:  221 EIRLAKSMDREVLDKHILKV--TAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLS---VFARDLDSGENGEIEYSLGE--GNGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSM-----------ASSSGIGGLTIDYSTGEVTLRERIDAK-NSPITAVIRAKDG----------AQPALSSTVPLTINVIDINDHAPTLIAAQK-------------MITLEENVAIGEEVGRVYA-IDEDSGPNGIIKYSMEGSEDFIIDEDSGLI 533          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 128.642 bits (322), Expect = 1.175e-29
Identity = 157/597 (26.30%), Postives = 252/597 (42.21%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDR----IEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFY--LNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFS-SPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEIS----VTVNILDKNDNSP 2189
            NDN+P F   +Y   ILEN  I + I+   A D D   FG           N  V++ + +   +              RE ID     I   + A DG +P       + + V+D ND  P        I ++E+   G E+  +   D+DSG NG I  +   S +  I     L        +K    LD ET  +YS  + A+D G P  +++  + V + ++ND+ P     ++N  IS++  R           +I L  V +D++Q   IT  IE +    +  L+     A+L    + E+K +   D + +    V I  +D  G   L+    + V I D+N +AP F+  P    I + + +   V   K    A D D G+N  + Y I     D   +F ID ++G +     LD E     S+ ++A D   P  ++S ++ V + D NDN P+   S Y+  + E+ P+GT   +V+  D D   N        +         +S P+ Q+F +D  SG +     LDRE      FA+I            +F + R T  +S    +T+ + D NDN+P
Sbjct:   10 NDNAPVFASDSYNVTILENITIPAVIATVKATDED---FGT----------NGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFIIDEDSGL--------IKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPR--------GSQIITLKAVDNDEDQ--KITYRIEEADREVFSILDIGDQGAILS--VSGELKRQ---DHKVR----VEISATDQGG---LQGRCVVNVFIDDVN-SAPYFNDHPFSVKIPEHSPIGYPVITLK----AEDHDRGDNARIVYSI-----DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNE--------SSSSPSIQLFRLDRTSGTLRVSSKLDREQ-----FAVIV---------LPIFARDRGTPSLSAASEITLTLSDVNDNAP 531          

HSP 2 Score: 122.865 bits (307), Expect = 6.755e-28
Identity = 125/493 (25.35%), Postives = 212/493 (43.00%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFV-DNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMK-NYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKD 1901
            ND++PT         + EN  I   +    A D D  P G+  Y +E             +EDF+ D    ++     +DRE   R    + A D G P     T I + + D ND  P F +  Y + I E    G +++ L+  D D   + KI+     + ++++ +   +     G  L +  +L  +  +K    + A D  Q       +V VF+ +VN +P     Y  + P S     + I E +     +  +K  D D   ++ I   I++SQ  F ++            + +I    D DRE +    V +  SD      L  + ++EVI+ DINDN+P F+S  Y   + E+     V  +   + A D D G NG V+Y+++          F +D+ +G ++    LD E+   + + I A+D G P  S++ ++ + + D NDN P  +   Y   + EN P+G+ VG +   D D
Sbjct:  114 NDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEG------------SEDFIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDND--EDQKITYRIEEA-DREVFSILDIGD--QGAILSVSGELKRQD-HKVRVEISATD--QGGLQGRCVVNVFIDDVNSAP-----YFNDHPFS-----VKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSSQ-FFRIDP----------SSGDISVSSDLDREDRATFSVIVTASD-HASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIP---VGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGTIVARDAD 561          

HSP 3 Score: 95.9005 bits (237), Expect = 1.288e-19
Identity = 122/500 (24.40%), Postives = 216/500 (43.20%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE----NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNT---GVVK--TILGLDYE-KIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKD 1901
            NDN+PTF +K Y   I E     S+I    A D D+      +Y IE+ +      F ++    + ++  IL V  ++ R+   ++   + A D G    +G+  ++   +D+ +  P F+   + +KI E    G  ++ L+ ED D G+N +I  +  SS        F++  +   +++   S LD E    +S  + A D   PP +++  +EV + ++ND+ P      +   IS+      I  GT+       V   D D   + I          ++LN   ++  ++    +R +  ++     DRE   +  + I   D  G   L   +++ + + D+NDNAP F    Y   + EN     V      I+A D DEG+N  + + I    D     F I+++    GVV+  T    DYE K      E+ A    +   SS+V + ++V D NDN+P +         ++N  +   +G +   D D
Sbjct:  216 NDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRIEEADREV---FSILD---IGDQGAILSVSGELKRQ-DHKVRVEISATDQGG--LQGRC-VVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS------QFFRIDPSSGDISVS--SDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISED-----IPVGTS----FLQVSAIDADIGPNGIV--------DYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARD-RGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAEN---SPVGSTVGTIVARDADEGDNADISFRIFGGAD--AKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQL---SSTVPVRIHVSDVNDNKPALKDFVILMNRFDNVQMARQIGFIPAFDPD 669          

HSP 4 Score: 83.1889 bits (204), Expect = 8.615e-16
Identity = 74/280 (26.43%), Postives = 129/280 (46.07%), Query Frame = 3
Query: 1074 LVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKD--PILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTD 1907
            +VE+ V +VND+ P      +N         + I E  T   VI  VK TD+D   +    ++  S  S   + +    +  +     ++ +ID     K     +++ +       L  T  L + + DIND+AP   + +    ++EN     V I ++   + A D+D G NG ++Y +    D     F ID+++G++KT   LD E     S++++A+D+G P  ++S  + V +KD NDN P  D   Y+  + E  P G+ +  +   D D D
Sbjct:    1 MVEITVVDVNDNAPVFASDSYN---------VTILENITIPAVIATVKATDEDFGTNG---KVHYSMASS--SGIGGLTIDYSTGEVTLRERID----AKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEEN-----VAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED-----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDED 252          

HSP 5 Score: 82.8037 bits (203), Expect = 1.419e-15
Identity = 121/490 (24.69%), Postives = 202/490 (41.22%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQF------NKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKEN--RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNV-KDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPN--PLDYGKDLFRQFRDTMEISVTVNILDKNDNSP 2189
            + V+D ND  P F+   Y + I E+      +  ++  D+D G NGK+  + ASS+         +  +   V L+   ++D +  +  +  + AKD  QP  SST  + + V ++ND  P ++  Q       N  I ++  R+Y                 D+D+  + I        E F +          +  +  IK+    DRET   + + +   D  G   L  +  + V++KDINDNAP F    Y   + E   R ++I+T+      A D DE +   + Y I     ++ +   I  + G + ++ G    +   V +EISA D G        + +VNV  D  ++ P  +   +S ++ E+ PIG  V  +   D D   N +              +  S  + Q F ID  SG I     LDRE  +     + AS+    PL+           + +I V ++  D NDNSP
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSG---IGGLTIDYSTGEVTLR--ERIDAKN-SPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVY---------------AIDEDSGPNGIIKYSMEGSEDFII----------DEDSGLIKTTKLLDRETTARYSLKVTARDM-GTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLK-----AVDNDEDQK--ITYRIEEADREVFSILDIG-DQGAILSVSGELKRQDHKVRVEISATDQG----GLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNAR--------------IVYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLN----------TSTQIEVILD--DINDNSP 423          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 115.546 bits (288), Expect = 1.256e-25
Identity = 163/641 (25.43%), Postives = 262/641 (40.87%), Query Frame = 3
Query:  660 QIDREFIDRIEFTLIAVD-------GGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRK---TYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPIL-----ATDKDE--GENGTVEYYI-SNVVDDMKNYFSIDKNTGVVKTILGLDYE--KIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDY----GKDLFR------QFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDY-GMLCAMEKL--PPIGDYKTVIVAEDGDFNNSRK 2483
            + DRE ID    T+ A D       G   P K   K+ + + D ND  P F +  Y  ++KESE  G +++ ++  D D  +N +  +  A       +  F +      + +K    LD+E  ++Y   L+A D G+   ++T  V + + +VND+ P     QF +   ++YA   I E      V+  V  TD D    S       S+  + L     + V    K   T E+   +D D       +  +V +  +  N L     ++V ++DINDN+P+F   R +G ++ENR      I+ D +      A D D+   EN  +EY I  N + + ++ F ID+NTG +  +  LD E    +   IE+ A D GVP R     + + V D NDN P  + + Y   + E  PIG  V   +  D D                        +  D +FT        Y  V  D++ S Q    ++     PLDY     +D F         R   E +V V ++D+ND++P +    + +V+   P  + I                 Y   D D G+ ++ R+  +++     T D  G L     L    I  Y  +I A D   N  R+
Sbjct: 1285 KFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGG----RIPFGVRTDSGTIFVK--EPLDFEASDQYHLVLIASD-GR--HNATTNVYIHIEDVNDNAP-----QFEQ---QKYATTVIEEDVDIPKVLFNVHATDADQDEKS-------SRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPE-RLFGYIEENRE----PIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDAD-----------------------EEAKDNVFTYQLSEESDYFYVTTDKD-SKQSSVGVLRVK-QPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGR---------------YTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQ 1856          

HSP 2 Score: 85.5001 bits (210), Expect = 2.268e-16
Identity = 169/710 (23.80%), Postives = 286/710 (40.28%), Query Frame = 3
Query:  177 DHIGRSGLKSDSFYLSEDTDSFQLINGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLM------TEDFVDNKQPILIVK--HQI-DREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKI--SINFASSTNQDIQNT---FQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQP-PRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVK-VTDDDNQADSITCEIETS------QESFYLNALKTNAVLENRKTY---EIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRV--NEIVTINKDPIL---ATDKD-EGENGTVEYYISNVVD-DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSS-------VKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSP 2189
            D  GRS  K + F + E T       G V LR  +   +     N     +  Q   G CC++     +        + I + D+N+N P FP+   Y +I +  +   +   P           VE+ + +  + N D+ + L        + FV ++Q  ++    H + DRE   R + T+ A D G  P  G  +  ++V+D ND  PQF +  YE  +   E  G  ++ +   D D+ +N +I  S+   ++  ++ QN    F+L     G  + LI  +  +T  K+ FN++A D G P    S+A V + V +     P        KP       I ++E    + VI   + V+  D++   +  ++  S       ES +    K     EN   +    I   +D+++    ++  ++  + T+  +++  T    V ++D+ND  P F+   + G + E       +   N  PI+   A D D +G    V Y I    + +   +F ID+ TG +      D EKI    + + A D  V     +       VK+ + + D NDN P  +   Y   + E+E  G  V  +   D D   N +         L G   G        F +  +SG I+ K  LD E S Q    +IAS+              R     +V ++I D NDN+P
Sbjct:  786 DKNGRSTQKMNLFSIDEHT-------GLVKLRHGVSAADLAEAENPINLTVIVQD-DGSCCVY----PSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVK-------VEATD-DDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSG-EITLIKPIPMKT-QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKP------GITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNK----FENGNEWVEVVIMEGLDYEQ----VNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYH-------LIGAGGGRIP-----FGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG-------------RHNATTNVYIHIEDVNDNAP 1434          

HSP 3 Score: 75.0998 bits (183), Expect = 2.879e-13
Identity = 98/414 (23.67%), Postives = 169/414 (40.82%), Query Frame = 3
Query:  729 RKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISI-----NFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINK----YSFNLVAKDFGQP-PRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTN----KLEVIIKDINDNAPVF-SSPRYYGIVKENRVNEIVTINKDP-----ILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVV--KTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDT 1904
            R+    + +++ D ND  P F++ +Y  +++E       +L +   DKD+G+N +I+      NF+ ++N +I                   +LD + +N+    Y FN+ A+D G+P   SS+A++ +   N ND   + VF     P S+  A  ++ E       +  ++  D D    + +   +  + +  +N    +      K     S  D       ++   IV  D        +T+     L + I+D+N+N P F    +Y  I K   + E  T   DP     + ATD D   NG + Y +     + +  F ID+ TGV+     +  D E      + + A D G        +  V V D NDN P+ +   Y   +   E +GT V  V   D D 
Sbjct:  622 RESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKV---------------RLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDE--SAVFL----PTSQYTA--FVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAK---IME-GTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDA 1008          

HSP 4 Score: 65.0846 bits (157), Expect = 3.518e-10
Identity = 117/498 (23.49%), Postives = 202/498 (40.56%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQID------REFIDRIEFTLIAVDGGKPPRKGKTKII-LKVLDENDCEPQF---SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKL---ISKLDY-ETINKYSFNLVAKDFGQ----PPRSST--ALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIY-INEGTTKDMVICLVKV--TDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEI--KSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYI-------SNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVP-VRSSSVKLIVNVKDTNDNQPEVDLS 1826
            NDN PTF    Y  ++ E+  +N  I    A D D               +N  + + +   +F  N    +  K ++D      R F+ R  F + A D G+P     + +I ++  + ND    F   SQ  Y   + E    G  ++ ++  D D     +++ +F     +  Q     S   H   +KL   +S  D  E  N  +  ++ +D G     P ++ T  A + + + +VN++ P         P   +Y+ I  I EGT K     +VKV  TDDD+ A+      +     +Y  +    A + +R+T  +     + FDRET+    V++  +D  G   L    +  V + DINDN+P F  P Y   V      E V  +   + A D D   N  + Y +           +D+  +  +++ +G +  I  +  +  K +   + A D G+P    SS ++ +NV D     P+   S
Sbjct:  636 NDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKD-------------TGDNSRITYSVDNHNFSINSNGEISAKVRLDADQLNERHFVYR--FNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQ--YTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEF-------PDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANG-----DIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATD-RGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSR---FEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI-FNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTS 1096          

HSP 5 Score: 63.5438 bits (153), Expect = 1.028e-9
Identity = 90/361 (24.93%), Postives = 154/361 (42.66%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDAD-DLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQP---ILIVKHQIDREFI-DRIEFTL-IAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQ--ADSITCEIETS-QESFYLNALKTNAVLENRKTYEIKSKIDFDRET----KTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDN 1475
            NDN+P F +  Y   + E + I + +    A+DAD +    V +Y++ + ++    YF + T+   D+KQ    +L VK  +D E +  R  F L I V  G+     +  + + ++D ND  P       E +++E    G  +      D+D+G+  +  IN  S    D +  F + Q      L++   LD E I  Y  NL+ + +         +V V++ +VND+ P        +P +     I+        +  C ++ TD D        T E+  S + S YLN +          +  I    +FDRE     K L  + ++ +D  G    +    + VII D+NDN
Sbjct: 1655 NDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESD----YFYVTTDK--DSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGR--HDAEAAVHVALVDRNDHAPHIHGAT-EHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQS----DPKRQFTIDQD---GTLRVAHTLDREDIAVY--NLIIEAYDNSNNIGRQMVAVYLQDVNDNGP--------EPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILE-IPLILADRAG---RRNEASVHVIIGDLNDN 1985          

HSP 6 Score: 54.6842 bits (130), Expect = 4.245e-7
Identity = 99/409 (24.21%), Postives = 164/409 (40.10%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKP-NENFDVYFKLMTEDFVDNKQPILI--------VKHQIDREFIDRIEFTL--IAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKI--------SINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAP-VFSSPRYYGIVKENR-VNEIVTINKDPILATDKDEGENG 1595
            NDNSP FPE+  +  I EN +       P+  D       V++ + + P  EN ++ + ++    ++ +    I            +DRE     EF +   A D G P R+G   + +KV D ND  P F +  YE  ++E+   G  ++     D D      +        S  F  +T++D +      Q+  GV L++   LDYE + +     +          + A V V + + ND  P+I         ++   R  +  GT+    I     TD D   D+    I    +      +  +  L    T         DRE   ++ + I   D    N + +   + V ++D+NDN P  ++ PR   I +EN  VN++ T     I ATD+D  E G
Sbjct: 1540 NDNSPIFPER-LFGYIEENRE-------PIHSDGVYF-MDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSK------QSSVGV-LRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHI------HGATEHRVREDVPRGTS----IGRYTATDRD-AGDTARFRINRQSDPKRQFTIDQDGTLRVAHT--------LDREDIAVYNLIIEAYDNS--NNIGR-QMVAVYLQDVNDNGPEPYTVPRPC-IFRENTPVNQLGTCE---IRATDRDTAEFG 1906          

HSP 7 Score: 52.373 bits (124), Expect = 2.433e-6
Identity = 124/517 (23.98%), Postives = 214/517 (41.39%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKL----MTEDFVDNK--QPILIVKHQIDRE---FIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESE---MTGLELLHLRVEDKDSGNNGKISINFASSTNQDI--QNTFQLSQTLHGVALKLISKLDYETINKYSF--NLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQES--FYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHF-VSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIV----TINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPI---GTYVGKVNVTDKDT 1904
            NDN+P F ++ Y   ++E       + +P         F V + + ++  ++  + ++L      E F   K    I +VK  +DR+    +    F + A+D       G   + + V D ND  P F + ++    +  E     G+  + ++  D D       +I +    N+ I  ++ F++ Q    +    +  LD E  ++  F   + A D G P R   A V + VT++ND+ P   F++      K      + E       +      D D +A       + S+ES  FY+   K ++   +     +K  +D++  T+   F + I  SD     +      + V + D ND+A     P  +G   E+RV E V    +I +    ATD+D G+  T  + I N   D K  F+ID++ G ++    LD E I   ++ I A D    +    V   V ++D NDN PE           EN P+   GT   ++  TD+DT
Sbjct: 1430 NDNAPQFEQQKYATTVIEED-----VDIPKVL------FNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVK-ALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIF--AMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAP---FFE------KTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDK-DSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD----GRHDAEAAVHVALVDRNDHA-----PHIHG-ATEHRVREDVPRGTSIGR--YTATDRDAGD--TARFRI-NRQSDPKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVA--VYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTC--EIRATDRDT 1902          

HSP 8 Score: 51.9878 bits (123), Expect = 3.055e-6
Identity = 117/513 (22.81%), Postives = 207/513 (40.35%), Query Frame = 3
Query:  750 ILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVED----KDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINK-YSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDR-ETKTLHFV---SIVCSDTEGINQLKQTNKLEVIIKDINDNAPVF-SSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMK-NYFSIDKNTGVVKTILGLDYEKIKH----VSIEISAKDLG------VPVRSSSVKLIVNVKDTNDNQPEV-DLSFYS--FELYENEPIGTY------VGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTK--VVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSP 2189
            IL++L  ++  PQF++  YE+ + E  +    ++ ++ +     +D  + G I+ +    T +D    F++  +   + L  +   D   + K +   + A+   +  R S   + + + +VND+ P      F +P+     R    E    +  I  V   D D   +S IT  ++    S   N              EI +K+  D  +    HFV   ++   D      L  +  + +  ++ ND + VF  + +Y   V E+       I    I A D D  E  T  +   N     K N FSID++TG+VK   G+    +      +++ +  +D G          +S   L++ ++D N+N+PE  D + YS   ++ E    GTY      + KV  TD D+  N   +              T   + + F ID ++G +     VV DRE   +    + A++    D     F QF        +V ++D NDNSP
Sbjct:  518 ILEIL-ADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAR---EDNRESHVDLTIRIDDVNDNVPT-----FTRPLYTAQVR----EDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNG-------------EISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQ---IQARDADRDEV-TYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIME----GTYKTDPPTIVKVEATDDDSSANGDIVYSLYY---------TQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRG--DRPLIGFCQF--------SVEVVDINDNSP 977          
BLAST of Protocadherin-1 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 115.546 bits (288), Expect = 1.256e-25
Identity = 163/641 (25.43%), Postives = 262/641 (40.87%), Query Frame = 3
Query:  660 QIDREFIDRIEFTLIAVD-------GGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRK---TYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPIL-----ATDKDE--GENGTVEYYI-SNVVDDMKNYFSIDKNTGVVKTILGLDYE--KIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDY----GKDLFR------QFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDY-GMLCAMEKL--PPIGDYKTVIVAEDGDFNNSRK 2483
            + DRE ID    T+ A D       G   P K   K+ + + D ND  P F +  Y  ++KESE  G +++ ++  D D  +N +  +  A       +  F +      + +K    LD+E  ++Y   L+A D G+   ++T  V + + +VND+ P     QF +   ++YA   I E      V+  V  TD D    S       S+  + L     + V    K   T E+   +D D       +  +V +  +  N L     ++V ++DINDN+P+F   R +G ++ENR      I+ D +      A D D+   EN  +EY I  N + + ++ F ID+NTG +  +  LD E    +   IE+ A D GVP R     + + V D NDN P  + + Y   + E  PIG  V   +  D D                        +  D +FT        Y  V  D++ S Q    ++     PLDY     +D F         R   E +V V ++D+ND++P +    + +V+   P  + I                 Y   D D G+ ++ R+  +++     T D  G L     L    I  Y  +I A D   N  R+
Sbjct: 1285 KFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGG----RIPFGVRTDSGTIFVK--EPLDFEASDQYHLVLIASD-GR--HNATTNVYIHIEDVNDNAP-----QFEQ---QKYATTVIEEDVDIPKVLFNVHATDADQDEKS-------SRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPE-RLFGYIEENRE----PIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDAD-----------------------EEAKDNVFTYQLSEESDYFYVTTDKD-SKQSSVGVLRVK-QPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHIHGATEHRVREDVPRGTSIGR---------------YTATDRDAGDTARFRINRQSDPKRQFTIDQDGTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQ 1856          

HSP 2 Score: 85.5001 bits (210), Expect = 2.268e-16
Identity = 169/710 (23.80%), Postives = 286/710 (40.28%), Query Frame = 3
Query:  177 DHIGRSGLKSDSFYLSEDTDSFQLINGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLM------TEDFVDNKQPILIVK--HQI-DREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKI--SINFASSTNQDIQNT---FQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQP-PRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVK-VTDDDNQADSITCEIETS------QESFYLNALKTNAVLENRKTY---EIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRV--NEIVTINKDPIL---ATDKD-EGENGTVEYYISNVVD-DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSS-------VKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSP 2189
            D  GRS  K + F + E T       G V LR  +   +     N     +  Q   G CC++     +        + I + D+N+N P FP+   Y +I +  +   +   P           VE+ + +  + N D+ + L        + FV ++Q  ++    H + DRE   R + T+ A D G  P  G  +  ++V+D ND  PQF +  YE  +   E  G  ++ +   D D+ +N +I  S+   ++  ++ QN    F+L     G  + LI  +  +T  K+ FN++A D G P    S+A V + V +     P        KP       I ++E    + VI   + V+  D++   +  ++  S       ES +    K     EN   +    I   +D+++    ++  ++  + T+  +++  T    V ++D+ND  P F+   + G + E       +   N  PI+   A D D +G    V Y I    + +   +F ID+ TG +      D EKI    + + A D  V     +       VK+ + + D NDN P  +   Y   + E+E  G  V  +   D D   N +         L G   G        F +  +SG I+ K  LD E S Q    +IAS+              R     +V ++I D NDN+P
Sbjct:  786 DKNGRSTQKMNLFSIDEHT-------GLVKLRHGVSAADLAEAENPINLTVIVQD-DGSCCVY----PSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVK-------VEATD-DDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSG-EITLIKPIPMKT-QKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSPDCKP------GITVDENVELNKVILRCRAVSSGDSRNSDVIYKLTASGGPGNKAESKFRQFNK----FENGNEWVEVVIMEGLDYEQ----VNNYTLTLTATDMTSRVASTKTFVVEVRDVNDVVPQFTVDLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYH-------LIGAGGGRIP-----FGVRTDSGTIFVKEPLDFEASDQYHLVLIASDG-------------RHNATTNVYIHIEDVNDNAP 1434          

HSP 3 Score: 75.0998 bits (183), Expect = 2.879e-13
Identity = 98/414 (23.67%), Postives = 169/414 (40.82%), Query Frame = 3
Query:  729 RKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISI-----NFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINK----YSFNLVAKDFGQP-PRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTN----KLEVIIKDINDNAPVF-SSPRYYGIVKENRVNEIVTINKDP-----ILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVV--KTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDT 1904
            R+    + +++ D ND  P F++ +Y  +++E       +L +   DKD+G+N +I+      NF+ ++N +I                   +LD + +N+    Y FN+ A+D G+P   SS+A++ +   N ND   + VF     P S+  A  ++ E       +  ++  D D    + +   +  + +  +N    +      K     S  D       ++   IV  D        +T+     L + I+D+N+N P F    +Y  I K   + E  T   DP     + ATD D   NG + Y +     + +  F ID+ TGV+     +  D E      + + A D G        +  V V D NDN P+ +   Y   +   E +GT V  V   D D 
Sbjct:  622 RESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNGEISAKV---------------RLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDE--SAVFL----PTSQYTA--FVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAK---IME-GTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSRFEAVGTSVITVFAFDNDA 1008          

HSP 4 Score: 65.0846 bits (157), Expect = 3.518e-10
Identity = 117/498 (23.49%), Postives = 202/498 (40.56%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQID------REFIDRIEFTLIAVDGGKPPRKGKTKII-LKVLDENDCEPQF---SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKL---ISKLDY-ETINKYSFNLVAKDFGQ----PPRSST--ALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIY-INEGTTKDMVICLVKV--TDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEI--KSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYI-------SNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVP-VRSSSVKLIVNVKDTNDNQPEVDLS 1826
            NDN PTF    Y  ++ E+  +N  I    A D D               +N  + + +   +F  N    +  K ++D      R F+ R  F + A D G+P     + +I ++  + ND    F   SQ  Y   + E    G  ++ ++  D D     +++ +F     +  Q     S   H   +KL   +S  D  E  N  +  ++ +D G     P ++ T  A + + + +VN++ P         P   +Y+ I  I EGT K     +VKV  TDDD+ A+      +     +Y  +    A + +R+T  +     + FDRET+    V++  +D  G   L    +  V + DINDN+P F  P Y   V      E V  +   + A D D   N  + Y +           +D+  +  +++ +G +  I  +  +  K +   + A D G+P    SS ++ +NV D     P+   S
Sbjct:  636 NDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKD-------------TGDNSRITYSVDNHNFSINSNGEISAKVRLDADQLNERHFVYR--FNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQ--YTAFVAEDAQGGTPVIQIQARDAD---RDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEF-------PDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANG-----DIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATD-RGDRPLIGFCQFSVEVVDINDNSPQFERPSYETSVSR---FEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEITLIKPIPMKTQKFI-FNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTS 1096          

HSP 5 Score: 63.5438 bits (153), Expect = 1.028e-9
Identity = 90/361 (24.93%), Postives = 154/361 (42.66%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDAD-DLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQP---ILIVKHQIDREFI-DRIEFTL-IAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQ--ADSITCEIETS-QESFYLNALKTNAVLENRKTYEIKSKIDFDRET----KTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDN 1475
            NDN+P F +  Y   + E + I + +    A+DAD +    V +Y++ + ++    YF + T+   D+KQ    +L VK  +D E +  R  F L I V  G+     +  + + ++D ND  P       E +++E    G  +      D+D+G+  +  IN  S    D +  F + Q      L++   LD E I  Y  NL+ + +         +V V++ +VND+ P        +P +     I+        +  C ++ TD D        T E+  S + S YLN +          +  I    +FDRE     K L  + ++ +D  G    +    + VII D+NDN
Sbjct: 1655 NDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESD----YFYVTTDK--DSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDGR--HDAEAAVHVALVDRNDHAPHIHGAT-EHRVREDVPRGTSIGRYTATDRDAGDTARFRINRQS----DPKRQFTIDQD---GTLRVAHTLDREDIAVY--NLIIEAYDNSNNIGRQMVAVYLQDVNDNGP--------EPYTVPRPCIFRENTPVNQLGTCEIRATDRDTAEFGPPFTMEVSPSFKYSQYLNVIFNANGDGGNGSMTITPLQEFDREAPVPGKILE-IPLILADRAG---RRNEASVHVIIGDLNDN 1985          

HSP 6 Score: 54.6842 bits (130), Expect = 4.245e-7
Identity = 99/409 (24.21%), Postives = 164/409 (40.10%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKP-NENFDVYFKLMTEDFVDNKQPILI--------VKHQIDREFIDRIEFTL--IAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKI--------SINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAP-VFSSPRYYGIVKENR-VNEIVTINKDPILATDKDEGENG 1595
            NDNSP FPE+  +  I EN +       P+  D       V++ + + P  EN ++ + ++    ++ +    I            +DRE     EF +   A D G P R+G   + +KV D ND  P F +  YE  ++E+   G  ++     D D      +        S  F  +T++D +      Q+  GV L++   LDYE + +     +          + A V V + + ND  P+I         ++   R  +  GT+    I     TD D   D+    I    +      +  +  L    T         DRE   ++ + I   D    N + +   + V ++D+NDN P  ++ PR   I +EN  VN++ T     I ATD+D  E G
Sbjct: 1540 NDNSPIFPER-LFGYIEENRE-------PIHSDGVYF-MDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSK------QSSVGV-LRVKQPLDYEDVTQRDGFHLGIRVSDGRHDAEAAVHVALVDRNDHAPHI------HGATEHRVREDVPRGTS----IGRYTATDRD-AGDTARFRINRQSDPKRQFTIDQDGTLRVAHT--------LDREDIAVYNLIIEAYDNS--NNIGR-QMVAVYLQDVNDNGPEPYTVPRPC-IFRENTPVNQLGTCE---IRATDRDTAEFG 1906          

HSP 7 Score: 52.373 bits (124), Expect = 2.433e-6
Identity = 124/517 (23.98%), Postives = 214/517 (41.39%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKL----MTEDFVDNK--QPILIVKHQIDRE---FIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESE---MTGLELLHLRVEDKDSGNNGKISINFASSTNQDI--QNTFQLSQTLHGVALKLISKLDYETINKYSF--NLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQES--FYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHF-VSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIV----TINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPI---GTYVGKVNVTDKDT 1904
            NDN+P F ++ Y   ++E       + +P         F V + + ++  ++  + ++L      E F   K    I +VK  +DR+    +    F + A+D       G   + + V D ND  P F + ++    +  E     G+  + ++  D D       +I +    N+ I  ++ F++ Q    +    +  LD E  ++  F   + A D G P R   A V + VT++ND+ P   F++      K      + E       +      D D +A       + S+ES  FY+   K ++   +     +K  +D++  T+   F + I  SD     +      + V + D ND+A     P  +G   E+RV E V    +I +    ATD+D G+  T  + I N   D K  F+ID++ G ++    LD E I   ++ I A D    +    V   V ++D NDN PE           EN P+   GT   ++  TD+DT
Sbjct: 1430 NDNAPQFEQQKYATTVIEED-----VDIPKVL------FNVHATDADQDEKSSRIVYRLEGQGADEVFRIGKYSGTIELVK-ALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIFPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLINGESVFRIDQNTGKIF--AMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAP---FFE------KTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDK-DSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSD----GRHDAEAAVHVALVDRNDHA-----PHIHG-ATEHRVREDVPRGTSIGR--YTATDRDAGD--TARFRI-NRQSDPKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDNSNNIGRQMVA--VYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTC--EIRATDRDT 1902          

HSP 8 Score: 51.9878 bits (123), Expect = 3.055e-6
Identity = 117/513 (22.81%), Postives = 207/513 (40.35%), Query Frame = 3
Query:  750 ILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVED----KDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINK-YSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDR-ETKTLHFV---SIVCSDTEGINQLKQTNKLEVIIKDINDNAPVF-SSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMK-NYFSIDKNTGVVKTILGLDYEKIKH----VSIEISAKDLG------VPVRSSSVKLIVNVKDTNDNQPEV-DLSFYS--FELYENEPIGTY------VGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTK--VVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSP 2189
            IL++L  ++  PQF++  YE+ + E  +    ++ ++ +     +D  + G I+ +    T +D    F++  +   + L  +   D   + K +   + A+   +  R S   + + + +VND+ P      F +P+     R    E    +  I  V   D D   +S IT  ++    S   N              EI +K+  D  +    HFV   ++   D      L  +  + +  ++ ND + VF  + +Y   V E+       I    I A D D  E  T  +   N     K N FSID++TG+VK   G+    +      +++ +  +D G          +S   L++ ++D N+N+PE  D + YS   ++ E    GTY      + KV  TD D+  N   +              T   + + F ID ++G +     VV DRE   +    + A++    D     F QF        +V ++D NDNSP
Sbjct:  518 ILEIL-ADERPPQFAKQEYEVTVSEDNLVDYSVVDVKAQSFRSFEDGRSKGPITYSLEGDTPEDETKWFRIDPSTGIIHLTRLLDFDDPALPKLHKLKVTAR---EDNRESHVDLTIRIDDVNDNVPT-----FTRPLYTAQVR----EDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINSNG-------------EISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQ---IQARDADRDEV-TYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIME----GTYKTDPPTIVKVEATDDDSSANGDIVYSLYY---------TQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRG--DRPLIGFCQF--------SVEVVDINDNSP 977          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 186.808 bits (473), Expect = 2.272e-47
Identity = 172/626 (27.48%), Postives = 280/626 (44.73%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQI----DREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKI--SINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPP--NIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENR--KTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDP------ILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTST 2261
            NDN+PTFP+ + + E  EN+    + +L  A D D  P+  + Y I   N N    F+L +    D    +L +  QI    DRE        + A+DGG PP +G   + + + D ND +P F+Q  Y   + E+   G  +L +   D D+  NG +  +IN   S   D +  F++       A+ +   LD+ET   +   +VAKD G+ P  +TA V + VT+VND+ P  N++F   +       A   I+E       +  + V D D++ +     +        LN    +  L  R    Y +   +  DRE  + + +S+V +D +G   L  +  + + I D+NDN P F    Y+  V E           DP      +LA D+DEG N  + Y ++   +    +F ID  TG++ T   +D E      + + A+D GVP  SS+  ++V + D NDN+P  D SFY+  + ENEP+G  + KV+ +D D  +N               T+G        F + + SG+I     LD E  S   F ++A++   L            +    + + + D NDN P+   ++       +P+ S   +ST
Sbjct:  168 NDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVND--AFRLSSHRERDG---VLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQS---DKEQMFRIDPRTG--AIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDD-------ASPKISESAQPGEFVARISVHDPDSKTEYANVNVT-------LNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATD-KGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEV---------ADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNY----------TIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGL------------STTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASST 737          

HSP 2 Score: 152.14 bits (383), Expect = 1.214e-36
Identity = 182/723 (25.17%), Postives = 317/723 (43.85%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDN-----KQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISK--LDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNK-LEVIIKDINDNAPVFSSPRYYGIVKENR-----VNEIVTINK--DPILATDKDEGENGTVEYYISNVVDDM-KNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVP--VRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQ-PADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKV--RVTMKNND-YFSLTPDYGMLCAMEKLPPI-------GDYKTVIVAEDGDFNNSRKQEFLINIHI 2510
            NDN P F +  Y   + E+  IN++I    A D D       +Y I     + +V   + + D   +         + ++  +DRE  DR + T++A D G P    KT++I++VLD ND +P+F +  YE +I+E+   G  +  +   D D G N  I  +        I ++FQ    +H V  ++ ++  LD E    Y   + A+D G P RS+   V + V++VND+ P I           Q   + + E       +  V+  D D  Q  SIT  I   ++S        +       +  I++++  D E ++++ + +  SD  G N  ++T + L V + D+NDN P F+S      V+E+      V  I  I +  D +  + ++  E+  V Y ++ +  D+ +  F ID+++G +     LD E      +EI A D       +SS++ + + V D NDN PE        ++ E  P+GT +     TD DT  N       I+     P L  SQ  A  +F +D+ +G +  +  LD E   +    + A     LD   ++  + + +  ++V + ILD ND++P  +    P          FI  +T         V    + VD D G+N ++   +T  N +  F +    G++  ++ LPP        G +  +I A+D      +K    +N+H+
Sbjct: 1030 NDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVD-NVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP-----INSSFQ----VHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIA--------DPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPT-----SGVIRTRVVLDHEERSIYRLGVAASD--GGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYF---PQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQA-----LDQSSNVTERLQTS--VTVRLRILDANDHAPHFV---SPNSSGGKTASLFISDATR-----IGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSS--LNLHL 1707          

HSP 3 Score: 137.502 bits (345), Expect = 3.467e-32
Identity = 187/786 (23.79%), Postives = 320/786 (40.71%), Query Frame = 3
Query:  273 RPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGK-PPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNI--------VFYQFNKPISKQYARIYI--NEGTTKDMVICLVKVTDDDNQA-DSITCEIETSQESFY---------LNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVS----------------IVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKE--NRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKN-TGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPT--LGTSQPAD----QIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFV---DLD-EGENSKV-RVTMKNNDYFSLTPDYGMLCA-MEKLPPI----GDYKTVIVAEDG 2462
            RP+DRE++   + + Q     Q    Q    I I   D               NDN+P F    Y   + E++ + + +    A DAD    GV +  +      + +  +   +  +D +  ++    ++DRE      F ++A DGG+   R     + + VLD ND  P F +  Y  ++      G  LL ++  D D G N +I  +  ++ N  +   F+++ +    AL     L  E+       +VA+D G PP+SS  L+E+ +       P +        V  + N P   +  ++    ++G  + +        +D   + DS++ EI  ++             ++AL     L   +  +  S+ D +  T++   ++                ++ + T     L    +L + ++D NDN+P FS  ++   V E  N+   +  ++     A D D G N  + Y+I  V  +  N F I+   +G+V+T + LD E      ++I A D GVP  + +  + V + D NDNQP    +     + E   +G  +  ++  D DT               P  T  LG     D     IF +D  SGK+  K  LD E+  +    +IAS         D   + R  +    TV + D+NDN+P+ + +  P   A+ P +S I  S          V F  + V   D D EG NSKV  +     + FS+ P  G++   M +L P     GDY   I+A+D 
Sbjct: 1907 RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQ--------------NDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDAD---LGVNARLV------YSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL-NAENSAVSAKFRINPSTG--ALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVH-----AFDSDAGSNARLRYHI--VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT--------------YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIAS---------DAAHEARTVL----TVRVNDENDNAPVFLAQQPPAYFAILPAISEISESL--------SVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDA 2623          

HSP 4 Score: 124.79 bits (312), Expect = 2.571e-28
Identity = 167/673 (24.81%), Postives = 280/673 (41.60%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKES-----EMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILAT---DKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLG-TSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIAS-NPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKN-NDYFSLTPDYGMLCAMEKL 2417
            NDN P F +  Y   + EN  +   I   +   A D   GV +      N      FK +TE  V +    + +  ++D E     EF ++A D G        K  +++ D ND  P F    Y++ ++ES     + +   ++ +   D D GN G++S    +     I   F++ ++   + +     L   T   +  N+ A D G    ++ A+V + + +    PP      F K     Y +  I  GT   +V  ++  + D      +   I +     Y  +++TN       +  I+     D E K+   ++I    T G   +    ++ + ++D+NDNAP F +      V E+   E+      P+ A    DKD G +G V Y +  V +  K  F+ID  +G +     LDYE  +  ++ ++A D GVP  S+++ ++V+V+D NDN P  +   YS  + E+  I   + +VN +D DT  N +     +   +   T   +S    Q F I   SG IY +  LDRE   +    ++A+ N  P  + K             V V +LD NDN P    K K + +              EN+   + V       DLD GEN+ +R ++   N  F + P  G +   E L
Sbjct:  605 NDNEPIFDQSFYNVSVAENEPVGRCI---LKVSASDPDCGVNAMV----NYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIK--MQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGI---FRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPP-----IFEKARYNYYVKEDIPRGT---VVGSVIAASGDVAHRSPVRYSIYSGDPDGYF-SIETN-------SGNIRIAKPLDHEAKSQVLLNIQA--TLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESA--EL----GAPLYAAHAHDKDSGSSGQVTYSL--VKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAK-----------TRVIVRVLDANDNDPKFQ-KSKYEFR------------IEENLRRGSVVGV-VTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPL 1214          

HSP 5 Score: 122.479 bits (306), Expect = 1.320e-27
Identity = 170/710 (23.94%), Postives = 304/710 (42.82%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDAD-----DLPFGVESY--EIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVD-GGKPPRKGKTKII--LKVLDENDCEPQF------SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQL-SQTLHGVALKLISKL-----DYETINKYSFNLVAKDFGQP-PRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQY-ARIYINEGTTKDMVIC---------LVKVTDD----DNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGI-VKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVP-VRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKP---QVKA-VNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDY-----FSLTPDYGMLCAMEKL 2417
            NDN+P +P+     ++ E + + + I    A DAD     DL + +  Y  ++ +  E     F++      D+    L ++  +D E +      + A+D       + +T +   L++LD ND  P F            + I ++   G  + H+   D+DSG+NG+++      T  + +  F++ SQT  G+ ++L+  L     D E   +++  + AKD GQP P+ S+  + + V   +++PP  +   +   I +   +  ++ + T K +               V +D    D Q   IT   +  +ES     L       NR++    S +   R + ++        DT    Q      + + + D+NDN+P F     YG+ V EN    ++      ++A+D DEG N  + Y I+    ++ N FSID ++G + +   LD E+    +++I A D G P  R     + + V+D NDN P   LS Y+  + E+ P+GT V +++  D D  +N +                 +      F ID +SG I T   LDRE+ +   F ++A+     D G+   R    +  + V +N+LD NDN P  + +  P   QV A + P  + +K                   +D D G N+++  ++   +      F + P  G L A + L
Sbjct: 1479 NDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRM------DSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI---TGGNGEGRFRINSQT--GI-IELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSI-------GDTSN-GQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHT----VVASDLDEGPNADLIYSITG--GNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARL------------VYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLAT-----DGGRYEVR----SATVPVQINVLDINDNRP--IFERYPYIGQVPALIQPGQTLLKVQA----------------LDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSL 2122          

HSP 6 Score: 101.293 bits (251), Expect = 3.745e-21
Identity = 129/520 (24.81%), Postives = 215/520 (41.35%), Query Frame = 3
Query:  687 IEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDN--------QADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSS---PRYYGIVKE-NRVNEIVTINKDPIL--ATDKD-EGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVS---IEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPM 2192
            I   L+A     P      ++++++ DEND  P+FSQ  +   + E    G  +  +   D D+G+N ++  +     N D  N F +     G+    I  LD E  + Y   ++A D G P  + TA + V + +VND          N+P       + ++E T    VI  +   D D          A+S T +IE +   F L+      VL+ R  YE++ + + D          ++ SD       +    L V + D NDNAPVF +   P Y+ I+   + ++E ++++ D +   ATD D EG N  V Y    +++  +  FS+  + GVV   +      +       + I AKD G P   SS  L V   D    + +   + Y  ++ E  P+G+ V ++     D  +                  G  + A ++     +S  I     LDRE +      ++ S+P    +G  L      +  ISV + ILD NDN P+
Sbjct: 2288 IRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDG-NHD--NAFVIEPAFSGIVRTNI-VLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVND----------NQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAES-TVDIE-NMSIFALDRYSGKLVLKRRLDYELQQEYELD----------VIASDAAH----EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIY----IIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIA--------------GNEESAFELL----QSKAIVLVKPLDRERNDLYKLRLVLSHP----HGPPLISSLNSSSGISVIITILDANDNFPI 2751          

HSP 7 Score: 94.3597 bits (233), Expect = 4.921e-19
Identity = 188/828 (22.71%), Postives = 321/828 (38.77%), Query Frame = 3
Query:  126 VEITETTVSLFELADVSDHIGRSGLKSDSFYLSEDTDSFQLINGRVTLRRPIDREE--------YCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTF-PEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKP-PRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQ-PPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFY-LNALKTNAVLE---NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPV--FSSPRYYGIVKEN-----RVNEIVTI----------------NKDPILATDKDEGE-----------------------NGTVEYYISNVVDDMKNY--FSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNE-SGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAMEKL 2417
            +++T  ++   E A++S  I  +G+ +D F++      +Q   G +T R   DRE         Y   +N+  T  +S     +    IG  SN        I I V D+NDNSP F P   Y   + ENS+    I   +A D D+ P     Y I   N         +   F  +     +    +DRE   R    + A D G+P  R+G   I + V D+ND  P+F    Y   ++E    G  ++ +   D D G N ++  + A+ T       +Q +       +  + KLD E    Y+F ++A D G+   RS+T  V++ V ++ND          N+PI ++Y   YI +      V  L++      +  ++  ++  + E  Y LNA  +    +   N  T  + +      E+  L  + +V  D +G         +E++I +     PV  F +  Y  ++KEN     R+ ++V +                N+D IL+ D   GE                        G   +Y   + +  +     S      +  +   L   +   + + + A+    P  +S  +L++ ++D NDN P+     +   + E    GT+V +V+  D D   N +                     D  F I+   SG + T +VLDRE+       IIA+     D G         T   ++ V I+D NDN P     +   V     E+  + TS + N    +  T+P +   L     ++  V ++N   F+L    G L    +L
Sbjct: 1739 LQVTAKSLHGAENANLSYEI-PAGVANDLFHVD-----WQ--RGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGN---------LGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQ------WQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDIND----------NRPIFERYP--YIGQ------VPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARD-KGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI-----------VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIAT-----DEGVPQM-----TGTATIRVQIVDVNDNQPTFPPNNLVTVSEAT-ELGAVITSISAN----DVDTYPALTYRL----GAESTVDIENMSIFALDRYSGKLVLKRRL 2493          

HSP 8 Score: 89.7373 bits (221), Expect = 1.263e-17
Identity = 156/630 (24.76%), Postives = 259/630 (41.11%), Query Frame = 3
Query:  612 TEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKT-KIILKVLDENDCEPQFSQLIYEIKIKESEMTGLE--LLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLS--QTLHGVA---LKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINE--GTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVF--------SSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNV-VDDMKNYFSI---DKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPN--PLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTM----KNNDYFSLTPDYGMLCAMEKL 2417
            T+  +D     +  K ++DRE   R  ++L+A+     P  G+  ++++ V DEND  P F Q    I+  E+    ++  LL  R  D +  N  + +I      + ++ + F+LS  +   GV    L++   LD ET   YS  + A D G PP      V + + +VND+ P  +F Q     S+ +A +  N   GT+   V       D++   +      ++ +E  +    +T A+  N+        +DF  ETK LH + +V  D  G   L+ T  + + + D+NDN P          +SP+   I +  +  E V      I   D D       EY   NV ++    +F++   D +  +V   L LD E + + ++ + A D G P   +S  + + + D NDN PE +   Y   + E    GT V +V   D+D  +N+       +         T +   Q F ID ++G I T+  +D E        ++A +    PL            +   +V V I D NDN P+              + SF   S  EN     C+       D D G N+ V  T+    K+   F +    G +C   +L
Sbjct:  121 TDLAIDRATGEIRTKVKLDRE--TRASYSLVAI-----PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNI-----VSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQP--IFNQ-----SRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINK-------ALDF--ETKELHELVVVAKD-HGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPK---ISESAQPGEFVA----RISVHDPDS----KTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAE---------TPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPL------------SSTATVLVTIHDVNDNEPIF-------------DQSFYNVSVAENEPVGRCI-LKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGEL 675          

HSP 9 Score: 89.7373 bits (221), Expect = 1.386e-17
Identity = 164/742 (22.10%), Postives = 296/742 (39.89%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKL--MTEDFV------DNKQPILIVKHQIDREFID--RIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKIS---INFASSTNQDIQNTFQLSQ--TLHGVALKLISKLDYETINKYSFNLVAKDFGQ--PPRSSTAL-VEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGT-TKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTN-KLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYI-SNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLG--VPVRSSSVK---------------------LIVNVKDTNDNQPEVD-LSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNND--YFSLTPDYGMLCAMEKLPP--IGDYKTVIVAEDGDFNNSRKQEFLINIHI 2510
            NDN PTF   +    + E++ +   +    +    + P  V    +E+  E+  V + L  +T+D +      D     L+V   +DRE     R+E   +       P+     + ++V D ND  P++ Q   ++++ E+   G  + +    D D+G NG +    I +    N+  +    L +  +L G AL L + LD+E + +Y   + A D       R  T++ V + + + ND  P+  F   N    K  A ++I++ T   ++V  +V V +D      +T EI                ++E  K+    ++ D ++  +   F  I+ +   G  + K+++  L +I++  ++N P F    Y   + EN  +    +    + A      EN  + Y I + V +D+   F +D   G++ T    D E      + +  +D      + SS+V+                     + + V D NDN PE    S Y   + EN   G  +  V  +D D   N   I       + G  LG        F+ID+ SG++  +  LDRE  S+    I AS     D G+   RQ       ++T+ + D+NDN+P   L                 T + +   P          VD D G N+++  ++ N     F++    G++  + KL       Y  +++A DG     R     + I++
Sbjct: 1359 NDNRPTFTSSSLVFRVREDAALGHVVG---SISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTG-ALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPH--FVSPNSSGGKT-ASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATE-DVEKGGR---FNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQ---VTAKSLHGAENANLSYEIPAGVANDL---FHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYS-----ITGGNLGNK------FSIDSSSGELSARP-LDREQHSRYTLQIQAS-----DRGQPKSRQ----GHCNITIFVEDQNDNAPRFKLSK--------------YTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINV 2047          

HSP 10 Score: 87.4261 bits (215), Expect = 6.182e-17
Identity = 147/581 (25.30%), Postives = 246/581 (42.34%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLP-----FGVES-YEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEP---------QFSQLIYEIKIKESEMTGLELLHLRVEDKDS-GNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLD--YETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEG-----INQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIV----TINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEK-IKHVSIEISAKDLGVPVRSSSVK-LIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASN 2087
            NDN PTFP       + E +++ + I+   A D D  P      G ES  +IE    N  ++        +D     L++K ++D E     E  +IA D      + +T + ++V DEND  P          F+ L    +I ES     +LL +   D DS GNN K+         +  Q  F +  + +GV    +S+L     +   Y   ++AKD G+P   S+ L+ V     ND+       QF   +  QY R  I+E      V+  +      +  D     I  ++ES +        +L+++    +K     DRE   L+ + +V S   G              + + I D NDN P+F     Y    E  ++E+     +I +   +  D++   N  V Y I++  D+  + F+ID  TGV+     LDY+   K   + I A D        S++   + + D NDN+P+  L+ Y   L ENEP+G+ V + + +D D             ++ P P+  +S    ++F +D+ESG + +  V D E   +    ++AS+
Sbjct: 2422 NDNQPTFPPNNLVT-VSEATELGAVITSISANDVDTYPALTYRLGAESTVDIE----NMSIFA-------LDRYSGKLVLKRRLDYELQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYII-----EPAQEGFSVHPS-NGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRV---QANDNGSG--RSQF---LQNQY-RAQISEAAPLGSVVLQLG----QDALDQSLAIIAGNEESAF-------ELLQSKAIVLVKP---LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKY----EAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDE--HMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLD----KGPFGQLNYSIGPAPSDESSW---KMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD 2945          

HSP 11 Score: 75.8702 bits (185), Expect = 2.531e-13
Identity = 107/394 (27.16%), Postives = 163/394 (41.37%), Query Frame = 3
Query: 1320 NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEY-YISNVVDDMKNYFSIDKNTGVVKTILG----LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSP---MMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNND-YFSLTP-DYGMLCAMEKLPP----IGDYKTVIVAED 2459
            +R T EI++K+  DRET+  +  S+V     G N      ++ V +KD NDNAP F     +    EN   E   + +  + A D D     T  Y  +S  V+D     S  +  GV+   L     LD E     S+ I A D G P     + + + ++D NDNQP  + S Y   + EN  +GT V +V  +D D D N        +              +Q+F ID  +G IY    LD E        ++A         KD   Q  +T    V++ + D NDN P   ++ L D       +P++S       E+  P   V    +     + E + V VT+   D +F+LT  D  +   +  LP     + +Y   +VA D
Sbjct:  126 DRATGEIRTKVKLDRETRASY--SLVAIPLSGRNI-----RVLVTVKDENDNAPTFPQTSMHIEFPENTPRE---VKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRR---------QSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVA---------KDHGEQPLETTAF-VSIRVTDVNDNQPTINVIFLSDD-----ASPKIS-------ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATD 478          

HSP 12 Score: 73.559 bits (179), Expect = 1.280e-12
Identity = 103/419 (24.58%), Postives = 169/419 (40.33%), Query Frame = 3
Query:  699 LIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTAL------VEVFVTNVNDSPPNIVFYQFNKPISKQYAR--IYINEGTTKDMVICLVKVTDDDNQADSITCEI-----ETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNY--FSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENE--PIGTYVGKVNVTDKDT 1904
            +IA D GKP  K  T + ++  D      QF Q  Y  +I E+   G  +L L  +  D       S+   +   +   + F+L   L   A+ L+  LD E  + Y   LV      PP  S+        V + + + ND          N PI  + A+    I+E       I  ++  D D Q ++   E+       + E  +   L T  +  N       +++D+D   K+   +   C D+     L       + + D NDN P F    Y   + EN   E V  +     A+D D+G  G + Y I     D  ++  F +D  +G+V +    DYE+ +   +E+ A D+G   + +SV + V ++  ++  P+     Y F L      P G  VG+V  TD D+
Sbjct: 2618 IIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQ------SLAIIAGNEE---SAFEL---LQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDAND----------NFPIFDRSAKYEAEISELAPLRYSIAQLQAIDAD-QENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVN-------NRLDYDSGAKSYELIIRAC-DSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAEN---EPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDS 3000          

HSP 13 Score: 69.707 bits (169), Expect = 1.623e-11
Identity = 115/504 (22.82%), Postives = 205/504 (40.67%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQI--DREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS--ITCEIETSQESFYLNALKTNAVLE---NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIE-ISAKDLGVP-----VRSSSVKLIVNVKDTNDNQPEVDLSF-YSFELYENEPIGTYVGKVNVTDKD 1901
            NDNSP F +K +   + E +   + ++   A+D+D        Y I   N +           FV       IV+  I  DRE  D  +  +IA D G P   G   I ++++D ND +P F        +  SE T L  +   +   D      ++    + +  DI+N    +   +   L L  +LDYE   +Y  +++A D     R+   ++ V V + ND+ P  +  Q     +   A   I+E  + D  +  V  TD D++ ++  +   IE +QE F ++   +N V+    +R    + S  D+        FV I+  D  G   LK +  L V   D       F   +Y   + E            P+ +     G++  ++  ++ +  + ++ F + ++  +V  +  LD E+     +  + +   G P       SS + +I+ + D NDN P  D S  Y  E+ E  P+   + ++   D D
Sbjct: 2316 NDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHD---------NAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPP---NNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVH--PSNGVVSVNMSRLQPAVSSSGDY--------FVRIIAKDA-GKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISE----------AAPLGSVVLQLGQDA-LDQSLAIIAGNEESAFELLQSKAIV-LVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDAD 2781          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 186.808 bits (473), Expect = 2.272e-47
Identity = 172/626 (27.48%), Postives = 280/626 (44.73%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQI----DREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKI--SINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPP--NIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENR--KTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDP------ILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTST 2261
            NDN+PTFP+ + + E  EN+    + +L  A D D  P+  + Y I   N N    F+L +    D    +L +  QI    DRE        + A+DGG PP +G   + + + D ND +P F+Q  Y   + E+   G  +L +   D D+  NG +  +IN   S   D +  F++       A+ +   LD+ET   +   +VAKD G+ P  +TA V + VT+VND+ P  N++F   +       A   I+E       +  + V D D++ +     +        LN    +  L  R    Y +   +  DRE  + + +S+V +D +G   L  +  + + I D+NDN P F    Y+  V E           DP      +LA D+DEG N  + Y ++   +    +F ID  TG++ T   +D E      + + A+D GVP  SS+  ++V + D NDN+P  D SFY+  + ENEP+G  + KV+ +D D  +N               T+G        F + + SG+I     LD E  S   F ++A++   L            +    + + + D NDN P+   ++       +P+ S   +ST
Sbjct:  168 NDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSGNVND--AFRLSSHRERDG---VLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQS---DKEQMFRIDPRTG--AIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDD-------ASPKISESAQPGEFVARISVHDPDSKTEYANVNVT-------LNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATD-KGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEV---------ADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNY----------TIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGL------------STTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASST 737          

HSP 2 Score: 152.14 bits (383), Expect = 1.214e-36
Identity = 182/723 (25.17%), Postives = 317/723 (43.85%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDN-----KQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISK--LDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNK-LEVIIKDINDNAPVFSSPRYYGIVKENR-----VNEIVTINK--DPILATDKDEGENGTVEYYISNVVDDM-KNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVP--VRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQ-PADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKV--RVTMKNND-YFSLTPDYGMLCAMEKLPPI-------GDYKTVIVAEDGDFNNSRKQEFLINIHI 2510
            NDN P F +  Y   + E+  IN++I    A D D       +Y I     + +V   + + D   +         + ++  +DRE  DR + T++A D G P    KT++I++VLD ND +P+F +  YE +I+E+   G  +  +   D D G N  I  +        I ++FQ    +H V  ++ ++  LD E    Y   + A+D G P RS+   V + V++VND+ P I           Q   + + E       +  V+  D D  Q  SIT  I   ++S        +       +  I++++  D E ++++ + +  SD  G N  ++T + L V + D+NDN P F+S      V+E+      V  I  I +  D +  + ++  E+  V Y ++ +  D+ +  F ID+++G +     LD E      +EI A D       +SS++ + + V D NDN PE        ++ E  P+GT +     TD DT  N       I+     P L  SQ  A  +F +D+ +G +  +  LD E   +    + A     LD   ++  + + +  ++V + ILD ND++P  +    P          FI  +T         V    + VD D G+N ++   +T  N +  F +    G++  ++ LPP        G +  +I A+D      +K    +N+H+
Sbjct: 1030 NDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVD-NVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP-----INSSFQ----VHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIA--------DPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPT-----SGVIRTRVVLDHEERSIYRLGVAASD--GGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYF---PQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQA-----LDQSSNVTERLQTS--VTVRLRILDANDHAPHFV---SPNSSGGKTASLFISDATR-----IGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSS--LNLHL 1707          

HSP 3 Score: 137.502 bits (345), Expect = 3.467e-32
Identity = 187/786 (23.79%), Postives = 320/786 (40.71%), Query Frame = 3
Query:  273 RPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGK-PPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNI--------VFYQFNKPISKQYARIYI--NEGTTKDMVICLVKVTDDDNQA-DSITCEIETSQESFY---------LNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVS----------------IVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKE--NRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKN-TGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPT--LGTSQPAD----QIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFV---DLD-EGENSKV-RVTMKNNDYFSLTPDYGMLCA-MEKLPPI----GDYKTVIVAEDG 2462
            RP+DRE++   + + Q     Q    Q    I I   D               NDN+P F    Y   + E++ + + +    A DAD    GV +  +      + +  +   +  +D +  ++    ++DRE      F ++A DGG+   R     + + VLD ND  P F +  Y  ++      G  LL ++  D D G N +I  +  ++ N  +   F+++ +    AL     L  E+       +VA+D G PP+SS  L+E+ +       P +        V  + N P   +  ++    ++G  + +        +D   + DS++ EI  ++             ++AL     L   +  +  S+ D +  T++   ++                ++ + T     L    +L + ++D NDN+P FS  ++   V E  N+   +  ++     A D D G N  + Y+I  V  +  N F I+   +G+V+T + LD E      ++I A D GVP  + +  + V + D NDNQP    +     + E   +G  +  ++  D DT               P  T  LG     D     IF +D  SGK+  K  LD E+  +    +IAS         D   + R  +    TV + D+NDN+P+ + +  P   A+ P +S I  S          V F  + V   D D EG NSKV  +     + FS+ P  G++   M +L P     GDY   I+A+D 
Sbjct: 1907 RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQ--------------NDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDAD---LGVNARLV------YSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSL-NAENSAVSAKFRINPSTG--ALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVH-----AFDSDAGSNARLRYHI--VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNL-VTVSEATELGAVITSISANDVDT--------------YPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIAS---------DAAHEARTVL----TVRVNDENDNAPVFLAQQPPAYFAILPAISEISESL--------SVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDA 2623          

HSP 4 Score: 124.79 bits (312), Expect = 2.571e-28
Identity = 167/673 (24.81%), Postives = 280/673 (41.60%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKES-----EMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILAT---DKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLG-TSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIAS-NPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKN-NDYFSLTPDYGMLCAMEKL 2417
            NDN P F +  Y   + EN  +   I   +   A D   GV +      N      FK +TE  V +    + +  ++D E     EF ++A D G        K  +++ D ND  P F    Y++ ++ES     + +   ++ +   D D GN G++S    +     I   F++ ++   + +     L   T   +  N+ A D G    ++ A+V + + +    PP      F K     Y +  I  GT   +V  ++  + D      +   I +     Y  +++TN       +  I+     D E K+   ++I    T G   +    ++ + ++D+NDNAP F +      V E+   E+      P+ A    DKD G +G V Y +  V +  K  F+ID  +G +     LDYE  +  ++ ++A D GVP  S+++ ++V+V+D NDN P  +   YS  + E+  I   + +VN +D DT  N +     +   +   T   +S    Q F I   SG IY +  LDRE   +    ++A+ N  P  + K             V V +LD NDN P    K K + +              EN+   + V       DLD GEN+ +R ++   N  F + P  G +   E L
Sbjct:  605 NDNEPIFDQSFYNVSVAENEPVGRCI---LKVSASDPDCGVNAMV----NYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTTAMIK--MQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQVSYRIVAGNEAGI---FRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPP-----IFEKARYNYYVKEDIPRGT---VVGSVIAASGDVAHRSPVRYSIYSGDPDGYF-SIETN-------SGNIRIAKPLDHEAKSQVLLNIQA--TLGEPPVYGHTQVNIEVEDVNDNAPEFEASMVRISVPESA--EL----GAPLYAAHAHDKDSGSSGQVTYSL--VKESGKGLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAK-----------TRVIVRVLDANDNDPKFQ-KSKYEFR------------IEENLRRGSVVGV-VTASDLDLGENAAIRYSLLPINSSFQVHPVTGEISTREPL 1214          

HSP 5 Score: 122.479 bits (306), Expect = 1.320e-27
Identity = 170/710 (23.94%), Postives = 304/710 (42.82%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDAD-----DLPFGVESY--EIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVD-GGKPPRKGKTKII--LKVLDENDCEPQF------SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQL-SQTLHGVALKLISKL-----DYETINKYSFNLVAKDFGQP-PRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQY-ARIYINEGTTKDMVIC---------LVKVTDD----DNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGI-VKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVP-VRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKP---QVKA-VNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDY-----FSLTPDYGMLCAMEKL 2417
            NDN+P +P+     ++ E + + + I    A DAD     DL + +  Y  ++ +  E     F++      D+    L ++  +D E +      + A+D       + +T +   L++LD ND  P F            + I ++   G  + H+   D+DSG+NG+++      T  + +  F++ SQT  G+ ++L+  L     D E   +++  + AKD GQP P+ S+  + + V   +++PP  +   +   I +   +  ++ + T K +               V +D    D Q   IT   +  +ES     L       NR++    S +   R + ++        DT    Q      + + + D+NDN+P F     YG+ V EN    ++      ++A+D DEG N  + Y I+    ++ N FSID ++G + +   LD E+    +++I A D G P  R     + + V+D NDN P   LS Y+  + E+ P+GT V +++  D D  +N +                 +      F ID +SG I T   LDRE+ +   F ++A+     D G+   R    +  + V +N+LD NDN P  + +  P   QV A + P  + +K                   +D D G N+++  ++   +      F + P  G L A + L
Sbjct: 1479 NDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRM------DSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEI---TGGNGEGRFRINSQT--GI-IELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGVANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSI-------GDTSN-GQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGVIHT----VVASDLDEGPNADLIYSITG--GNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARL------------VYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLAT-----DGGRYEVR----SATVPVQINVLDINDNRP--IFERYPYIGQVPALIQPGQTLLKVQA----------------LDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSL 2122          

HSP 6 Score: 101.293 bits (251), Expect = 3.745e-21
Identity = 129/520 (24.81%), Postives = 215/520 (41.35%), Query Frame = 3
Query:  687 IEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDN--------QADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSS---PRYYGIVKE-NRVNEIVTINKDPIL--ATDKD-EGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVS---IEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPM 2192
            I   L+A     P      ++++++ DEND  P+FSQ  +   + E    G  +  +   D D+G+N ++  +     N D  N F +     G+    I  LD E  + Y   ++A D G P  + TA + V + +VND          N+P       + ++E T    VI  +   D D          A+S T +IE +   F L+      VL+ R  YE++ + + D          ++ SD       +    L V + D NDNAPVF +   P Y+ I+   + ++E ++++ D +   ATD D EG N  V Y    +++  +  FS+  + GVV   +      +       + I AKD G P   SS  L V   D    + +   + Y  ++ E  P+G+ V ++     D  +                  G  + A ++     +S  I     LDRE +      ++ S+P    +G  L      +  ISV + ILD NDN P+
Sbjct: 2288 IRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDG-NHD--NAFVIEPAFSGIVRTNI-VLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVND----------NQPTFPPNNLVTVSEATELGAVITSISANDVDTYPALTYRLGAES-TVDIE-NMSIFALDRYSGKLVLKRRLDYELQQEYELD----------VIASDAAH----EARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIY----IIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIA--------------GNEESAFELL----QSKAIVLVKPLDRERNDLYKLRLVLSHP----HGPPLISSLNSSSGISVIITILDANDNFPI 2751          

HSP 7 Score: 94.3597 bits (233), Expect = 4.921e-19
Identity = 188/828 (22.71%), Postives = 321/828 (38.77%), Query Frame = 3
Query:  126 VEITETTVSLFELADVSDHIGRSGLKSDSFYLSEDTDSFQLINGRVTLRRPIDREE--------YCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTF-PEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKP-PRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQ-PPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFY-LNALKTNAVLE---NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPV--FSSPRYYGIVKEN-----RVNEIVTI----------------NKDPILATDKDEGE-----------------------NGTVEYYISNVVDDMKNY--FSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNE-SGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAMEKL 2417
            +++T  ++   E A++S  I  +G+ +D F++      +Q   G +T R   DRE         Y   +N+  T  +S     +    IG  SN        I I V D+NDNSP F P   Y   + ENS+    I   +A D D+ P     Y I   N         +   F  +     +    +DRE   R    + A D G+P  R+G   I + V D+ND  P+F    Y   ++E    G  ++ +   D D G N ++  + A+ T       +Q +       +  + KLD E    Y+F ++A D G+   RS+T  V++ V ++ND          N+PI ++Y   YI +      V  L++      +  ++  ++  + E  Y LNA  +    +   N  T  + +      E+  L  + +V  D +G         +E++I +     PV  F +  Y  ++KEN     R+ ++V +                N+D IL+ D   GE                        G   +Y   + +  +     S      +  +   L   +   + + + A+    P  +S  +L++ ++D NDN P+     +   + E    GT+V +V+  D D   N +                     D  F I+   SG + T +VLDRE+       IIA+     D G         T   ++ V I+D NDN P     +   V     E+  + TS + N    +  T+P +   L     ++  V ++N   F+L    G L    +L
Sbjct: 1739 LQVTAKSLHGAENANLSYEI-PAGVANDLFHVD-----WQ--RGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYSITGGN---------LGNKFSIDSSSGELSARPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQ------WQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDIND----------NRPIFERYP--YIGQ------VPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARD-KGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNEDGILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHI-----------VDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIAT-----DEGVPQM-----TGTATIRVQIVDVNDNQPTFPPNNLVTVSEAT-ELGAVITSISAN----DVDTYPALTYRL----GAESTVDIENMSIFALDRYSGKLVLKRRL 2493          

HSP 8 Score: 89.7373 bits (221), Expect = 1.263e-17
Identity = 156/630 (24.76%), Postives = 259/630 (41.11%), Query Frame = 3
Query:  612 TEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKT-KIILKVLDENDCEPQFSQLIYEIKIKESEMTGLE--LLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLS--QTLHGVA---LKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINE--GTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVF--------SSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNV-VDDMKNYFSI---DKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPN--PLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTM----KNNDYFSLTPDYGMLCAMEKL 2417
            T+  +D     +  K ++DRE   R  ++L+A+     P  G+  ++++ V DEND  P F Q    I+  E+    ++  LL  R  D +  N  + +I      + ++ + F+LS  +   GV    L++   LD ET   YS  + A D G PP      V + + +VND+ P  +F Q     S+ +A +  N   GT+   V       D++   +      ++ +E  +    +T A+  N+        +DF  ETK LH + +V  D  G   L+ T  + + + D+NDN P          +SP+   I +  +  E V      I   D D       EY   NV ++    +F++   D +  +V   L LD E + + ++ + A D G P   +S  + + + D NDN PE +   Y   + E    GT V +V   D+D  +N+       +         T +   Q F ID ++G I T+  +D E        ++A +    PL            +   +V V I D NDN P+              + SF   S  EN     C+       D D G N+ V  T+    K+   F +    G +C   +L
Sbjct:  121 TDLAIDRATGEIRTKVKLDRE--TRASYSLVAI-----PLSGRNIRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNI-----VSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQP--IFNQ-----SRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINK-------ALDF--ETKELHELVVVAKD-HGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPK---ISESAQPGEFVA----RISVHDPDS----KTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAE---------TPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPL------------SSTATVLVTIHDVNDNEPIF-------------DQSFYNVSVAENEPVGRCI-LKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGEL 675          

HSP 9 Score: 89.7373 bits (221), Expect = 1.386e-17
Identity = 164/742 (22.10%), Postives = 296/742 (39.89%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKL--MTEDFV------DNKQPILIVKHQIDREFID--RIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKIS---INFASSTNQDIQNTFQLSQ--TLHGVALKLISKLDYETINKYSFNLVAKDFGQ--PPRSSTAL-VEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGT-TKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTN-KLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYI-SNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLG--VPVRSSSVK---------------------LIVNVKDTNDNQPEVD-LSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNND--YFSLTPDYGMLCAMEKLPP--IGDYKTVIVAEDGDFNNSRKQEFLINIHI 2510
            NDN PTF   +    + E++ +   +    +    + P  V    +E+  E+  V + L  +T+D +      D     L+V   +DRE     R+E   +       P+     + ++V D ND  P++ Q   ++++ E+   G  + +    D D+G NG +    I +    N+  +    L +  +L G AL L + LD+E + +Y   + A D       R  T++ V + + + ND  P+  F   N    K  A ++I++ T   ++V  +V V +D      +T EI                ++E  K+    ++ D ++  +   F  I+ +   G  + K+++  L +I++  ++N P F    Y   + EN  +    +    + A      EN  + Y I + V +D+   F +D   G++ T    D E      + +  +D      + SS+V+                     + + V D NDN PE    S Y   + EN   G  +  V  +D D   N   I       + G  LG        F+ID+ SG++  +  LDRE  S+    I AS     D G+   RQ       ++T+ + D+NDN+P   L                 T + +   P          VD D G N+++  ++ N     F++    G++  + KL       Y  +++A DG     R     + I++
Sbjct: 1359 NDNRPTFTSSSLVFRVREDAALGHVVG---SISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTG-ALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPH--FVSPNSSGGKT-ASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGGNGEGRFRINSQTGIIELVKSLPPATE-DVEKGGR---FNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFLQAVYRATILENVPSGSFVLQ---VTAKSLHGAENANLSYEIPAGVANDL---FHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSPEFRPGSCYGLSVPENSEPGV-IHTVVASDLDEGPNADLIYS-----ITGGNLGNK------FSIDSSSGELSARP-LDREQHSRYTLQIQAS-----DRGQPKSRQ----GHCNITIFVEDQNDNAPRFKLSK--------------YTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINV 2047          

HSP 10 Score: 87.4261 bits (215), Expect = 6.182e-17
Identity = 147/581 (25.30%), Postives = 246/581 (42.34%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLP-----FGVES-YEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEP---------QFSQLIYEIKIKESEMTGLELLHLRVEDKDS-GNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLD--YETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEG-----INQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIV----TINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEK-IKHVSIEISAKDLGVPVRSSSVK-LIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASN 2087
            NDN PTFP       + E +++ + I+   A D D  P      G ES  +IE    N  ++        +D     L++K ++D E     E  +IA D      + +T + ++V DEND  P          F+ L    +I ES     +LL +   D DS GNN K+         +  Q  F +  + +GV    +S+L     +   Y   ++AKD G+P   S+ L+ V     ND+       QF   +  QY R  I+E      V+  +      +  D     I  ++ES +        +L+++    +K     DRE   L+ + +V S   G              + + I D NDN P+F     Y    E  ++E+     +I +   +  D++   N  V Y I++  D+  + F+ID  TGV+     LDY+   K   + I A D        S++   + + D NDN+P+  L+ Y   L ENEP+G+ V + + +D D             ++ P P+  +S    ++F +D+ESG + +  V D E   +    ++AS+
Sbjct: 2422 NDNQPTFPPNNLVT-VSEATELGAVITSISANDVDTYPALTYRLGAESTVDIE----NMSIFA-------LDRYSGKLVLKRRLDYELQQEYELDVIASDAA---HEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYII-----EPAQEGFSVHPS-NGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRV---QANDNGSG--RSQF---LQNQY-RAQISEAAPLGSVVLQLG----QDALDQSLAIIAGNEESAF-------ELLQSKAIVLVKP---LDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKY----EAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDE--HMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLD----KGPFGQLNYSIGPAPSDESSW---KMFRVDSESGLVTSAFVFDYEQRQRYDMELLASD 2945          

HSP 11 Score: 75.8702 bits (185), Expect = 2.531e-13
Identity = 107/394 (27.16%), Postives = 163/394 (41.37%), Query Frame = 3
Query: 1320 NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEY-YISNVVDDMKNYFSIDKNTGVVKTILG----LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSP---MMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNND-YFSLTP-DYGMLCAMEKLPP----IGDYKTVIVAED 2459
            +R T EI++K+  DRET+  +  S+V     G N      ++ V +KD NDNAP F     +    EN   E   + +  + A D D     T  Y  +S  V+D     S  +  GV+   L     LD E     S+ I A D G P     + + + ++D NDNQP  + S Y   + EN  +GT V +V  +D D D N        +              +Q+F ID  +G IY    LD E        ++A         KD   Q  +T    V++ + D NDN P   ++ L D       +P++S       E+  P   V    +     + E + V VT+   D +F+LT  D  +   +  LP     + +Y   +VA D
Sbjct:  126 DRATGEIRTKVKLDRETRASY--SLVAIPLSGRNI-----RVLVTVKDENDNAPTFPQTSMHIEFPENTPRE---VKRTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRR---------QSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVA---------KDHGEQPLETTAF-VSIRVTDVNDNQPTINVIFLSDD-----ASPKIS-------ESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATD 478          

HSP 12 Score: 73.559 bits (179), Expect = 1.280e-12
Identity = 103/419 (24.58%), Postives = 169/419 (40.33%), Query Frame = 3
Query:  699 LIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTAL------VEVFVTNVNDSPPNIVFYQFNKPISKQYAR--IYINEGTTKDMVICLVKVTDDDNQADSITCEI-----ETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNY--FSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENE--PIGTYVGKVNVTDKDT 1904
            +IA D GKP  K  T + ++  D      QF Q  Y  +I E+   G  +L L  +  D       S+   +   +   + F+L   L   A+ L+  LD E  + Y   LV      PP  S+        V + + + ND          N PI  + A+    I+E       I  ++  D D Q ++   E+       + E  +   L T  +  N       +++D+D   K+   +   C D+     L       + + D NDN P F    Y   + EN   E V  +     A+D D+G  G + Y I     D  ++  F +D  +G+V +    DYE+ +   +E+ A D+G   + +SV + V ++  ++  P+     Y F L      P G  VG+V  TD D+
Sbjct: 2618 IIAKDAGKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQ------SLAIIAGNEE---SAFEL---LQSKAIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDAND----------NFPIFDRSAKYEAEISELAPLRYSIAQLQAIDAD-QENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVN-------NRLDYDSGAKSYELIIRAC-DSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAEN---EPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMG--GKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQVTATDSDS 3000          

HSP 13 Score: 69.707 bits (169), Expect = 1.623e-11
Identity = 115/504 (22.82%), Postives = 205/504 (40.67%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQI--DREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS--ITCEIETSQESFYLNALKTNAVLE---NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIE-ISAKDLGVP-----VRSSSVKLIVNVKDTNDNQPEVDLSF-YSFELYENEPIGTYVGKVNVTDKD 1901
            NDNSP F +K +   + E +   + ++   A+D+D        Y I   N +           FV       IV+  I  DRE  D  +  +IA D G P   G   I ++++D ND +P F        +  SE T L  +   +   D      ++    + +  DI+N    +   +   L L  +LDYE   +Y  +++A D     R+   ++ V V + ND+ P  +  Q     +   A   I+E  + D  +  V  TD D++ ++  +   IE +QE F ++   +N V+    +R    + S  D+        FV I+  D  G   LK +  L V   D       F   +Y   + E            P+ +     G++  ++  ++ +  + ++ F + ++  +V  +  LD E+     +  + +   G P       SS + +I+ + D NDN P  D S  Y  E+ E  P+   + ++   D D
Sbjct: 2316 NDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHD---------NAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPP---NNLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEART---VLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVH--PSNGVVSVNMSRLQPAVSSSGDY--------FVRIIAKDA-GKPALKSSTLLRVQANDNGSGRSQFLQNQYRAQISE----------AAPLGSVVLQLGQDA-LDQSLAIIAGNEESAFELLQSKAIV-LVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDAD 2781          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304900)

HSP 1 Score: 167.933 bits (424), Expect = 1.675e-41
Identity = 136/492 (27.64%), Postives = 227/492 (46.14%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQL-SQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKD 1901
            NDN+P F    + + +LEN  +   I    AYD+D+      +Y I + ++NF +         VD +   +     +DRE   R  F ++A DGG PP+   + +++ V D ND +P F+   YE  + E +  G  +  +   D D  +     I     T  + +  F + SQ   G+ + +   LDY+   ++   + A D G   RS TA V + +T+ N+  P  +F   N P S       + E       + +V  TD D     +  +I  S     +N L +      N +T  I +    DRET + + +++   D  G   L  T  +E+ + D+NDNAP F SP Y   + E+    +V  +   + A+D D G NG ++Y +S+  D     F ID  +G ++T  GLD E +    +   A D G P  SS+V++ + ++D ND+ P       +  + EN P+G+ VG+++  D D
Sbjct:  683 NDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA--------VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEI-----TTGNTRGRFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAP--IFE--NAPYSAS-----VFEDAPVGTTVLVVSATDSDV---GVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDG-GNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILED---ALVGTSVIQVAASDPDVGLNGRIKYLLSDR-DIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD 1141          

HSP 2 Score: 165.236 bits (417), Expect = 1.063e-40
Identity = 144/505 (28.51%), Postives = 225/505 (44.55%), Query Frame = 3
Query:  435 DNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTN-----QDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPP---RSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINE---GTTKDMVICLVKVTDDD---NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTD 1907
            + SP F +  Y   +LE     + ++   A D +D P  V    +   +      FK      VD++  ++     +DRE +D   F ++A D   PPR G T + + VLD ND  P F    +E  I+E    G  ++ LR  D+D G N +I     + T+     QD +       +  GV +   S LD ET + Y   + A D        R++TA V+V V + ND+ P     QF    S++   + + E   G T+D  +  ++ TD D   N A         +Q  F ++++  +  L     YE               +  ++ +   G      T +L V + D NDNAP F + ++   V EN     V  N   + A D DEG N  + Y IS   D+     ++D  TG V+TI  LD E+    + ++ AKD GVP +S+S  +++ V+D NDN P  +  +Y   + E++P GT V  V  TD D D
Sbjct:  354 NQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSP--VVYSMVSLLDSRSQSLFK------VDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV-ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP-----QF----SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYE-----------SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVP---VGYNIIRVQAYDSDEGANAEITYSISERDDNFP--LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED 824          

HSP 3 Score: 164.851 bits (416), Expect = 1.458e-40
Identity = 157/597 (26.30%), Postives = 259/597 (43.38%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDF-VDNKQPILIVKHQIDREFIDRIEFTLIAVD---GGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLE---LLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNT--GVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASN-PNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSP 2189
            ND+SPTF  + +   I E + + S +    A D D        Y IE   +   +        F +D++  ++  +  +DRE  D     + A D        R     + +KVLD+ND  PQFS+  Y +++ E +  G E   + H+R  D D GNN  I         Q      Q S       + L+  LDYE++  Y   + A+D G P RS+T  + V V + ND+ P     QF + + +     Y          I  V+  D D  A++ IT  I    ++F L          + +T  +++    DRE +      +V  D  G+     ++ + + ++D+NDN P F +P+YY    E  V E           T  D  E+  + Y I+    + +  F+I      G++     LDY++ K   + ++A D G   RS +  + +N+ D N+  P  + + YS  ++E+ P+GT V  V+ TD D  +N +      +  + G  LG+  P    F+I+ ++G I T   LDRE +S     + A +  NP            DT ++ + V   D NDN+P
Sbjct:  458 NDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS-----QFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGY---------NIIRVQAYDSDEGANAEITYSISERDDNFPLAV--------DPRTGWVQTIKPLDREEQGRFAFQVVAKDG-GVPPKSASSSVVITVQDVNDNDPAF-NPKYY----EANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT--TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESING--LGSPDP----FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP---------SLSDTTDVEIGVT--DVNDNAP 1005          

HSP 4 Score: 93.2041 bits (230), Expect = 1.258e-18
Identity = 89/355 (25.07%), Postives = 153/355 (43.10%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTED-FVDNKQPILIVKHQ-IDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQN-TFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVF 1487
            N+ +P F    Y   + E++ + + + +  A D+D    GV +      NE  +    L + D F  N Q   IV +  +DRE       T+ A DGG P     T + + V D ND  P F   +Y+  I E  + G  ++ +   D D G NG+I       +++DI++ +F +  T     ++    LD E++  +    +A D G PP SST  V++ + +VNDSPP           +     +Y+ E +    V+  +   D D   +++        +     +L T    E R      +++D++   K    V    S       L+    +E+++ D+NDNAPV 
Sbjct:  891 NNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD---VGVNAQITYSLNE--ESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL---SDRDIEDGSFVIDPT--SGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTF---------ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSE-RAQLLTMTELDYESTRKRFELVVRAASPP-----LRNDAHIEILVTDVNDNAPVL 1220          

HSP 5 Score: 72.0182 bits (175), Expect = 3.267e-12
Identity = 64/239 (26.78%), Postives = 101/239 (42.26%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTED---FVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLI--SKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQ 1133
            NDN+P F    Y   ILE++ + + +    A D D    G   Y +   +           ED    +D     +     +DRE +     T IAVD G PP     ++ +++ D ND  P F+     + + E+   G  +  +   D D G N  +     S    D  N F L         +L+  ++LDYE+  K  F LV +    PP  + A +E+ VT+VND+ P +  +Q
Sbjct: 1001 NDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRD----------IEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHY---SIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRA-ASPPLRNDAHIEILVTDVNDNAPVLRDFQ 1224          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0339463)

HSP 1 Score: 167.548 bits (423), Expect = 1.940e-41
Identity = 136/492 (27.64%), Postives = 227/492 (46.14%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQL-SQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKD 1901
            NDN+P F    + + +LEN  +   I    AYD+D+      +Y I + ++NF +         VD +   +     +DRE   R  F ++A DGG PP+   + +++ V D ND +P F+   YE  + E +  G  +  +   D D  +     I     T  + +  F + SQ   G+ + +   LDY+   ++   + A D G   RS TA V + +T+ N+  P  +F   N P S       + E       + +V  TD D     +  +I  S     +N L +      N +T  I +    DRET + + +++   D  G   L  T  +E+ + D+NDNAP F SP Y   + E+    +V  +   + A+D D G NG ++Y +S+  D     F ID  +G ++T  GLD E +    +   A D G P  SS+V++ + ++D ND+ P       +  + EN P+G+ VG+++  D D
Sbjct:  683 NDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA--------VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEI-----TTGNTRGRFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAP--IFE--NAPYSAS-----VFEDAPVGTTVLVVSATDSDV---GVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDG-GNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILED---ALVGTSVIQVAASDPDVGLNGRIKYLLSDR-DIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD 1141          

HSP 2 Score: 164.851 bits (416), Expect = 1.200e-40
Identity = 144/505 (28.51%), Postives = 225/505 (44.55%), Query Frame = 3
Query:  435 DNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTN-----QDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPP---RSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINE---GTTKDMVICLVKVTDDD---NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTD 1907
            + SP F +  Y   +LE     + ++   A D +D P  V    +   +      FK      VD++  ++     +DRE +D   F ++A D   PPR G T + + VLD ND  P F    +E  I+E    G  ++ LR  D+D G N +I     + T+     QD +       +  GV +   S LD ET + Y   + A D        R++TA V+V V + ND+ P     QF    S++   + + E   G T+D  +  ++ TD D   N A         +Q  F ++++  +  L     YE               +  ++ +   G      T +L V + D NDNAP F + ++   V EN     V  N   + A D DEG N  + Y IS   D+     ++D  TG V+TI  LD E+    + ++ AKD GVP +S+S  +++ V+D NDN P  +  +Y   + E++P GT V  V  TD D D
Sbjct:  354 NQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSP--VVYSMVSLLDSRSQSLFK------VDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV-ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP-----QF----SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYE-----------SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVP---VGYNIIRVQAYDSDEGANAEITYSISERDDNFP--LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED 824          

HSP 3 Score: 164.466 bits (415), Expect = 1.675e-40
Identity = 157/597 (26.30%), Postives = 259/597 (43.38%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDF-VDNKQPILIVKHQIDREFIDRIEFTLIAVD---GGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLE---LLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNT--GVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASN-PNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSP 2189
            ND+SPTF  + +   I E + + S +    A D D        Y IE   +   +        F +D++  ++  +  +DRE  D     + A D        R     + +KVLD+ND  PQFS+  Y +++ E +  G E   + H+R  D D GNN  I         Q      Q S       + L+  LDYE++  Y   + A+D G P RS+T  + V V + ND+ P     QF + + +     Y          I  V+  D D  A++ IT  I    ++F L          + +T  +++    DRE +      +V  D  G+     ++ + + ++D+NDN P F +P+YY    E  V E           T  D  E+  + Y I+    + +  F+I      G++     LDY++ K   + ++A D G   RS +  + +N+ D N+  P  + + YS  ++E+ P+GT V  V+ TD D  +N +      +  + G  LG+  P    F+I+ ++G I T   LDRE +S     + A +  NP            DT ++ + V   D NDN+P
Sbjct:  458 NDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS-----QFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGY---------NIIRVQAYDSDEGANAEITYSISERDDNFPLAV--------DPRTGWVQTIKPLDREEQGRFAFQVVAKDG-GVPPKSASSSVVITVQDVNDNDPAF-NPKYY----EANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT--TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESING--LGSPDP----FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP---------SLSDTTDVEIGVT--DVNDNAP 1005          

HSP 4 Score: 92.8189 bits (229), Expect = 1.359e-18
Identity = 89/355 (25.07%), Postives = 153/355 (43.10%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTED-FVDNKQPILIVKHQ-IDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQN-TFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVF 1487
            N+ +P F    Y   + E++ + + + +  A D+D    GV +      NE  +    L + D F  N Q   IV +  +DRE       T+ A DGG P     T + + V D ND  P F   +Y+  I E  + G  ++ +   D D G NG+I       +++DI++ +F +  T     ++    LD E++  +    +A D G PP SST  V++ + +VNDSPP           +     +Y+ E +    V+  +   D D   +++        +     +L T    E R      +++D++   K    V    S       L+    +E+++ D+NDNAPV 
Sbjct:  891 NNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD---VGVNAQITYSLNE--ESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL---SDRDIEDGSFVIDPT--SGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTF---------ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSE-RAQLLTMTELDYESTRKRFELVVRAASPP-----LRNDAHIEILVTDVNDNAPVL 1220          

HSP 5 Score: 72.0182 bits (175), Expect = 3.410e-12
Identity = 64/239 (26.78%), Postives = 101/239 (42.26%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTED---FVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLI--SKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQ 1133
            NDN+P F    Y   ILE++ + + +    A D D    G   Y +   +           ED    +D     +     +DRE +     T IAVD G PP     ++ +++ D ND  P F+     + + E+   G  +  +   D D G N  +     S    D  N F L         +L+  ++LDYE+  K  F LV +    PP  + A +E+ VT+VND+ P +  +Q
Sbjct: 1001 NDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRD----------IEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHY---SIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRA-ASPPLRNDAHIEILVTDVNDNAPVLRDFQ 1224          
BLAST of Protocadherin-1 vs. Ensembl Fly
Match: stan (gene:FBgn0024836 transcript:FBtr0304899)

HSP 1 Score: 167.548 bits (423), Expect = 2.073e-41
Identity = 136/492 (27.64%), Postives = 227/492 (46.14%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQL-SQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKD 1901
            NDN+P F    + + +LEN  +   I    AYD+D+      +Y I + ++NF +         VD +   +     +DRE   R  F ++A DGG PP+   + +++ V D ND +P F+   YE  + E +  G  +  +   D D  +     I     T  + +  F + SQ   G+ + +   LDY+   ++   + A D G   RS TA V + +T+ N+  P  +F   N P S       + E       + +V  TD D     +  +I  S     +N L +      N +T  I +    DRET + + +++   D  G   L  T  +E+ + D+NDNAP F SP Y   + E+    +V  +   + A+D D G NG ++Y +S+  D     F ID  +G ++T  GLD E +    +   A D G P  SS+V++ + ++D ND+ P       +  + EN P+G+ VG+++  D D
Sbjct:  683 NDNAPRFYTSQFQESVLENVPVGYNIIRVQAYDSDEGANAEITYSISERDDNFPLA--------VDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDEDSRLHYEI-----TTGNTRGRFAITSQNGRGL-ITIAQSLDYKQEKRFLLTVAATDSGG--RSDTATVHINITDANNFAP--IFE--NAPYSAS-----VFEDAPVGTTVLVVSATDSDV---GVNAQITYSLNEESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDG-GNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILED---ALVGTSVIQVAASDPDVGLNGRIKYLLSDR-DIEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPD 1141          

HSP 2 Score: 164.851 bits (416), Expect = 1.239e-40
Identity = 144/505 (28.51%), Postives = 225/505 (44.55%), Query Frame = 3
Query:  435 DNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTN-----QDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPP---RSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINE---GTTKDMVICLVKVTDDD---NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTD 1907
            + SP F +  Y   +LE     + ++   A D +D P  V    +   +      FK      VD++  ++     +DRE +D   F ++A D   PPR G T + + VLD ND  P F    +E  I+E    G  ++ LR  D+D G N +I     + T+     QD +       +  GV +   S LD ET + Y   + A D        R++TA V+V V + ND+ P     QF    S++   + + E   G T+D  +  ++ TD D   N A         +Q  F ++++  +  L     YE               +  ++ +   G      T +L V + D NDNAP F + ++   V EN     V  N   + A D DEG N  + Y IS   D+     ++D  TG V+TI  LD E+    + ++ AKD GVP +S+S  +++ V+D NDN P  +  +Y   + E++P GT V  V  TD D D
Sbjct:  354 NQSPYFEQALYVASVLEEQPAGAAVTTVRARDPEDSP--VVYSMVSLLDSRSQSLFK------VDSRTGVVTTSASLDRELMDVHYFRVVATDDSFPPRSGTTTLQVNVLDCNDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGV-ISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYP-----QF----SERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQSQFSIDSMSGDVSLVKPLDYE-----------SVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVP---VGYNIIRVQAYDSDEGANAEITYSISERDDNFP--LAVDPRTGWVQTIKPLDREEQGRFAFQVVAKDGGVPPKSASSSVVITVQDVNDNDPAFNPKYYEANVGEDQPPGTPVTTVTATDPDED 824          

HSP 3 Score: 164.466 bits (415), Expect = 1.805e-40
Identity = 157/597 (26.30%), Postives = 259/597 (43.38%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDF-VDNKQPILIVKHQIDREFIDRIEFTLIAVD---GGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLE---LLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNT--GVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASN-PNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSP 2189
            ND+SPTF  + +   I E + + S +    A D D        Y IE   +   +        F +D++  ++  +  +DRE  D     + A D        R     + +KVLD+ND  PQFS+  Y +++ E +  G E   + H+R  D D GNN  I         Q      Q S       + L+  LDYE++  Y   + A+D G P RS+T  + V V + ND+ P     QF + + +     Y          I  V+  D D  A++ IT  I    ++F L          + +T  +++    DRE +      +V  D  G+     ++ + + ++D+NDN P F +P+YY    E  V E           T  D  E+  + Y I+    + +  F+I      G++     LDY++ K   + ++A D G   RS +  + +N+ D N+  P  + + YS  ++E+ P+GT V  V+ TD D  +N +      +  + G  LG+  P    F+I+ ++G I T   LDRE +S     + A +  NP            DT ++ + V   D NDN+P
Sbjct:  458 NDHSPTFEAEQFEASIREGATVGSTVITLRATDQDIGKNAEIEYGIEAVTDGAGLAQDQEMPIFRIDSRSGVISTRSSLDRETSDSYHLLVTAADLASAQSERRTATASVQVKVLDDNDNYPQFSERTYTVQVPEDQWGGTEDNTVAHIRATDADQGNNAAIRYAIIGGNTQS-----QFSIDSMSGDVSLVKPLDYESVRSYRLVIRAQDGGSPSRSNTTQLLVNVIDANDNAPRFYTSQFQESVLENVPVGY---------NIIRVQAYDSDEGANAEITYSISERDDNFPLAV--------DPRTGWVQTIKPLDREEQGRFAFQVVAKDG-GVPPKSASSSVVITVQDVNDNDPAF-NPKYY----EANVGEDQPPGTPVTTVTATDPDEDSRLHYEIT--TGNTRGRFAITSQNGRGLITIAQSLDYKQEKRFLLTVAATDSG--GRSDTATVHINITDANNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSDVGVNAQITYSLNEESING--LGSPDP----FSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNP---------SLSDTTDVEIGVT--DVNDNAP 1005          

HSP 4 Score: 92.8189 bits (229), Expect = 1.440e-18
Identity = 89/355 (25.07%), Postives = 153/355 (43.10%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTED-FVDNKQPILIVKHQ-IDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQN-TFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVF 1487
            N+ +P F    Y   + E++ + + + +  A D+D    GV +      NE  +    L + D F  N Q   IV +  +DRE       T+ A DGG P     T + + V D ND  P F   +Y+  I E  + G  ++ +   D D G NG+I       +++DI++ +F +  T     ++    LD E++  +    +A D G PP SST  V++ + +VNDSPP           +     +Y+ E +    V+  +   D D   +++        +     +L T    E R      +++D++   K    V    S       L+    +E+++ D+NDNAPV 
Sbjct:  891 NNFAPIFENAPYSASVFEDAPVGTTVLVVSATDSD---VGVNAQITYSLNE--ESINGLGSPDPFSINPQTGAIVTNAPLDRETTSGYLLTVTAKDGGNPSLSDTTDVEIGVTDVNDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLL---SDRDIEDGSFVIDPT--SGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTF---------ASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHYSIIGGDDSNAFSLVTRPGSE-RAQLLTMTELDYESTRKRFELVVRAASPP-----LRNDAHIEILVTDVNDNAPVL 1220          

HSP 5 Score: 72.0182 bits (175), Expect = 3.525e-12
Identity = 64/239 (26.78%), Postives = 101/239 (42.26%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTED---FVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLI--SKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQ 1133
            NDN+P F    Y   ILE++ + + +    A D D    G   Y +   +           ED    +D     +     +DRE +     T IAVD G PP     ++ +++ D ND  P F+     + + E+   G  +  +   D D G N  +     S    D  N F L         +L+  ++LDYE+  K  F LV +    PP  + A +E+ VT+VND+ P +  +Q
Sbjct: 1001 NDNAPAFKSPLYQASILEDALVGTSVIQVAASDPDVGLNGRIKYLLSDRD----------IEDGSFVIDPTSGTIRTNKGLDRESVAVFHLTAIAVDKGSPPLSSTVEVQIRLEDVNDSPPTFASDKITLYVPENSPVGSVVGEIHAHDPDEGVNAVVHY---SIIGGDDSNAFSLVTRPGSERAQLLTMTELDYESTRK-RFELVVRA-ASPPLRNDAHIEILVTDVNDNAPVLRDFQ 1224          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 233.417 bits (594), Expect = 1.593e-62
Identity = 203/703 (28.88%), Postives = 328/703 (46.66%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGI--VKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVD-DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKN---NDYFSLTPDYGMLCAMEKLP--PIGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       + EN+ + +  S+P+A D D    GV  Y +    E   ++   + ED  + K P LIV   +DRE  D  + T+ AVDGG PPR     + + + D ND  P+F +  YE ++ E+   G  +L ++  D D G NG+I      + +  +    ++ ++   + +K    LD E IN   F +VA+D G  P+SS   V + VT+ ND+ P +        ++       I+E       + LV+V+D D   +++   +      F L     ++V +N++ Y +++    D E    + V IV  D+ G   L  TN L+V + D NDN+P+F SP  + +   +EN+  E V      ++A+D D G N  + Y I  + D   +  F ID N+G V+    LD E        ++A D GVP    +  +++ V D NDN P+  LS YSF + EN P  + VG V V D D   N +  +         P +G        F I N +G I + +  DRE  S   F + A +      G D  R    +  + VT+N+LD+NDN+P++    KP         SFI+ S      P++ V       D+D G N+++  ++     +D F ++P  G +   ++L     G ++ VI   D     SR    L++I++ E
Sbjct:  125 NDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGE-KLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDP-VPKLLRIDRSSGIIYVK--GPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGL-VTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSV-DNKRKYFLQTTTPLDYERVRDYRVEIVAVDS-GNPALSSTNSLKVQVTDTNDNSPIF-SPTLFEVEFAEENQPGEKVV----EVVASDADSGTNAELVYSI--IADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVE------PDVGK-------FVIQNGTGTILSSISFDREKESSYTFRLKAVD------GGDPPR----SSYVGVTINVLDENDNAPVVT---KPS------NSSFIRLSP--MAAPDSVVEV-VEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSD-RGKPSRHAIALVHIYVNE 777          

HSP 2 Score: 119.783 bits (299), Expect = 7.096e-27
Identity = 141/557 (25.31%), Postives = 225/557 (40.39%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLI--SKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILAT--------DKDEGENGTVEYYIS------------NVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK 2357
            ++V D ND  PQF   +  + + E+   G         DKD+  NG       +          Q+++       +LI    LD E  + Y   + A D G PPR S+AL+ V + + ND+ P            K      + E +     +  VK  D D   +    EIE +         K   +  +     +K  +D + E   L F   V +  +G +       + + + D NDNAP     R  G+V  +  + +  I++D  + T        DKDEGEN  V   ++            + VD+ + YF        ++T   LDYE+++   +EI A D G P  SS+  L V V DTNDN P    + +  E  E    G  V +V  +D D+  N + +           ++        +F ID  SG++  +  LDRE   +  F + A+     D G    R        +V + +LD+NDN P  ML             S    S  EN+ P + V       D+DEGEN++V+++++
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPK---------FEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNG---EIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDRE-EINNLKF--YVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEI-RGIGLVTHS--DGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYF--------LQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVY----------SIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAA-----DKGVPSHRG-----TATVVIKVLDRNDNDPKFML-------------SGYSFSVLENMPPLSPVGM-VTVQDMDEGENAQVQLSVE 615          

HSP 3 Score: 94.3597 bits (233), Expect = 5.177e-19
Identity = 97/332 (29.22%), Postives = 145/332 (43.67%), Query Frame = 3
Query: 1419 NQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNY---FSIDKNTGVVKTI-LG-LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTN-ENIYPENCVTFPYIFV---DLDEGENSKVRVTMKNNDYFSLTP 2384
            NQ  +  +  + ++DINDN P F SP     V EN  +  + +I     LATDKD   NG  +Y ++   + +  +    + D+   + + I LG LD E      + I A D G P R SS  L V + D NDN P+ + S Y  E+ EN PIG  V +V   D D   N +      + + P P L           ID  SG IY K  LDRE  + + F ++A +  P       +          V++++ D+NDN+P + ++           +  +  S    NI  +  V      V   D DEGEN+ V   +  +  F L P
Sbjct:  109 NQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIP----LATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKL---------LRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTY----------VSIDVTDQNDNAPAVEIRG----------IGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRP 407          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 231.106 bits (588), Expect = 4.576e-62
Identity = 203/703 (28.88%), Postives = 327/703 (46.51%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGI--VKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVD-DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKN---NDYFSLTPDYGMLCAMEKLPP--IGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       + EN+ + +  S+P+A D D    GV  Y +    E   ++   + ED    K P LIV   +DRE  D  + T+ AVDGG PPR     + + + D ND  P+F +  YE ++ E+   G  +L ++  D D G NG+I      + +  +    ++ ++   + +K    LD E IN   F +VA+D G  P+SS   V + VT+ ND+ P +        ++       I+E       + LV+V+D D   +++   +      F L     ++V +N++ Y +++    D E    + V IV  D+ G   L  TN L+V + D NDN+P+F SP  + +   +EN+  E V      ++A+D D G N  + Y I  + D   +  F ID N+G V+    LD E        ++A D GVP    +  +++ V D NDN P+  LS YSF + EN P  + VG V V D D   N +  +         P +G        F I N +G I + +  DRE  S   F + A +      G D  R    +  + VT+N+LD+NDN+P++    KP         SFI+ S      P++ V       D+D G N+++  ++     +D F ++P  G +   ++L     G ++ VI   D     SR    L++I++ E
Sbjct:  125 NDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDR-GEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDP-VPKLLRIDRSSGIIYVK--GPLDREEINNLKFYVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEIRGIGL-VTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSV-DNKRKYFLQTTTPLDYERVRDYRVEIVAVDS-GNPALSSTNSLKVQVTDTNDNSPIF-SPTLFEVEFAEENQPGEKVV----EVVASDADSGTNAELVYSI--IADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVQDMDEGENAQVQLSVE------PDVGK-------FVIQNGTGTILSSISFDREKESSYTFRLKAVD------GGDPPR----SSYVGVTINVLDENDNAPVVT---KPS------NSSFIRLSPMA--APDSVVEV-VEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLHRLVIKVSD-RGKPSRHAIALVHIYVNE 777          

HSP 2 Score: 117.472 bits (293), Expect = 3.630e-26
Identity = 145/569 (25.48%), Postives = 226/569 (39.72%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLI--SKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILAT--------DKDEGENGTVEYYIS------------NVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYG 2393
            ++V D ND  PQF   +  + + E+   G         DKD+  NG       +          Q+++       +LI    LD E  + Y   + A D G PPR S+AL+ V + + ND+ P            K      + E +     +  VK  D D   +    EIE +         K   +  +     +K  +D + E   L F   V +  +G +       + + + D NDNAP     R  G+V  +  + +  I++D  + T        DKDEGEN  V   ++            + VD+ + YF        ++T   LDYE+++   +EI A D G P  SS+  L V V DTNDN P    + +  E  E    G  V +V  +D D+  N + +           ++        +F ID  SG++  +  LDRE   +  F + A+     D G    R        +V + +LD+NDN P  ML             S    S  EN+ P + V       D+DEGEN++V+         S+ PD G
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPK---------FEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNG---EIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDRE-EINNLKF--YVVARDKGPSPKSSKTYVSIDVTDQNDNAPAVEI-RGIGLVTHS--DGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSSVDNKRKYF--------LQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEKVVEVVASDADSGTNAELVY----------SIIADSSTRGLFEIDPNSGEVRARSPLDREHKDRYEFRVTAA-----DKGVPSHRG-----TATVVIKVLDRNDNDPKFML-------------SGYSFSVLENMPPLSPVGM-VTVQDMDEGENAQVQ--------LSVEPDVG 619          

HSP 3 Score: 92.8189 bits (229), Expect = 1.457e-18
Identity = 95/332 (28.61%), Postives = 144/332 (43.37%), Query Frame = 3
Query: 1419 NQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNY---FSIDKNTGVVKTIL--GLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTN-ENIYPENCVTFPYIFV---DLDEGENSKVRVTMKNNDYFSLTP 2384
            NQ  +  +  + ++DINDN P F SP     V EN  +  + +I     LATDKD   NG  +Y ++   + +  +    + D+   + + I+   LD E      + I A D G P R SS  L V + D NDN P+ + S Y  E+ EN PIG  V +V   D D   N +      + + P P L           ID  SG IY K  LDRE  + + F ++A +  P       +          V++++ D+NDN+P + ++           +  +  S    NI  +  V      V   D DEGEN+ V   +  +  F L P
Sbjct:  109 NQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIP----LATDKDTERNGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKL---------LRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTY----------VSIDVTDQNDNAPAVEIRG----------IGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRP 407          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh7b (protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-299])

HSP 1 Score: 217.624 bits (553), Expect = 2.512e-57
Identity = 180/629 (28.62%), Postives = 287/629 (45.63%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPN----------------------ENFD------VYFKLMTEDFVDN-KQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTK-------DMVICLVKVTDDDNQADSI-TCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRV--NEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMML 2201
            NDN+P+FP       + EN  I +   LP A D D    G+E YE+ + N                        FD        F+L   D  D  KQP LI+K  +DRE  D  E TL   DGG PPR  +  + + + D ND  P+F + +YE  + E+   G  +L L+  D D G NG+I   F ++T + ++   +L ++     L ++ ++D E +++  F ++A+D GQPP++  A V + + + ND+ PNI          ++  RI++ +G          D  I LV+V+D D   + I TC +      F L          N+K Y + +    D E    + V IV  D+   +     + + V + D+NDN PVFS         EN      +VT     ++A D D G+N  + Y + + V+ +   FSID +TG ++    LD E+ +    ++ AKD G+PV   S  ++V V D NDN+P+     ++F + EN    + VG + V D D   N    +               +  + IF+IDN +G I++ +  DRE  +   F + A +      G D  R    T+ +SV    +D NDN P ++ 
Sbjct:  131 NDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTPRFEKSVYEADLPENSSPGAPILQLKAGDTDVGVNGQIEYVFGAAT-ESVRRLLRLDESTG--WLSVLHRIDREDVSQLRFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDI--------RKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTV-VGDVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLI-VKVGDMNDNPPVFSKSTVEVSFPENNAPGERVVT-----VVALDADSGKNAEISYSLDSSVNGI---FSIDADTGDIRVNTILDREQTERYEFKVIAKDKGMPVLQGSATVVVLVADKNDNEPKFMQDVFTFYIQENLQPNSPVGMITVMDADKGQNADMSLYI-------------EEEENIFSIDNNTGTIFSNMAFDREQRNNYSFRVKAVD------GGDPPRSATATVSLSV----MDVNDNPPTVLF 715          

HSP 2 Score: 132.109 bits (331), Expect = 1.147e-30
Identity = 139/511 (27.20%), Postives = 233/511 (45.60%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDF-----VDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFS-QLIYEIKIKESEMTGLE-------LLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVA--LKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQES-FYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSF---YSFELYENEPIGTYVGKVNVTDKDT 1904
            NDN+P F +  Y  ++ ENS   + I   +   A D   GV        N   +  F   TE       +D     L V H+IDRE + ++ FT++A D G+PP+  K  +I+ + DEND  P    + I  I +K+      E       +  ++V D+D G NG ++          ++   ++   ++     L   + LDYE + +Y+  +VA D G P  SS   + V V ++ND+PP  VF +    +S      +       + V+ +V +  D  +   I+  +++S    F ++A           T +I+     DRE    +   ++  D +G+  L+ +  + V++ D NDN P F    +   ++EN + N  V +    I   D D+G+N  +  YI    ++ +N FSID NTG + + +  D E+  + S  + A D G P RS++  + ++V D NDN P V       Y+  L  +  I T V  V+ TD DT
Sbjct:  273 NDNTPRFEKSVYEADLPENSSPGAPI---LQLKAGDTDVGV--------NGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREDVSQLRFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDIRKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTVVGDVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPP--VFSKSTVEVS------FPENNAPGERVVTVVALDADSGKNAEISYSLDSSVNGIFSIDA----------DTGDIRVNTILDREQTERYEFKVIAKD-KGMPVLQGSATVVVLVADKNDNEPKFMQDVFTFYIQENLQPNSPVGM----ITVMDADKGQNADMSLYI----EEEENIFSIDNNTGTIFSNMAFDREQRNNYSFRVKAVDGGDPPRSATATVSLSVMDVNDNPPTVLFPMNNSYTL-LPPSSNIRTVVRTVSATDTDT 744          

HSP 3 Score: 98.5969 bits (244), Expect = 2.393e-20
Identity = 113/448 (25.22%), Postives = 187/448 (41.74%), Query Frame = 3
Query:  477 ILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLM----TEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSP---RYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDT 1796
            + E+  +++ I+L    D D  P G+ +  +       DV F+L      E  ++ K+  L     +D E +      ++AVD G P       +I+KV D ND  P FS+   E+   E+   G  ++ +   D DSG N +IS +  SS N      F +      + +  I  LD E   +Y F ++AKD G P    +A V V V + ND+ P  +   F           YI E    +  + ++ V D D  Q   ++  IE  +  F ++            T  I S + FDRE +  +   +   D  G      T  + + + D+NDN P    P    Y  +   + +  +V      + ATD D G N  + Y I  V  +    F +D  TGV+  +  L+ +      + +   D GVP +S++  + + V +T
Sbjct:  403 VAEDVIVDTPIALVQVSDRDKGPNGIVTCTVVG-----DVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPPVFSKSTVEVSFPENNAPGERVVTVVALDADSGKNAEISYSLDSSVN----GIFSIDADTGDIRVNTI--LDREQTERYEFKVIAKDKGMPVLQGSATVVVLVADKNDNEPKFMQDVFT---------FYIQENLQPNSPVGMITVMDADKGQNADMSLYIEEEENIFSID----------NNTGTIFSNMAFDREQRNNYSFRVKAVDG-GDPPRSATATVSLSVMDVNDNPPTVLFPMNNSYTLLPPSSNIRTVVRT----VSATDTDTGVNANLSYRI--VGGNPFKLFDMDAWTGVISLVGKLEQKHFGLHRLVVQVNDSGVPSQSTTTLVHIYVNET 813          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: pcdh7b (protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-299])

HSP 1 Score: 216.853 bits (551), Expect = 3.088e-57
Identity = 180/629 (28.62%), Postives = 287/629 (45.63%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPN----------------------ENFD------VYFKLMTEDFVDN-KQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTK-------DMVICLVKVTDDDNQADSI-TCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRV--NEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMML 2201
            NDN+P+FP       + EN  I +   LP A D D    G+E YE+ + N                        FD        F+L   D  D  KQP LI+K  +DRE  D  E TL   DGG PPR  +  + + + D ND  P+F + +YE  + E+   G  +L L+  D D G NG+I   F ++T + ++   +L ++     L ++ ++D E +++  F ++A+D GQPP++  A V + + + ND+ PNI          ++  RI++ +G          D  I LV+V+D D   + I TC +      F L          N+K Y + +    D E    + V IV  D+   +     + + V + D+NDN PVFS         EN      +VT     ++A D D G+N  + Y + + V+ +   FSID +TG ++    LD E+ +    ++ AKD G+PV   S  ++V V D NDN+P+     ++F + EN    + VG + V D D   N    +               +  + IF+IDN +G I++ +  DRE  +   F + A +      G D  R    T+ +SV    +D NDN P ++ 
Sbjct:  131 NDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGESTVRRIGTSGSGSVDSHSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNTPRFEKSVYEADLPENSSPGAPILQLKAGDTDVGVNGQIEYVFGAAT-ESVRRLLRLDESTG--WLSVLHRIDREDVSQLRFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDI--------RKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTV-VGDVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLI-VKVGDMNDNPPVFSKSTVEVSFPENNAPGERVVT-----VVALDADSGKNAEISYSLDSSVNGI---FSIDADTGDIRVNTILDREQTERYEFKVIAKDKGMPVLQGSATVVVLVADKNDNEPKFMQDVFTFYIQENLQPNSPVGMITVMDADKGQNADMSLYI-------------EEEENIFSIDNNTGTIFSNMAFDREQRNNYSFRVKAVD------GGDPPRSATATVSLSV----MDVNDNPPTVLF 715          

HSP 2 Score: 131.339 bits (329), Expect = 2.079e-30
Identity = 139/511 (27.20%), Postives = 233/511 (45.60%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDF-----VDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFS-QLIYEIKIKESEMTGLE-------LLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVA--LKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQES-FYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSF---YSFELYENEPIGTYVGKVNVTDKDT 1904
            NDN+P F +  Y  ++ ENS   + I   +   A D   GV        N   +  F   TE       +D     L V H+IDRE + ++ FT++A D G+PP+  K  +I+ + DEND  P    + I  I +K+      E       +  ++V D+D G NG ++          ++   ++   ++     L   + LDYE + +Y+  +VA D G P  SS   + V V ++ND+PP  VF +    +S      +       + V+ +V +  D  +   I+  +++S    F ++A           T +I+     DRE    +   ++  D +G+  L+ +  + V++ D NDN P F    +   ++EN + N  V +    I   D D+G+N  +  YI    ++ +N FSID NTG + + +  D E+  + S  + A D G P RS++  + ++V D NDN P V       Y+  L  +  I T V  V+ TD DT
Sbjct:  273 NDNTPRFEKSVYEADLPENSSPGAPI---LQLKAGDTDVGV--------NGQIEYVFGAATESVRRLLRLDESTGWLSVLHRIDREDVSQLRFTVMARDRGQPPKTDKATVIINIKDENDNVPNIDIRKIGRIFLKDGVANVAEDVIVDTPIALVQVSDRDKGPNGIVTCTVVGDVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPP--VFSKSTVEVS------FPENNAPGERVVTVVALDADSGKNAEISYSLDSSVNGIFSIDA----------DTGDIRVNTILDREQTERYEFKVIAKD-KGMPVLQGSATVVVLVADKNDNEPKFMQDVFTFYIQENLQPNSPVGM----ITVMDADKGQNADMSLYI----EEEENIFSIDNNTGTIFSNMAFDREQRNNYSFRVKAVDGGDPPRSATATVSLSVMDVNDNPPTVLFPMNNSYTL-LPPSSNIRTVVRTVSATDTDT 744          

HSP 3 Score: 97.8265 bits (242), Expect = 4.164e-20
Identity = 113/448 (25.22%), Postives = 187/448 (41.74%), Query Frame = 3
Query:  477 ILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLM----TEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSP---RYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDT 1796
            + E+  +++ I+L    D D  P G+ +  +       DV F+L      E  ++ K+  L     +D E +      ++AVD G P       +I+KV D ND  P FS+   E+   E+   G  ++ +   D DSG N +IS +  SS N      F +      + +  I  LD E   +Y F ++AKD G P    +A V V V + ND+ P  +   F           YI E    +  + ++ V D D  Q   ++  IE  +  F ++            T  I S + FDRE +  +   +   D  G      T  + + + D+NDN P    P    Y  +   + +  +V      + ATD D G N  + Y I  V  +    F +D  TGV+  +  L+ +      + +   D GVP +S++  + + V +T
Sbjct:  403 VAEDVIVDTPIALVQVSDRDKGPNGIVTCTVVG-----DVPFQLKPASEVEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDMNDNPPVFSKSTVEVSFPENNAPGERVVTVVALDADSGKNAEISYSLDSSVN----GIFSIDADTGDIRVNTI--LDREQTERYEFKVIAKDKGMPVLQGSATVVVLVADKNDNEPKFMQDVFT---------FYIQENLQPNSPVGMITVMDADKGQNADMSLYIEEEENIFSID----------NNTGTIFSNMAFDREQRNNYSFRVKAVDG-GDPPRSATATVSLSVMDVNDNPPTVLFPMNNSYTLLPPSSNIRTVVRT----VSATDTDTGVNANLSYRI--VGGNPFKLFDMDAWTGVISLVGKLEQKHFGLHRLVVQVNDSGVPSQSTTTLVHIYVNET 813          
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Match: CT030123.1 (protocadherin 1b [Source:NCBI gene;Acc:572016])

HSP 1 Score: 216.468 bits (550), Expect = 3.125e-57
Identity = 194/701 (27.67%), Postives = 322/701 (45.93%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGI--VKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVR---VTMKNNDYFSLTPDYGMLCAMEKLPP-IGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P F        I EN+ + +  ++P+A D D    G+  Y +    E  ++ F L      D K P LIV   +DRE  D  +  +  VDGG PPR+    + + + D ND  P+F +  YE ++ E+   G  +L ++  D D G NG+++ +    ++  +     + +    + +K    +D E I+   F + AKD G   +SS ALV + V + ND+ P+I        ++ +     I+E       + LV+V+D D   +++   +      F L +         RK Y +++    D E    + + IV  D+ G   L  TN L+V + D+NDNAPVF SP  Y +   +EN+  + V      ++ATD D G N  + Y I+      +  F I+ NTG V+ +  LD E++ H    ++A D GVP    +  ++V V D NDN P+  L+ YSF + EN P  + VG V V D D   N +  +             + +P +  F I N +  I + +  DRE  S   F + A +      G D  R    +  + +T+N+LD+NDN+P +        K  N    F+   T+   + E+         D+D G NS++    V    +  F ++ +  +  A E  P  IG ++ V+  +D      R+   L++I++ E
Sbjct:  153 NDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGIADYALTTGPEATNL-FSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPKFERSHYEGELPENSPVGHSVLQVKANDSDMGPNGEVTYSLHQPSSP-VMRLLSIDRNTGIIFVK--GSVDREEISILKFYVQAKDNGPQSKSSKALVTITVKDQNDNAPSIRIRGIGL-VTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRK-YFLQTTTLLDYERIKEYRIEIVAVDS-GNPALSSTNSLKVQVTDMNDNAPVF-SPTLYEVEFFEENQPGDKVL----DVVATDADSGTNAELTYSITG-GSVPEGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAADKGVPSLRGTATVVVKVLDRNDNDPKFMLNGYSFSVQENMPPLSPVGMVTVNDHDEGENARVQL-------------SVEPDNGKFMIQNGTYTILSTISFDREKESTYSFRLKAVD------GGDPPR----SSYVGITINVLDENDNAPYV-------TKPANSSYKFLDPRTSPETHVESVEA-----EDIDIGLNSELDFNIVGGNPHGLFRISSEGEITLAKEFTPKHIGLHRLVVKVKD-KGTPPRQTTALVHIYVNE 804          

HSP 2 Score: 140.969 bits (354), Expect = 2.183e-33
Identity = 156/571 (27.32%), Postives = 236/571 (41.33%), Query Frame = 3
Query:  717 GKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHG----VALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILAT--------DKDEGENGTVEYYISNVV------------DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK 2357
            G  PR  + +I  ++LDEND  PQFS  +  + I E+   G         D+DSG+NG    ++A +T  +  N F L            L ++  LD E  + Y  N+   D G PPR S+AL+ + +T+ ND+ P            + +    + E +     +  VK  D D   +    E+  S        ++  ++  N     +K  +D + E   L F   V +   G         + + +KD NDNAP   S R  GI      + +  I++D  + T        D+DEGEN  V   ++  V            D  + YF        ++T   LDYE+IK   IEI A D G P  SS+  L V V D NDN P    + Y  E +E    G  V  V  TD D+  N +         +P          + +F I+  +G++     LDRE      F + A+     D G    R        +V V +LD+NDN P  ML             SF   S  EN+ P + V    +  D DEGEN++V+++++
Sbjct:  137 GTGPRLIEGRI--EILDENDNTPQFSSPVLTLSIPENTHVGALFAIPVATDRDSGSNGI--ADYALTTGPEATNLFSLQVAQDSDEKLPQLIVLGNLDRELRDSYDLNIKVVDGGSPPRQSSALLRITITDANDNVPK---------FERSHYEGELPENSPVGHSVLQVKANDSDMGPNG---EVTYSLHQPSSPVMRLLSIDRNTGIIFVKGSVDRE-EISILKF--YVQAKDNGPQSKSSKALVTITVKDQNDNAP---SIRIRGIGLVTHEDGVANISEDMPVGTAVALVEVSDRDEGENAVVTCVVAGDVPFQLRSASETGNDRKRKYF--------LQTTTLLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPTLYEVEFFEENQPGDKVLDVVATDADSGTNAELTYSITGGSVP----------EGLFEINPNTGEVRVMSQLDREQLDHYQFLVAAA-----DKGVPSLRG-----TATVVVKVLDRNDNDPKFMLNG----------YSF---SVQENMPPLSPVGMVTVN-DHDEGENARVQLSVE 643          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 229.18 bits (583), Expect = 7.412e-61
Identity = 182/651 (27.96%), Postives = 309/651 (47.47%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENR-VNEIVTINKDPILATDKDEGENGTVEYYISNVVD-DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            NDN+P F        I EN+ I     +P A D D    GV SYE+    E  D++   + ED  D KQP LIV   +DRE  D  + T+   DGG P R     + + +LD ND  P+F ++ YE ++ E+   G  +L ++  D D G N +I  +F  +++  ++    L ++   + ++    +D E +    F++VAKD G  P+++   V + + + ND+ P I    F   ++ Q     I+E    +  + LV+V+D D   ++    +      F L  + ++   +++K Y +++    D E+   + + IV  D+ G   L  TN L+V + D+NDNAPVFS      +  EN  +N++V      + ATD D G N  + Y I  + D   +  FSI+ ++G ++    LD E+ +H    + A D G+P    +  +++ V D NDN P+  L+ Y+F + EN P  + VG V V D D   N    +             + +P    F I N +G I + +  DRE  S   F + A +      G D  R    +  + VT+N+LD+NDN+P++++      K + P+            +P   V +     D+D G N+++  ++ + + F L
Sbjct:  162 NDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAED-QDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDT-VRRLLHLDRSTGLITVQ--GPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGL-VTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQV-SDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDS-GNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVM----EVSATDADSGPNSQLHYSI--LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHL-------------SVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVD------GGDPPR----SSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQT-----------HPGTPVNW-VRAEDMDTGINAELDYSIASGNPFEL 764          

HSP 2 Score: 139.043 bits (349), Expect = 1.333e-32
Identity = 154/561 (27.45%), Postives = 235/561 (41.89%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLS----QTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRE-TKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKD-----PIL---ATDKDEGENGTVEYYISNVV------------DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK 2357
            ++++D ND  P F+  +  + I E+   G+        D+DSG NG  S         + Q+ F L     Q      L ++  LD E  + Y   +  +D G P R+S+AL+ + + + ND+ P            K      + E +     +  VK  D D     +  EI+    SF+  +     +L  +R T  I  +   DRE   TL F S+V  D +G N      ++ + I+D NDN PV    R +G+V       +  I++D     P+     +D DEG N  V   ++  V            D  K YF        ++T   LDYE +K  +IEI A D G P  SS+  L V V D NDN P    S       EN  I   V +V+ TD D+            ++LP P+      A  IF+I+ +SG+I    VLDRE      F ++A     +D G       + T   SV + +LD+NDN P  ML             +F        + P   VT     +D D+GEN+ + ++++
Sbjct:  156 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELI--VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPK---------FEKMAYEAELPENSPMGHSVLQVKANDSDQ---GVNAEIDY---SFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKF-SVVAKD-KGANPKTARTQVTITIRDTNDNKPVIEI-RGFGLVTHQ--GGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF--------LQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG----PNSQLHYSILPDPS------ARGIFSINPDSGQIRVNTVLDREQREHYDFHVVA-----VDKG---IPSLKGTA--SVVITVLDRNDNDPKFMLNG----------YNFSVMENMPRLSPVGMVT----VIDADKGENAHIHLSVE 652          

HSP 3 Score: 83.5741 bits (205), Expect = 1.589e-15
Identity = 97/365 (26.58%), Postives = 156/365 (42.74%), Query Frame = 3
Query: 1332 YEIKSKIDFD--RETKTLH-----FVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSI------DKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFV---DLDEGENSKVRVTMKNNDYFSL 2378
            Y  ++ ID +  RE + L      F+    S T+ ++ + +    ++ I DINDN P F+SP     + EN    I  +   P  ATD+D G NG   Y +  V  + ++ F +      D+    +  +  LD E+     + I  +D G P R+SS  L +++ DTNDN P+ +   Y  EL EN P+G  V +V   D D  +N +      +          S    ++  +D  +G I  +  +DRE    + F+++A      D G +       T    VT+ I D NDN P++ ++    V                NI  +  V  P   V   D+DEG N+ V   +  +  F L
Sbjct:  110 YTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPEN--TNIGMLFPIPA-ATDRDSGVNGVSSYELI-VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQ---------ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAK-----DKGAN-----PKTARTQVTITIRDTNDNKPVIEIRGFGLV---------THQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQL 442          

HSP 4 Score: 68.1662 bits (165), Expect = 7.044e-11
Identity = 66/230 (28.70%), Postives = 94/230 (40.87%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTED---FVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQF---SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYS--FNLVAK--DFGQPPRSSTALVEVFV 1091
            NDN P F    Y   ++EN    S + +    DAD               EN  ++  +  E     + N    ++     DRE      F L AVDGG PPR     + + VLDEND  P     S + Y+    ++   G  +  +R ED D+G N ++  + AS       N F+L Q  H      + K     I K+     LV K  D G+P R  TALV  ++
Sbjct:  606 NDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADK-------------GENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTH-PGTPVNWVRAEDMDTGINAELDYSIASG------NPFELFQISHNNGEVTLEK---AIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 812          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 228.794 bits (582), Expect = 8.054e-61
Identity = 182/651 (27.96%), Postives = 309/651 (47.47%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENR-VNEIVTINKDPILATDKDEGENGTVEYYISNVVD-DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            NDN+P F        I EN+ I     +P A D D    GV SYE+    E  D++   + ED  D KQP LIV   +DRE  D  + T+   DGG P R     + + +LD ND  P+F ++ YE ++ E+   G  +L ++  D D G N +I  +F  +++  ++    L ++   + ++    +D E +    F++VAKD G  P+++   V + + + ND+ P I    F   ++ Q     I+E    +  + LV+V+D D   ++    +      F L  + ++   +++K Y +++    D E+   + + IV  D+ G   L  TN L+V + D+NDNAPVFS      +  EN  +N++V      + ATD D G N  + Y I  + D   +  FSI+ ++G ++    LD E+ +H    + A D G+P    +  +++ V D NDN P+  L+ Y+F + EN P  + VG V V D D   N    +             + +P    F I N +G I + +  DRE  S   F + A +      G D  R    +  + VT+N+LD+NDN+P++++      K + P+            +P   V +     D+D G N+++  ++ + + F L
Sbjct:  170 NDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAED-QDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDT-VRRLLHLDRSTGLITVQ--GPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGL-VTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQV-SDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDS-GNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVM----EVSATDADSGPNSQLHYSI--LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHL-------------SVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVD------GGDPPR----SSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQT-----------HPGTPVNW-VRAEDMDTGINAELDYSIASGNPFEL 772          

HSP 2 Score: 138.658 bits (348), Expect = 1.586e-32
Identity = 154/561 (27.45%), Postives = 235/561 (41.89%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLS----QTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRE-TKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKD-----PIL---ATDKDEGENGTVEYYISNVV------------DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK 2357
            ++++D ND  P F+  +  + I E+   G+        D+DSG NG  S         + Q+ F L     Q      L ++  LD E  + Y   +  +D G P R+S+AL+ + + + ND+ P            K      + E +     +  VK  D D     +  EI+    SF+  +     +L  +R T  I  +   DRE   TL F S+V  D +G N      ++ + I+D NDN PV    R +G+V       +  I++D     P+     +D DEG N  V   ++  V            D  K YF        ++T   LDYE +K  +IEI A D G P  SS+  L V V D NDN P    S       EN  I   V +V+ TD D+            ++LP P+      A  IF+I+ +SG+I    VLDRE      F ++A     +D G       + T   SV + +LD+NDN P  ML             +F        + P   VT     +D D+GEN+ + ++++
Sbjct:  164 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELI--VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPK---------FEKMAYEAELPENSPMGHSVLQVKANDSDQ---GVNAEIDY---SFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKF-SVVAKD-KGANPKTARTQVTITIRDTNDNKPVIEI-RGFGLVTHQ--GGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF--------LQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG----PNSQLHYSILPDPS------ARGIFSINPDSGQIRVNTVLDREQREHYDFHVVA-----VDKG---IPSLKGTA--SVVITVLDRNDNDPKFMLNG----------YNFSVMENMPRLSPVGMVT----VIDADKGENAHIHLSVE 660          

HSP 3 Score: 83.1889 bits (204), Expect = 1.989e-15
Identity = 97/365 (26.58%), Postives = 156/365 (42.74%), Query Frame = 3
Query: 1332 YEIKSKIDFD--RETKTLH-----FVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSI------DKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFV---DLDEGENSKVRVTMKNNDYFSL 2378
            Y  ++ ID +  RE + L      F+    S T+ ++ + +    ++ I DINDN P F+SP     + EN    I  +   P  ATD+D G NG   Y +  V  + ++ F +      D+    +  +  LD E+     + I  +D G P R+SS  L +++ DTNDN P+ +   Y  EL EN P+G  V +V   D D  +N +      +          S    ++  +D  +G I  +  +DRE    + F+++A      D G +       T    VT+ I D NDN P++ ++    V                NI  +  V  P   V   D+DEG N+ V   +  +  F L
Sbjct:  118 YTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPEN--TNIGMLFPIPA-ATDRDSGVNGVSSYELI-VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQ---------ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAK-----DKGAN-----PKTARTQVTITIRDTNDNKPVIEIRGFGLV---------THQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQL 450          

HSP 4 Score: 67.781 bits (164), Expect = 9.591e-11
Identity = 66/230 (28.70%), Postives = 94/230 (40.87%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTED---FVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQF---SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYS--FNLVAK--DFGQPPRSSTALVEVFV 1091
            NDN P F    Y   ++EN    S + +    DAD               EN  ++  +  E     + N    ++     DRE      F L AVDGG PPR     + + VLDEND  P     S + Y+    ++   G  +  +R ED D+G N ++  + AS       N F+L Q  H      + K     I K+     LV K  D G+P R  TALV  ++
Sbjct:  614 NDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADK-------------GENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTH-PGTPVNWVRAEDMDTGINAELDYSIASG------NPFELFQISHNNGEVTLEK---AIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 820          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 227.639 bits (579), Expect = 1.036e-60
Identity = 182/651 (27.96%), Postives = 307/651 (47.16%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENR-VNEIVTINKDPILATDKDEGENGTVEYYISNVVD-DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            NDN+P F        I EN+ I     +P A D D    GV SYE+    E  D++   + ED  D KQP LIV   +DRE  D  + T+   DGG P R     + + +LD ND  P+F ++ YE ++ E+   G  +L ++  D D G N +I  +F  +++  ++    L ++   + ++    +D E +    F++VAKD G  P+++   V + + + ND+ P I    F   ++ Q     I+E    +  + LV+V+D D   ++    +      F L  +      +++K Y +++    D E+   + + IV  D+ G   L  TN L+V + D+NDNAPVFS      +  EN  +N++V      + ATD D G N  + Y I  + D   +  FSI+ ++G ++    LD E+ +H    + A D G+P    +  +++ V D NDN P+  L+ Y+F + EN P  + VG V V D D   N    +             + +P    F I N +G I + +  DRE  S   F + A +      G D  R    +  + VT+N+LD+NDN+P++++      K + P+            +P   V +     D+D G N+++  ++ + + F L
Sbjct:  170 NDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAED-QDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDT-VRRLLHLDRSTGLITVQ--GPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGL-VTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGS-DSKKKYFLQTTTALDYESVKEYTIEIVAVDS-GNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVM----EVSATDADSGPNSQLHYSI--LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHL-------------SVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVD------GGDPPR----SSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQT-----------HPGTPVNW-VRAEDMDTGINAELDYSIASGNPFEL 772          

HSP 2 Score: 137.502 bits (345), Expect = 3.509e-32
Identity = 154/561 (27.45%), Postives = 235/561 (41.89%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLS----QTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRE-TKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKD-----PIL---ATDKDEGENGTVEYYISNVV------------DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK 2357
            ++++D ND  P F+  +  + I E+   G+        D+DSG NG  S         + Q+ F L     Q      L ++  LD E  + Y   +  +D G P R+S+AL+ + + + ND+ P            K      + E +     +  VK  D D     +  EI+    SF+  +     +L  +R T  I  +   DRE   TL F S+V  D +G N      ++ + I+D NDN PV    R +G+V       +  I++D     P+     +D DEG N  V   ++  V            D  K YF        ++T   LDYE +K  +IEI A D G P  SS+  L V V D NDN P    S       EN  I   V +V+ TD D+            ++LP P+      A  IF+I+ +SG+I    VLDRE      F ++A     +D G       + T   SV + +LD+NDN P  ML             +F        + P   VT     +D D+GEN+ + ++++
Sbjct:  164 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELI--VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPK---------FEKMAYEAELPENSPMGHSVLQVKANDSDQ---GVNAEIDY---SFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKF-SVVAKD-KGANPKTARTQVTITIRDTNDNKPVIEI-RGFGLVTHQ--GGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF--------LQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG----PNSQLHYSILPDPS------ARGIFSINPDSGQIRVNTVLDREQREHYDFHVVA-----VDKG---IPSLKGTA--SVVITVLDRNDNDPKFMLNG----------YNFSVMENMPRLSPVGMVT----VIDADKGENAHIHLSVE 660          

HSP 3 Score: 82.4185 bits (202), Expect = 3.089e-15
Identity = 97/365 (26.58%), Postives = 156/365 (42.74%), Query Frame = 3
Query: 1332 YEIKSKIDFD--RETKTLH-----FVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSI------DKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFV---DLDEGENSKVRVTMKNNDYFSL 2378
            Y  ++ ID +  RE + L      F+    S T+ ++ + +    ++ I DINDN P F+SP     + EN    I  +   P  ATD+D G NG   Y +  V  + ++ F +      D+    +  +  LD E+     + I  +D G P R+SS  L +++ DTNDN P+ +   Y  EL EN P+G  V +V   D D  +N +      +          S    ++  +D  +G I  +  +DRE    + F+++A      D G +       T    VT+ I D NDN P++ ++    V                NI  +  V  P   V   D+DEG N+ V   +  +  F L
Sbjct:  118 YTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPEN--TNIGMLFPIPA-ATDRDSGVNGVSSYELI-VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQ---------ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAK-----DKGAN-----PKTARTQVTITIRDTNDNKPVIEIRGFGLV---------THQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQL 450          

HSP 4 Score: 67.781 bits (164), Expect = 9.362e-11
Identity = 66/230 (28.70%), Postives = 94/230 (40.87%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTED---FVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQF---SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYS--FNLVAK--DFGQPPRSSTALVEVFV 1091
            NDN P F    Y   ++EN    S + +    DAD               EN  ++  +  E     + N    ++     DRE      F L AVDGG PPR     + + VLDEND  P     S + Y+    ++   G  +  +R ED D+G N ++  + AS       N F+L Q  H      + K     I K+     LV K  D G+P R  TALV  ++
Sbjct:  614 NDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADK-------------GENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTH-PGTPVNWVRAEDMDTGINAELDYSIASG------NPFELFQISHNNGEVTLEK---AIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 820          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 228.409 bits (581), Expect = 1.149e-60
Identity = 182/651 (27.96%), Postives = 309/651 (47.47%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENR-VNEIVTINKDPILATDKDEGENGTVEYYISNVVD-DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            NDN+P F        I EN+ I     +P A D D    GV SYE+    E  D++   + ED  D KQP LIV   +DRE  D  + T+   DGG P R     + + +LD ND  P+F ++ YE ++ E+   G  +L ++  D D G N +I  +F  +++  ++    L ++   + ++    +D E +    F++VAKD G  P+++   V + + + ND+ P I    F   ++ Q     I+E    +  + LV+V+D D   ++    +      F L  + ++   +++K Y +++    D E+   + + IV  D+ G   L  TN L+V + D+NDNAPVFS      +  EN  +N++V      + ATD D G N  + Y I  + D   +  FSI+ ++G ++    LD E+ +H    + A D G+P    +  +++ V D NDN P+  L+ Y+F + EN P  + VG V V D D   N    +             + +P    F I N +G I + +  DRE  S   F + A +      G D  R    +  + VT+N+LD+NDN+P++++      K + P+            +P   V +     D+D G N+++  ++ + + F L
Sbjct:  170 NDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAED-QDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDT-VRRLLHLDRSTGLITVQ--GPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGL-VTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQV-SDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDS-GNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVM----EVSATDADSGPNSQLHYSI--LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHL-------------SVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVD------GGDPPR----SSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQT-----------HPGTPVNW-VRAEDMDTGINAELDYSIASGNPFEL 772          

HSP 2 Score: 138.658 bits (348), Expect = 1.605e-32
Identity = 154/561 (27.45%), Postives = 235/561 (41.89%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLS----QTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRE-TKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKD-----PIL---ATDKDEGENGTVEYYISNVV------------DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK 2357
            ++++D ND  P F+  +  + I E+   G+        D+DSG NG  S         + Q+ F L     Q      L ++  LD E  + Y   +  +D G P R+S+AL+ + + + ND+ P            K      + E +     +  VK  D D     +  EI+    SF+  +     +L  +R T  I  +   DRE   TL F S+V  D +G N      ++ + I+D NDN PV    R +G+V       +  I++D     P+     +D DEG N  V   ++  V            D  K YF        ++T   LDYE +K  +IEI A D G P  SS+  L V V D NDN P    S       EN  I   V +V+ TD D+            ++LP P+      A  IF+I+ +SG+I    VLDRE      F ++A     +D G       + T   SV + +LD+NDN P  ML             +F        + P   VT     +D D+GEN+ + ++++
Sbjct:  164 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELI--VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPK---------FEKMAYEAELPENSPMGHSVLQVKANDSDQ---GVNAEIDY---SFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKF-SVVAKD-KGANPKTARTQVTITIRDTNDNKPVIEI-RGFGLVTHQ--GGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF--------LQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG----PNSQLHYSILPDPS------ARGIFSINPDSGQIRVNTVLDREQREHYDFHVVA-----VDKG---IPSLKGTA--SVVITVLDRNDNDPKFMLNG----------YNFSVMENMPRLSPVGMVT----VIDADKGENAHIHLSVE 660          

HSP 3 Score: 83.1889 bits (204), Expect = 1.810e-15
Identity = 97/365 (26.58%), Postives = 156/365 (42.74%), Query Frame = 3
Query: 1332 YEIKSKIDFD--RETKTLH-----FVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSI------DKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFV---DLDEGENSKVRVTMKNNDYFSL 2378
            Y  ++ ID +  RE + L      F+    S T+ ++ + +    ++ I DINDN P F+SP     + EN    I  +   P  ATD+D G NG   Y +  V  + ++ F +      D+    +  +  LD E+     + I  +D G P R+SS  L +++ DTNDN P+ +   Y  EL EN P+G  V +V   D D  +N +      +          S    ++  +D  +G I  +  +DRE    + F+++A      D G +       T    VT+ I D NDN P++ ++    V                NI  +  V  P   V   D+DEG N+ V   +  +  F L
Sbjct:  118 YTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPEN--TNIGMLFPIPA-ATDRDSGVNGVSSYELI-VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQ---------ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAK-----DKGAN-----PKTARTQVTITIRDTNDNKPVIEIRGFGLV---------THQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQL 450          

HSP 4 Score: 68.1662 bits (165), Expect = 7.488e-11
Identity = 66/230 (28.70%), Postives = 94/230 (40.87%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTED---FVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQF---SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYS--FNLVAK--DFGQPPRSSTALVEVFV 1091
            NDN P F    Y   ++EN    S + +    DAD               EN  ++  +  E     + N    ++     DRE      F L AVDGG PPR     + + VLDEND  P     S + Y+    ++   G  +  +R ED D+G N ++  + AS       N F+L Q  H      + K     I K+     LV K  D G+P R  TALV  ++
Sbjct:  614 NDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADK-------------GENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTH-PGTPVNWVRAEDMDTGINAELDYSIASG------NPFELFQISHNNGEVTLEK---AIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 820          
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 227.639 bits (579), Expect = 1.262e-60
Identity = 182/651 (27.96%), Postives = 309/651 (47.47%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENR-VNEIVTINKDPILATDKDEGENGTVEYYISNVVD-DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            NDN+P F        I EN+ I     +P A D D    GV SYE+    E  D++   + ED  D KQP LIV   +DRE  D  + T+   DGG P R     + + +LD ND  P+F ++ YE ++ E+   G  +L ++  D D G N +I  +F  +++  ++    L ++   + ++    +D E +    F++VAKD G  P+++   V + + + ND+ P I    F   ++ Q     I+E    +  + LV+V+D D   ++    +      F L  + ++   +++K Y +++    D E+   + + IV  D+ G   L  TN L+V + D+NDNAPVFS      +  EN  +N++V      + ATD D G N  + Y I  + D   +  FSI+ ++G ++    LD E+ +H    + A D G+P    +  +++ V D NDN P+  L+ Y+F + EN P  + VG V V D D   N    +             + +P    F I N +G I + +  DRE  S   F + A +      G D  R    +  + VT+N+LD+NDN+P++++      K + P+            +P   V +     D+D G N+++  ++ + + F L
Sbjct:  170 NDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAED-QDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDT-VRRLLHLDRSTGLITVQ--GPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGL-VTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQV-SDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDS-GNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVM----EVSATDADSGPNSQLHYSI--LPDPSARGIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADKGENAHIHL-------------SVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVD------GGDPPR----SSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQT-----------HPGTPVNW-VRAEDMDTGINAELDYSIASGNPFEL 772          

HSP 2 Score: 137.502 bits (345), Expect = 3.096e-32
Identity = 154/561 (27.45%), Postives = 235/561 (41.89%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLS----QTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRE-TKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKD-----PIL---ATDKDEGENGTVEYYISNVV------------DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK 2357
            ++++D ND  P F+  +  + I E+   G+        D+DSG NG  S         + Q+ F L     Q      L ++  LD E  + Y   +  +D G P R+S+AL+ + + + ND+ P            K      + E +     +  VK  D D     +  EI+    SF+  +     +L  +R T  I  +   DRE   TL F S+V  D +G N      ++ + I+D NDN PV    R +G+V       +  I++D     P+     +D DEG N  V   ++  V            D  K YF        ++T   LDYE +K  +IEI A D G P  SS+  L V V D NDN P    S       EN  I   V +V+ TD D+            ++LP P+      A  IF+I+ +SG+I    VLDRE      F ++A     +D G       + T   SV + +LD+NDN P  ML             +F        + P   VT     +D D+GEN+ + ++++
Sbjct:  164 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELI--VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPK---------FEKMAYEAELPENSPMGHSVLQVKANDSDQ---GVNAEIDY---SFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKF-SVVAKD-KGANPKTARTQVTITIRDTNDNKPVIEI-RGFGLVTHQ--GGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYF--------LQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSG----PNSQLHYSILPDPS------ARGIFSINPDSGQIRVNTVLDREQREHYDFHVVA-----VDKG---IPSLKGTA--SVVITVLDRNDNDPKFMLNG----------YNFSVMENMPRLSPVGMVT----VIDADKGENAHIHLSVE 660          

HSP 3 Score: 82.8037 bits (203), Expect = 2.649e-15
Identity = 97/367 (26.43%), Postives = 156/367 (42.51%), Query Frame = 3
Query: 1332 YEIKSKIDFD--RETKTLH-----FVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSI------DKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASN--PNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFV---DLDEGENSKVRVTMKNNDYFSL 2378
            Y  ++ ID +  RE + L      F+    S T+ ++ + +    ++ I DINDN P F+SP     + EN    I  +   P  ATD+D G NG   Y +  V  + ++ F +      D+    +  +  LD E+     + I  +D G P R+SS  L +++ DTNDN P+ +   Y  EL EN P+G  V +V   D D  +N +      +          S    ++  +D  +G I  +  +DRE    + F+++A +   NP             T    VT+ I D NDN P++ ++    V                NI  +  V  P   V   D+DEG N+ V   +  +  F L
Sbjct:  118 YTTETSIDRESLRECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPEN--TNIGMLFPIPA-ATDRDSGVNGVSSYELI-VGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQ---------ASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANP------------KTARTQVTITIRDTNDNKPVIEIRGFGLV---------THQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQL 450          

HSP 4 Score: 67.781 bits (164), Expect = 1.079e-10
Identity = 66/230 (28.70%), Postives = 94/230 (40.87%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTED---FVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQF---SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYS--FNLVAK--DFGQPPRSSTALVEVFV 1091
            NDN P F    Y   ++EN    S + +    DAD               EN  ++  +  E     + N    ++     DRE      F L AVDGG PPR     + + VLDEND  P     S + Y+    ++   G  +  +R ED D+G N ++  + AS       N F+L Q  H      + K     I K+     LV K  D G+P R  TALV  ++
Sbjct:  614 NDNDPKFMLNGYNFSVMENMPRLSPVGMVTVIDADK-------------GENAHIHLSVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKYLTPQTH-PGTPVNWVRAEDMDTGINAELDYSIASG------NPFELFQISHNNGEVTLEK---AIIRKHYGLHRLVVKVTDKGKPSRHGTALVHFYI 820          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 229.18 bits (583), Expect = 3.139e-61
Identity = 181/651 (27.80%), Postives = 304/651 (46.70%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFS-SPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            NDN+P F        I EN+ I S   +P+A D D  P GV SYE++   E  +++   + ED  + KQP LIV   +DRE  D  + T+   DGG PPR     + + VLD ND  P+F +  YE ++ E+   G  ++ ++  D D G N +I   F  +  + ++   +L +    + ++    +D E ++   F+++AKD G  P+S+ A V V V ++ND+ P I        ++ Q     I+E   ++  + LV+V+D D+ +  ++TC +          A +T +  +++K Y +++    D E    + + IV  D+ G   L  TN L+V + D+NDNAPVF+ S       + N+  E+V      + A+D D G N  + Y +       +  F+I    G ++    LD E+     +++ A D G P    +  ++VNV D NDN P+  LS Y+F + EN P  + VG V V D D   N +              L   Q  +  F I N +G I + +  DRE  S   F + A     +D G      +     + VT+N+LD+NDN+P +        + + P+    +T +                 D+D G N+++  ++   + + L
Sbjct:    1 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAED-QEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAP-EVVRRLLRLDRNTGLITVQ--GPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGL-VTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGS--DSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS-GNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVA----EVTASDADSGSNAELVYSL-EPEPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQ------------LSVEQ-DNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKA-----VDGGVPPRSAY-----VGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQ------------VTAEDIDSGINAELTYSIAGGNPYGL 603          

HSP 2 Score: 70.4774 bits (171), Expect = 1.134e-11
Identity = 59/223 (26.46%), Postives = 93/223 (41.70%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEP---QFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFV 1091
            NDN P F    Y   ++EN    S + +    D D          +E+ N +F           + N    ++     DRE      F L AVDGG PPR     + + VLDEND  P     S   + +   ++ + G  +  +  ED DSG N +++ + A      +   FQ+    H  A+ L  +++      +   +   D G+PPR  TALV ++V
Sbjct:  445 NDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDF----------VIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRL-GETVSQVTAEDIDSGINAELTYSIAGGNPYGL---FQIGS--HSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 651          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 227.639 bits (579), Expect = 6.780e-61
Identity = 181/651 (27.80%), Postives = 304/651 (46.70%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFS-SPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            NDN+P F        I EN+ I S   +P+A D D  P GV SYE++   E  +++   + ED  + KQP LIV   +DRE  D  + T+   DGG PPR     + + VLD ND  P+F +  YE ++ E+   G  ++ ++  D D G N +I   F  +  + ++   +L +    + ++    +D E ++   F+++AKD G  P+S+ A V V V ++ND+ P I        ++ Q     I+E   ++  + LV+V+D D+ +  ++TC +          A +T +  +++K Y +++    D E    + + IV  D+ G   L  TN L+V + D+NDNAPVF+ S       + N+  E+V      + A+D D G N  + Y +       +  F+I    G ++    LD E+     +++ A D G P    +  ++VNV D NDN P+  LS Y+F + EN P  + VG V V D D   N +              L   Q  +  F I N +G I + +  DRE  S   F + A     +D G      +     + VT+N+LD+NDN+P +        + + P+    +T +                 D+D G N+++  ++   + + L
Sbjct:  140 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAED-QEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAP-EVVRRLLRLDRNTGLITVQ--GPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGL-VTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGS--DSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS-GNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVA----EVTASDADSGSNAELVYSLEP-EPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQ------------LSVEQ-DNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKA-----VDGGVPPRSAY-----VGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQ------------VTAEDIDSGINAELTYSIAGGNPYGL 742          

HSP 2 Score: 88.1965 bits (217), Expect = 3.950e-17
Identity = 89/319 (27.90%), Postives = 141/319 (44.20%), Query Frame = 3
Query: 1446 EVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSI-------DKNTGVVKTILG-LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            ++ ++DINDN P F+SP     + EN    I ++   P LATD+D G NG   Y +     + +  F +       +K   ++  ++G LD E+     + I  +D G P R+SS  L V V DTNDN P+ +   Y  EL EN PIG  V +V   D D   N +      +           +   ++  +D  +G I  +  +DRE  S + F+++A      D G         +    V V + D NDN+P + ++    +  V  +      S  E++  E  V    +  D DEGEN+ V   +  +  F L
Sbjct:  133 QIEVQDINDNTPNFASPVITLAIPEN--TNIGSLFPIP-LATDRDAGPNGVASYEL-QAGPEAQELFGLQVAEDQEEKQPQLI--VMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQ---------APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAK-----DRGA-----TPKSARAQVVVTVKDMNDNAPTIEIRG---IGLVTHQDGMANIS--EDVAEETAVALVQVS-DRDEGENAAVTCVVAGDVPFQL 420          

HSP 3 Score: 70.0922 bits (170), Expect = 1.349e-11
Identity = 59/223 (26.46%), Postives = 93/223 (41.70%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEP---QFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFV 1091
            NDN P F    Y   ++EN    S + +    D D          +E+ N +F           + N    ++     DRE      F L AVDGG PPR     + + VLDEND  P     S   + +   ++ + G  +  +  ED DSG N +++ + A      +   FQ+    H  A+ L  +++      +   +   D G+PPR  TALV ++V
Sbjct:  584 NDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDF----------VIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRL-GETVSQVTAEDIDSGINAELTYSIAGGNPYGL---FQIGS--HSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 790          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh1 (protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692])

HSP 1 Score: 227.639 bits (579), Expect = 6.780e-61
Identity = 181/651 (27.80%), Postives = 304/651 (46.70%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFS-SPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            NDN+P F        I EN+ I S   +P+A D D  P GV SYE++   E  +++   + ED  + KQP LIV   +DRE  D  + T+   DGG PPR     + + VLD ND  P+F +  YE ++ E+   G  ++ ++  D D G N +I   F  +  + ++   +L +    + ++    +D E ++   F+++AKD G  P+S+ A V V V ++ND+ P I        ++ Q     I+E   ++  + LV+V+D D+ +  ++TC +          A +T +  +++K Y +++    D E    + + IV  D+ G   L  TN L+V + D+NDNAPVF+ S       + N+  E+V      + A+D D G N  + Y +       +  F+I    G ++    LD E+     +++ A D G P    +  ++VNV D NDN P+  LS Y+F + EN P  + VG V V D D   N +              L   Q  +  F I N +G I + +  DRE  S   F + A     +D G      +     + VT+N+LD+NDN+P +        + + P+    +T +                 D+D G N+++  ++   + + L
Sbjct:  140 NDNTPNFASPVITLAIPENTNIGSLFPIPLATDRDAGPNGVASYELQAGPEAQELFGLQVAED-QEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQAP-EVVRRLLRLDRNTGLITVQ--GPVDREDLSTLRFSVLAKDRGATPKSARAQVVVTVKDMNDNAPTIEIRGIGL-VTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGS--DSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS-GNPPLSSTNSLKVQVVDVNDNAPVFTQSITEVAFPENNKPGEVVA----EVTASDADSGSNAELVYSLEP-EPAAQGLFTISPENGEIRVKTSLDREQRDSYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQ------------LSVEQ-DNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKA-----VDGGVPPRSAY-----VGVTINVLDENDNAPFITAPSNTSHRLLTPQTRLGETVSQ------------VTAEDIDSGINAELTYSIAGGNPYGL 742          

HSP 2 Score: 88.1965 bits (217), Expect = 3.950e-17
Identity = 89/319 (27.90%), Postives = 141/319 (44.20%), Query Frame = 3
Query: 1446 EVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSI-------DKNTGVVKTILG-LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            ++ ++DINDN P F+SP     + EN    I ++   P LATD+D G NG   Y +     + +  F +       +K   ++  ++G LD E+     + I  +D G P R+SS  L V V DTNDN P+ +   Y  EL EN PIG  V +V   D D   N +      +           +   ++  +D  +G I  +  +DRE  S + F+++A      D G         +    V V + D NDN+P + ++    +  V  +      S  E++  E  V    +  D DEGEN+ V   +  +  F L
Sbjct:  133 QIEVQDINDNTPNFASPVITLAIPEN--TNIGSLFPIP-LATDRDAGPNGVASYEL-QAGPEAQELFGLQVAEDQEEKQPQLI--VMGNLDRERWDSYDLTIKVQDGGNPPRASSALLRVTVLDTNDNAPKFERPTYEAELSENSPIGHSVIQVKANDSDQGANAEIDYTFHQ---------APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAK-----DRGA-----TPKSARAQVVVTVKDMNDNAPTIEIRG---IGLVTHQDGMANIS--EDVAEETAVALVQVS-DRDEGENAAVTCVVAGDVPFQL 420          

HSP 3 Score: 70.0922 bits (170), Expect = 1.349e-11
Identity = 59/223 (26.46%), Postives = 93/223 (41.70%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEP---QFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFV 1091
            NDN P F    Y   ++EN    S + +    D D          +E+ N +F           + N    ++     DRE      F L AVDGG PPR     + + VLDEND  P     S   + +   ++ + G  +  +  ED DSG N +++ + A      +   FQ+    H  A+ L  +++      +   +   D G+PPR  TALV ++V
Sbjct:  584 NDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENARVQLSVEQDNGDF----------VIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPFITAPSNTSHRLLTPQTRL-GETVSQVTAEDIDSGINAELTYSIAGGNPYGL---FQIGS--HSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 790          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 207.223 bits (526), Expect = 5.166e-54
Identity = 200/702 (28.49%), Postives = 317/702 (45.16%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKL-MTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTM---KNNDYFSLTPDYGMLCAMEKLPP--IGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       I EN+ INSR  +P A D D    GV+ YE+     N    F L + E     K P LIV+  +DRE  D     +   DGG P +     + + V D ND  P F +   E+ I E+   G  ++ L   D D G+N +I   F +      +  F L+ T   + ++    LD E    +   ++A D    P  +T  V + VT+VND+PPNI       PI+     +Y++E    +  I L+ V+D D   +  + C IE  +  F+L A     V +N+   E  S +D++  TK   F  IV SD+ G   L QT  + V ++D NDN P+F+ P     V EN    +       I ATD+D G+N  + Y +        ++F +D+ TGV+      + E+ +     ++A+D G P   S   +IV V D NDN P+   + + F + EN P  + VG + VTD+D   N    +  + +             ++ F +D  SG I + V  DRE  S   F + A+     D G     Q   +    VT+N++D NDNSP+++         + P +S I  S    ++           VD+D G N++++ T+    N   F + P  G +   EK  P  +G ++ V+   D  +  +     L+ +++ +
Sbjct:  136 NDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELL----NGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQ--RSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPIN---GTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE-REVPFHLKA-----VYDNQYLLETSSLLDYEG-TKEFSF-KIVASDS-GKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT---ISATDEDSGKNADIVYQLG----PNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILND-------------NENFVLDPYSGVIKSNVSFDREQQSSYTFDVKAT-----DGG-----QPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVP-LSAIPGSVVAEVF----------AVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVND 776          

HSP 2 Score: 103.219 bits (256), Expect = 1.135e-21
Identity = 150/573 (26.18%), Postives = 237/573 (41.36%), Query Frame = 3
Query:  738 KTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKIS---INFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQ-YARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-----NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTIN-KDP-------ILATDKDEGENGTVEYYISNVVD-DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKN-NDYFSLTPDYGML 2399
            K KII+K  D ND  P F   +  I I E+ +           D D+G NG      +N  S    DI  T +  +      L +   LD E  + Y   +  +D G P +SSTA+++V V++VND          N+P+ K+    ++I E       +  +  TD D         I ++ E  Y+   +     +     N  T  I  +   DRE   +H V+++ SD    +       + + + D+NDN P     RY  I+    +N  V ++ KDP       I  +DKD   NG V  +I   V   +K  +    N  +++T   LDYE  K  S +I A D G P  + +  + V ++D NDN P  +       + EN   G Y+  ++ TD+D+  N   +            LG   P    F +D ++G +    V +RE   +  F + A      D G    +      + +V V +LD+NDNSP          K  +    F     +EN+ P+          D D GEN  V +++ N N+ F L P  G++
Sbjct:  127 KIKIIVK--DTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQ---LIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVND----------NRPVFKEGQVEVHIPENAPVGTSVIQLHATDAD---------IGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDG---SSTPARATVTINVTDVNDNPPNIDL-RY--IISP--INGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYD---NQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ----------LG---PNASFFDLDRKTGVLTASRVFNREEQERFIFTVTAR-----DNGTPPLQS-----QAAVIVTVLDENDNSP----------KFTHNHFQFF---VSENL-PKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVI 627          
BLAST of Protocadherin-1 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 207.223 bits (526), Expect = 5.166e-54
Identity = 200/702 (28.49%), Postives = 317/702 (45.16%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKL-MTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTM---KNNDYFSLTPDYGMLCAMEKLPP--IGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       I EN+ INSR  +P A D D    GV+ YE+     N    F L + E     K P LIV+  +DRE  D     +   DGG P +     + + V D ND  P F +   E+ I E+   G  ++ L   D D G+N +I   F +      +  F L+ T   + ++    LD E    +   ++A D    P  +T  V + VT+VND+PPNI       PI+     +Y++E    +  I L+ V+D D   +  + C IE  +  F+L A     V +N+   E  S +D++  TK   F  IV SD+ G   L QT  + V ++D NDN P+F+ P     V EN    +       I ATD+D G+N  + Y +        ++F +D+ TGV+      + E+ +     ++A+D G P   S   +IV V D NDN P+   + + F + EN P  + VG + VTD+D   N    +  + +             ++ F +D  SG I + V  DRE  S   F + A+     D G     Q   +    VT+N++D NDNSP+++         + P +S I  S    ++           VD+D G N++++ T+    N   F + P  G +   EK  P  +G ++ V+   D  +  +     L+ +++ +
Sbjct:  136 NDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELL----NGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQ--RSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPIN---GTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIE-REVPFHLKA-----VYDNQYLLETSSLLDYEG-TKEFSF-KIVASDS-GKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT---ISATDEDSGKNADIVYQLG----PNASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGVITVTDEDAGENKAVTLSILND-------------NENFVLDPYSGVIKSNVSFDREQQSSYTFDVKAT-----DGG-----QPPRSSTAKVTINVMDVNDNSPVVISPPSNTSFKLVP-LSAIPGSVVAEVF----------AVDIDTGMNAELKYTIVSGNNKGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYPKALHTLVLVFLYVND 776          

HSP 2 Score: 103.219 bits (256), Expect = 1.135e-21
Identity = 150/573 (26.18%), Postives = 237/573 (41.36%), Query Frame = 3
Query:  738 KTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKIS---INFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQ-YARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-----NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTIN-KDP-------ILATDKDEGENGTVEYYISNVVD-DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKN-NDYFSLTPDYGML 2399
            K KII+K  D ND  P F   +  I I E+ +           D D+G NG      +N  S    DI  T +  +      L +   LD E  + Y   +  +D G P +SSTA+++V V++VND          N+P+ K+    ++I E       +  +  TD D         I ++ E  Y+   +     +     N  T  I  +   DRE   +H V+++ SD    +       + + + D+NDN P     RY  I+    +N  V ++ KDP       I  +DKD   NG V  +I   V   +K  +    N  +++T   LDYE  K  S +I A D G P  + +  + V ++D NDN P  +       + EN   G Y+  ++ TD+D+  N   +            LG   P    F +D ++G +    V +RE   +  F + A      D G    +      + +V V +LD+NDNSP          K  +    F     +EN+ P+          D D GEN  V +++ N N+ F L P  G++
Sbjct:  127 KIKIIVK--DTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQ---LIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVND----------NRPVFKEGQVEVHIPENAPVGTSVIQLHATDAD---------IGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDG---SSTPARATVTINVTDVNDNPPNIDL-RY--IISP--INGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYD---NQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQ----------LG---PNASFFDLDRKTGVLTASRVFNREEQERFIFTVTAR-----DNGTPPLQS-----QAAVIVTVLDENDNSP----------KFTHNHFQFF---VSENL-PKYSTVGVITVTDEDAGENKAVTLSILNDNENFVLDPYSGVI 627          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 231.491 bits (589), Expect = 3.589e-61
Identity = 179/610 (29.34%), Postives = 292/610 (47.87%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFS-SPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKT 2255
            NDN+P F        I EN+ I S   +P+A D D  P GV SYE++   E  +++   + ED  + KQP LIV   +DRE  D  + T+   DGG PPR     + + VLD ND  P+F +  YE ++ E+   G  ++ ++  D D G N +I   F  +  + ++   +L +    + ++    +D E ++   F+++AKD G  P+S+ A V V V ++ND+ P I        ++ Q     I+E   ++  + LV+V+D D+ +  ++TC +          A +T +  +++K Y +++    D E    + + IV  D+ G   L  TN L+V + D+NDNAPVF+ S       + N+  E++      I A+D D G N  + Y +       K  F+I   TG ++    LD E+ +   +++ A D G P    +  ++VNV D NDN P+  LS Y+F + EN P  + VG V V D D   N +              L   Q  +  F I N +G I + +  DRE  S   F + A     +D G      +     + VT+N+LD+NDN+P +        K + P+    +T
Sbjct:  162 NDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAED-QEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAP-EVVRRLLRLDRNTGLITVQ--GPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGL-VTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGS--DSKKKYFLQTTTPLDYEKVKDYTIEIVAVDS-GNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIA----EITASDADSGSNAELVYSLEP-EPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQ------------LSVEQ-DNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKA-----VDGGVPPRSAY-----VGVTINVLDENDNAPYITAPSNTSHKLLTPQTRLGET 735          

HSP 2 Score: 141.739 bits (356), Expect = 7.589e-33
Identity = 160/567 (28.22%), Postives = 243/567 (42.86%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLS----QTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRE-TKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDP--------ILATDKDEGENGTVEYYISNVV------------DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK--NNDY 2369
            ++V D ND  P F+  +  + I E+   G         D+D+G NG  S    +    + Q  F L     Q      L ++  LD E  + Y   +  +D G PPR+S+AL+ V V + ND+ P     +F +P  +      ++E +     +  VK  D D  A++   EIE +   F+        +L  +R T  I  +   DRE   TL F S++  D  G N      ++ V +KD+NDNAP     R  G+V     + +  I++D         +  +D+DEGEN  V   ++  V            D  K YF        ++T   LDYEK+K  +IEI A D G P  SS+  L V V D NDN P    S       EN   G  + ++  +D D+  N + +      L P P       A  +FTI  E+G+I  K  LDRE        ++A+     D G    +        +V VN+LD NDN P  ML             +F        + P   VT     +D D+GEN++V+++++  N D+
Sbjct:  156 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGP--EAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAP-----KFERPSYE----AELSENSPIGHSVIQVKANDSDQGANA---EIEYT---FHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRF-SVLAKD-RGTNPKSARAQVVVTVKDMNDNAPTIEI-RGIGLVTHQ--DGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYF--------LQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYS----LEPEPA------AKGLFTISPETGEIQVKTSLDREQRESYELKVVAA-----DRGSPSLQG-----TATVLVNVLDCNDNDPKFMLSG----------YNFSVMENMPALSPVGMVTV----IDGDKGENAQVQLSVEQDNGDF 658          

HSP 3 Score: 88.9669 bits (219), Expect = 1.691e-16
Identity = 88/319 (27.59%), Postives = 142/319 (44.51%), Query Frame = 3
Query: 1446 EVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSI-------DKNTGVVKTILG-LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            ++ ++DINDN P F+SP     + EN    I ++   P LA+D+D G NG   Y +     + +  F +       +K   ++  ++G LD E+     + I  +D G P R+SS  L V V DTNDN P+ +   Y  EL EN PIG  V +V   D D   N +      +           +   ++  +D  +G I  +  +DRE  S + F+++A      D G +       +    V V + D NDN+P + ++    +  V  +      S  E++  E  V    +  D DEGEN+ V   +  +  F L
Sbjct:  155 QIEVQDINDNTPNFASPVITLAIPEN--TNIGSLFPIP-LASDRDAGPNGVASYEL-QAGPEAQELFGLQVAEDQEEKQPQLI--VMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQ---------APEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAK-----DRGTN-----PKSARAQVVVTVKDMNDNAPTIEIRG---IGLVTHQDGMANIS--EDVAEETAVALVQV-SDRDEGENAAVTCVVAGDVPFQL 442          

HSP 4 Score: 69.3218 bits (168), Expect = 1.624e-10
Identity = 59/223 (26.46%), Postives = 93/223 (41.70%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQF---SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFV 1091
            NDN P F    Y   ++EN    S + +    D D          +E+ N +F           + N    ++     DRE      F L AVDGG PPR     + + VLDEND  P     S   +++   ++ + G  +  +  ED DSG N ++  + A      +   FQ+    H  A+ L  +++      +   +   D G+PPR  TALV ++V
Sbjct:  606 NDNDPKFMLSGYNFSVMENMPALSPVGMVTVIDGDKGENAQVQLSVEQDNGDF----------VIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAPYITAPSNTSHKLLTPQTRL-GETVSQVAAEDFDSGVNAELIYSIAGGNPYGL---FQIGS--HSGAITLEKEIERRHHGLHRLVVKVSDRGKPPRYGTALVHLYV 812          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.433e-55
Identity = 209/701 (29.81%), Postives = 316/701 (45.08%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDD-NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVR---VTMKNNDYFSLTPDYGMLCAMEK--LPPIGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       I ENS INS+ +LP A D D    GV++YE+ K    F +    + E    +K P LIV+ ++DRE  D     +   DGG P R     + + V D ND  P F +   E+ I E+   G  +  L   D D G N KI  +F++  +   +  F L+ T   + +K    LD E    +   ++A D G  P  + A+V V VT+VND+ P+I       P++     + ++E    +  I L+ VTD D +    +TC  +  +  F L  + +N  L     Y        D E+   + + ++ +D  G   L Q+  L + +KD NDNAPVF+       + EN    I  +    + ATD D G N  + Y +     D    FS+D+ TG++  +  LD EK       I AKD GVP  +S+V + V++ D NDN P    + Y F + EN P    VG + VTD D   N+              TL      D  FTID+++G I   +  DRE      F + A         +D  R  R +    VT+N++D NDN P+ +      V   N     +  STN        V F  I VD D G N++VR   V     D F++  + G +  MEK  +  +G ++ ++ A D    +S     ++N+ + E
Sbjct:  165 NDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLD---VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIK--EPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTCFTD-HEIPFRLRPVFSNQFLLENAAY-------LDYESTKEYAIKLLAADA-GKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMK---VSATDADSGPNAEINYLLG---PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGLITVTDPDYGDNSAV------------TLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKA---------EDGGRVSRSS-SAKVTINVVDVNDNKPVFI------VPPYNYSYELVLPSTN-----PGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 806          

HSP 2 Score: 73.9442 bits (180), Expect = 7.794e-12
Identity = 79/267 (29.59%), Postives = 118/267 (44.19%), Query Frame = 3
Query: 1440 KLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILG-----------LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLK 2204
            K+  +I+DINDNAP+F +      + EN  +N   T+      A D D G NG   Y +       +N F +D    V++T  G           LD E+     +++  +D G P RSS+  L V+V DTNDN P    +     + EN P+GT V +++ TD D   N K        +        S  A ++F ++  +G I  K  LDRE +      ++AS     D G    R         V VN+ D NDN P + ++
Sbjct:  156 KIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPA----AVDPDVGINGVQNYELIK----SQNIFGLD----VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLV--------SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS-----DGGLMPARAM-------VLVNVTDVNDNVPSIDIR 390          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6WXV7|PC11X_PONPY (Protocadherin-11 X-linked OS=Pongo pygmaeus OX=9600 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.538e-55
Identity = 210/701 (29.96%), Postives = 315/701 (44.94%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDD-NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVR---VTMKNNDYFSLTPDYGMLCAMEK--LPPIGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       I ENS INS+ +LP A D D    GV++YE+ K    F +    + E    +K P LIV+ ++DRE  D     +   DGG P R     + + V D ND  P F +   E+ I E+   G  +  L   D D G N KI  +F++  +   +  F L+ T   + +K    LD E    +   ++A D G  P  + A+V V VT+VND+ P+I       PI+     + ++E    +  I L+ VTD D +    +TC     +  F L  + +N  L     Y        D E+   + + ++ +D  G   L Q+  L + +KD NDNAPVF+       + EN    I       + ATD D G N  + Y +     D    FS+D+ TG++  +  LD EK       I AKD GVP  +S+V + V++ D NDN P    + Y+F + EN P    VG + VTD D   N+              TL      D  FTID+++G I   +  DRE      F + A         +D  R  R +    VT+N++D NDN P+ +      V   N     +  STN        V F  I VD D G N++VR   V     D F++  + G +  MEK  +  +G ++ ++ A D    +S     ++N+ + E
Sbjct:  133 NDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLD---VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIK--EPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPINDT---VVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFLLETAAY-------LDYESTKEYAIKLLAADA-GKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTK---VSATDADSGPNAEINYLLG---PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAV------------TLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKA---------EDGGRVSRSS-SAKVTINVVDVNDNKPVFI------VPPSNYSYELVLPSTN-----PGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 774          

HSP 2 Score: 74.3294 bits (181), Expect = 6.002e-12
Identity = 79/267 (29.59%), Postives = 118/267 (44.19%), Query Frame = 3
Query: 1440 KLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILG-----------LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLK 2204
            K+  +I+DINDNAP+F +      + EN  +N   T+      A D D G NG   Y +       +N F +D    V++T  G           LD E+     +++  +D G P RSS+  L V+V DTNDN P    +     + EN P+GT V +++ TD D   N K        +        S  A ++F ++  +G I  K  LDRE +      ++AS     D G    R         V VN+ D NDN P + ++
Sbjct:  124 KIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPA----AVDPDVGINGVQNYELIK----SQNIFGLD----VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLV--------SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS-----DGGLMPARAM-------VLVNVTDVNDNVPSIDIR 358          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 214.927 bits (546), Expect = 1.786e-55
Identity = 209/701 (29.81%), Postives = 315/701 (44.94%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDD-NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVR---VTMKNNDYFSLTPDYGMLCAMEK--LPPIGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       I ENS INS+ +LP A D D    GV++YE+ K    F +    + E    +K P LIV+ ++DRE  D     +   DGG P R     + + V D ND  P F +   E+ I E+   G  +  L   D D G N KI  +F++  +   +  F L+ T   + +K    LD E    +   ++A D G  P  + A+V V VT+VND+ P+I       P++     + ++E    +  I L+ VTD D +    +TC     +  F L  + +N  L     Y        D E+   + + ++ +D  G   L Q+  L + +KD NDNAPVF+       + EN    I       + ATD D G N  + Y +     D    FS+D+ TG++  +  LD EK       I AKD GVP  +S+V + V++ D NDN P    + Y+F + EN P    VG + VTD D   N+              TL      D  FTID+++G I   +  DRE      F + A         +D  R  R +    VT+N++D NDN P+ +      V   N     +  STN        V F  I VD D G N++VR   V     D F++  + G +  MEK  +  +G ++ ++ A D    +S     ++N+ + E
Sbjct:  133 NDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNMFGLD---VIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIK--EPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTC-FTDHEIPFRLRPVFSNQFLLETAAY-------LDYESTKEYAIKLLAADA-GKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTK---VSATDADSGPNAEINYLLG---PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAV------------TLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKA---------EDGGRVSRSS-SAKVTINVVDVNDNKPVFI------VPPSNYSYELVLPSTN-----PGTVVFQVIAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 774          

HSP 2 Score: 75.8702 bits (185), Expect = 2.045e-12
Identity = 80/267 (29.96%), Postives = 118/267 (44.19%), Query Frame = 3
Query: 1440 KLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILG-----------LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLK 2204
            K+  +I+DINDNAP+F +      + EN  +N   T+      A D D G NG   Y +       +N F +D    V++T  G           LD EK     +++  +D G P RSS+  L V+V DTNDN P    +     + EN P+GT V +++ TD D   N K        +        S  A ++F ++  +G I  K  LDRE +      ++AS     D G    R         V VN+ D NDN P + ++
Sbjct:  124 KIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPA----AVDPDVGINGVQNYELIK----SQNMFGLD----VIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLV--------SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS-----DGGLMPARAM-------VLVNVTDVNDNVPSIDIR 358          
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Match: sp|Q6WYY1|PC11X_PANPA (Protocadherin-11 X-linked OS=Pan paniscus OX=9597 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 213.772 bits (543), Expect = 3.974e-55
Identity = 208/701 (29.67%), Postives = 316/701 (45.08%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDD-NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVR---VTMKNNDYFSLTPDYGMLCAMEK--LPPIGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       I ENS INS+ +LP A D D    GV++YE+ K    F +    + E    +K P LIV+ ++DRE  D     +   DGG P R     + + V D ND  P F +   E+ I E+   G  +  L   D D G N KI  +F++  +   +  F L+ T   + +K    LD E    +   ++A D G  P  + A+V V VT+VND+ P+I       P++     + ++E    +  I L+ VTD D +    +TC  +  +  F L  + +N  L     Y        D E+   + + ++ +D  G   L Q+  L + +KD NDNAPVF+       + EN    I       + ATD D G N  + Y +     D    FS+D+ TG++  +  LD EK       I AKD GVP  +S+V + V++ D NDN P    + Y+F + EN P    VG + VTD D   N+              TL      D  FTID+++G I   +  DRE      F + A         +D  R  R +    VT+N++D NDN P+ +      V   N     +  STN        V F  + VD D G N++VR   V     D F++  + G +  MEK  +  +G ++ ++ A D    +S     ++N+ + E
Sbjct:  133 NDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGTNGVQNYELIKSQNIFGLD---VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIK--EPLDREETPNHKLLVLASDGGLMP--ARAMVLVNVTDVNDNVPSIDIRYIVNPVNDT---VVLSENIPLNTKIALITVTDKDADHNGRVTCFTD-HEIPFRLRPVFSNQFLLETAAY-------LDYESTKEYAIKLLAADA-GKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTK---VSATDADSGPNAEINYLLG---PDAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGLITVTDPDYGDNSAV------------TLSILDENDD-FTIDSQTGVIRPNISFDREKQESYTFYVKA---------EDGGRVSRSS-SAKVTINVVDVNDNKPVFI------VPPSNYSYELVLPSTN-----PGTVVFQVMAVDNDTGMNAEVRYSIVGGNTRDLFAIDQETGNITLMEKCDVTDLGLHRVLVKANDLGQPDSLFSVVIVNLFVNE 774          

HSP 2 Score: 75.0998 bits (183), Expect = 3.640e-12
Identity = 79/267 (29.59%), Postives = 118/267 (44.19%), Query Frame = 3
Query: 1440 KLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILG-----------LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLK 2204
            K+  +I+DINDNAP+F +      + EN  +N   T+      A D D G NG   Y +       +N F +D    V++T  G           LD E+     +++  +D G P RSS+  L V+V DTNDN P    +     + EN P+GT V +++ TD D   N K        +        S  A ++F ++  +G I  K  LDRE +      ++AS     D G    R         V VN+ D NDN P + ++
Sbjct:  124 KIRFLIEDINDNAPLFPATVINISIPENSAINSKYTLPA----AVDPDVGTNGVQNYELIK----SQNIFGLD----VIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLV--------SNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLAS-----DGGLMPARAM-------VLVNVTDVNDNVPSIDIR 358          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A3R7JVJ3 (Protocadherin-9 (Fragment) OS=Clonorchis sinensis OX=79923 GN=PCDH9 PE=4 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 2.042e-93
Identity = 270/895 (30.17%), Postives = 416/895 (46.48%), Query Frame = 3
Query:  282 DREEYCSKSNKHQTYINSQ-CCGGQ---------------CCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPE----------KTYYKEIL--------ENSKINSRISLPMAYDADDLPFGVESYEIEKPNE-NFDVYFKLMTE--------------------------DFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKP-PRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQD-------IQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINE--GTT-----KDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVT-----------INKDPILATDKDEGENGTVEYYISNVVDDMK----------------------------NYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRS---SSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTM-------------EISVTVNILDKNDNSPMMMLKDKPQVKAVN---PEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAM-EKLPPIGDYKTVIVAED--GDFNNSRKQEFLINIH-IKEDPHTLNNKIRTS 2552
            DRE  C K    +    SQ CC  +               CC+++G+     +K   +I+I V D+NDN+P F             TY KEI+        E +  NS  +LPMA D D+   G   Y I    E  +  YF+L+                               D   P L+V   +DRE I      L+A D G+P  R    ++ + VLDEND  P F + +YE+++ E++  G+ LL+++  D DS NNG++ + F   +  D       ++   QL     GV L+L   LDYE    + F+LVA D G+ P SS+A + + V N+ND PP I F+   +P+   YAR+ + E  GT       D ++C V VTD D+  D I C +E+    F L  + T+ +++ RK YE+ +    DRE+     ++I C D +G ++L    +L + +KD+NDN P F   +Y+G V EN VN IV            I+ + I A D D G N  ++Y +   +++ K                            N F ID  TG ++T   LD EK K       A D   P  S   ++V++ + V+D NDN P +D   Y F++ EN P  + VG+++ TD D    N+R + ++++++       +  A Q+  I++ +G I T+ VLDRE   QIPF +IA N  P    + L    RD++             E SVTV + D+NDN+P+M+ +   +  +       V+ I  +TN  I    CV FPY F D D+  N +V V M+ N YF       ++C + +  PP G     I   D   D +   ++ F + +H I+E+P  L++K   S
Sbjct:  127 DRENICDKRMYPERMTVSQACCPLEFTAPAELSLTPTNYPCCVYLGVTVL--SKGTYFIRIDVGDVNDNAPFFTAVNSNTNRNFMSTYRKEIIGKVIISIPEGTPPNSWFALPMATDPDEGMNGAIRYSISTSGEERWAEYFRLLNNLKTASLPVNSTQVNVAWNNAGTTGHLSLGDYSGPGLMVLQTLDRESIADFNLRLVAADLGEPIGRSSTIQLQILVLDENDNAPVFEKTVYEVEVNENQ-AGIPLLYVKANDSDSDNNGRV-VYFMKPSRTDNTVSFDFLRTHIQLVPMNDGVTLRLSQPLDYERSPAFHFDLVAADQGRVPLSSSASILITVRNMNDHPPLIRFFLHGEPLEHDYARLSVTEHFGTVPKQSLHDNLLCHVHVTDADSNLDKIQCNVESGDRKFVLREVMTDQLVQRRKIYELIATTLLDRESTPTQLITIRCQDDDGPSRLVSQKQLHLTLKDVNDNPPKFLQEQYHGYVSENAVNAIVVFHLSNATWKDGIDSNVICAVDNDTGINANIQYLLQRWLEEEKVTKHGTENGSQIEDEKNSVLRYDHSQDANQFYIDPTTGQLRTRTALDCEKQKLYRFVAVAMDKAQPPESRYTATVRVTIEVRDENDNPPVMDKRHYVFKVKENLPRHSRVGQIHTTDADVSPENRRTVYELRDIV-------NINASQMLFIESHTGVIRTRKVLDREEIQQIPFVVIARNEFPYTTQQTL----RDSIQGHSNMNNSKFYDEASVTVEVEDENDNAPVMLPRGSDRQSSTTDGLSTVADITFNTNIKIQHSPCVEFPYYFADADDQSNGEVDVVMEPNPYFEFRLANTLICQISDSAPPAGQSNLRITVSDRPSDLSKVLRRRFTVRMHVIQEEPGGLSDKFEPS 1006          
BLAST of Protocadherin-1 vs. TrEMBL
Match: H2KTP1 (Protocadherin-9 OS=Clonorchis sinensis OX=79923 GN=CLF_105398 PE=4 SV=1)

HSP 1 Score: 332.028 bits (850), Expect = 1.335e-92
Identity = 269/895 (30.06%), Postives = 416/895 (46.48%), Query Frame = 3
Query:  282 DREEYCSKSNKHQTYINSQ-CCGGQ---------------CCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPE----------KTYYKEIL--------ENSKINSRISLPMAYDADDLPFGVESYEIEKPNE-NFDVYFKLMTE--------------------------DFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKP-PRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQD-------IQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINE--GTT-----KDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVT-----------INKDPILATDKDEGENGTVEYYISNVVDDMK----------------------------NYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRS---SSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTM-------------EISVTVNILDKNDNSPMMMLKDKPQVKAVN---PEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAM-EKLPPIGDYKTVIVAED--GDFNNSRKQEFLINIH-IKEDPHTLNNKIRTS 2552
            DRE  C K    +    SQ CC  +               CC+++G+     +K   +I+I V D+NDN+P F             TY KEI+        E +  NS  +LPMA D D+   G   Y I    E  +  YF+L+                               D   P L+V   +DRE I      L+A D G+P  R    ++ + VLDEND  P F + +YE+++ E++  G+ LL+++  D DS NNG++ + F   +  D       ++   QL     GV L+L   LDYE    + F+LVA D G+ P SS+A + + V N+ND PP I F+   +P+   YAR+ + E  GT       D ++C V VTD D+  D I C +E+    F L  + T+ +++ RK YE+ +    DRE+     ++I C D +G ++L    +L + +KD+NDN P F   +Y+G V EN VN IV            I+ + I A D D G N  ++Y +   +++ K                            N F ID  TG ++T   LD EK K       A D   P  S   ++V++ + V+D NDN P +D   + F++ EN P  + VG+++ TD D    N+R + ++++++       +  A Q+  I++ +G I T+ VLDRE   QIPF +IA N  P    + L    RD++             E SVTV + D+NDN+P+M+ +   +  +       V+ I  +TN  I    CV FPY F D D+  N +V V M+ N YF       ++C + +  PP G     I   D   D +   ++ F + +H I+E+P  L++K   S
Sbjct:  127 DRENICDKRMYPERMTVSQACCPLEFTAPAELSLTPTNYPCCVYLGVTVL--SKGTYFIRIDVGDVNDNAPFFTAVNSNTNRNFMSTYRKEIIGKVIISIPEGTPPNSWFALPMATDPDEGMNGAIRYSISTSGEERWAEYFRLLNNLKTASLPVNSTQVNVAWNNAGTTGHLSLGDYSGPGLMVLQTLDRESIADFNLRLVAADLGEPIGRSSTIQLQILVLDENDNAPVFEKTVYEVEVNENQ-AGIPLLYVKANDSDSDNNGRV-VYFMKPSRTDNTVSFDFLRTHIQLVPMNDGVTLRLSQPLDYERSPAFHFDLVAADQGRVPLSSSASILITVRNMNDHPPLIRFFLHGEPLEHDYARLSVTEHFGTVPKQSLHDNLLCHVHVTDADSNLDKIQCNVESGDRKFVLREVMTDQLVQRRKIYELIATTLLDRESTPTQLITIRCQDDDGPSRLVSQKQLHLTLKDVNDNPPKFLQEQYHGYVSENAVNAIVVFHLSNATWKDGIDSNVICAVDNDTGINANIQYLLQRWLEEEKVTKHGTENGSQIEDEKNSVLRYDHSQDANQFYIDPTTGQLRTRTALDCEKQKLYRFVAVAMDKAQPPESRYTATVRVTIEVRDENDNPPVMDKRHHVFKVKENLPRHSRVGQIHTTDADVSPENRRTVYELRDIV-------NINASQMLFIESHTGVIRTRKVLDREEIQQIPFVVIARNEFPYTTQQTL----RDSIQGHSNMNNSKFYDEASVTVEVEDENDNAPVMLPRGSDRQSSTTDGLSTVADITFNTNIKIQHSPCVEFPYYFADADDQSNGEVDVVMEPNPYFEFRLANTLICQISDSAPPAGQSNLRITVSDRPSDLSKVLRRRFTVRMHVIQEEPGGLSDKFEPS 1006          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A183AF39 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS5574 PE=4 SV=1)

HSP 1 Score: 333.954 bits (855), Expect = 2.284e-92
Identity = 263/904 (29.09%), Postives = 435/904 (48.12%), Query Frame = 3
Query:  276 PIDREEYCSKS-NKHQTYINSQCCGGQ---------------CCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKT-------YYKEILENSKIN--------SRISLPMAYDADDLPFGVESYEIEKPNEN--FDVYFKLM-------------TEDFVDNKQ-------------PILIVKHQIDREFIDRIEFTLIAVDGGKPPR-KGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKIS-----------INFASSTNQDIQNT-FQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINE-----GTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTIN--------KDP---ILATDKDEGENGTVEY-------------------------------------------------YISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRS---SSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLD---YGKDLFRQFRDTM---EISVTVNILDKNDNSPMMMLKDKPQV-----KAVNPEVSFI--KTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLC-AMEKLPPIGDYKTVIVAEDGDFNNSR--KQEFLINIHIKED 2519
            P+DRE+ CS +    +  + S CC                  CC+F+GI  +  TK    ++I+++D+NDN+P F  +        Y+  IL  + I         S I +P A D D+ P G   Y +E  +EN  +  YF+L+             +  F+ N Q             P L++ H +DRE I    F L+A D G P +      I + VLDEND  P F +  Y+++I+E++  G+ L+H +V+D D  NNG++S           +   S+ + D   T  QL     GV L++   LDYE   +++F+L+A D GQPP S+TA V V V NVND PP I FY   +P+ + YAR+ + E      +  + +IC V VTD D+  +SI+C +E+++ +F+L  + TN +++  K YE+ +    DRE      + + C D +  N L   N+L++I+ D+ND+APVF+   Y+G+V EN  N +V+ +        + P   + A D D G N  + Y                                                 ++ N  +D + ++ ID+ TG ++T + LD E+ +     + A D    + S   ++ K+ V V+D NDN P ++   Y+F + E  P  T +G++   D D    N+R + ++KN+        +    +   I+  +G + T+ VLDRE++SQI F ++A N  P++    GK   +  +      E+SVTV + D+NDN P+++ +  P +     + + P V  +  + STNE   P  C+ FPY FVD DEG N ++ V ++NN++F    D  +LC    + P +G     I  +D   + ++  K+++ I +   ED
Sbjct:  106 PLDREQLCSFALQPERVQLASTCCSKSFDLPADVVMATINQPCCIFLGITIS--TKGTHVLRIQIIDVNDNAPRFNVQLRATNDLPYFANILGKNVIGISESVPPGSWIPIPAAIDNDEGPNGAVRYVLEPLSENLLWTEYFRLINNIRAAGLHANSTSAPFMINDQRKSKSFEPNDYTGPGLLILHPLDREKISSFGFRLVANDLGIPVQLSSSVNIRIVVLDENDNAPTFEKSDYQVQIRENQ-AGVSLVHAKVQDADVDNNGRLSYFMQPTRLDPTMPATSAVSADFLRTHIQLVPVNDGVTLRVSQPLDYEKQPEFTFDLIAVDHGQPPLSATAHVHVSVINVNDYPPMIRFYYHGEPLDRDYARLSVLEQHDSSTSVDNQLICHVHVTDADSDFESISCTVESTERNFFLREVTTNRLIQRSKIYELLTTTKLDREGNARLLILVRCQDGKMANSLASQNQLQLILLDVNDHAPVFTQDHYHGVVPENAANTLVSFSDSGLPSPGQSPTNDVHARDADSGMNALIFYSIVPWSISSSDSDESDSDKSKNSINTTRSTAVQPDRLTNTKSSNSSNHTFLHNPREDAEKFY-IDQTTGQIRTRVALDCEEQQIYRFLVLAIDQAEQLSSRYTATAKVTVTVRDENDNPPVIEQRHYTFAVREGLPRHTRIGQIQSVDADIGSENRRTVYELKNV-------ENFNGSEFILIEAHTGYVRTRQVLDREVTSQISFIVLARNEQPVEEVFRGKQTIQTEKGPTFFDEVSVTVTVEDENDNVPILVRRVPPTLARLLTRELAPSVIDLTFRLSTNETSSP--CIEFPYEFVDDDEGPNGEIEVLLENNNFFEFRLDNSLLCKTTGEQPTMGQMNLFITLQDKPVDKTKTLKRQYTIRVRFIED 996          

HSP 2 Score: 67.0106 bits (162), Expect = 3.207e-7
Identity = 97/378 (25.66%), Postives = 146/378 (38.62%), Query Frame = 3
Query: 1320 NRKTYEIKSKIDFDRET--------KTLHFVSIVCSDT---------EGINQ-----------LKQTNKLEVIIKDINDNAPVFSS--------PRYYGIVKENRVN---EIVTINKDPI-LATDKDEGENGTVEYYISNVVDDM--KNYFSIDKN-------------------------------TGVVKTILG-LDYEKIKHVSIEISAKDLGVPVR-SSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTID-----------NESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMM 2195
            NR+ Y++ S +  DRE         + +   S  CS +           INQ            K T+ L + I D+NDNAP F+         P +  I+ +N +     +   +  PI  A D DEG NG V Y +  + +++    YF +  N                               TG    IL  LD EKI      + A DLG+PV+ SSSV + + V D NDN P  + S Y  ++ EN+  G  +    V D D D N +         L  PT+    PA    + D           N+   +     LD E   +  F +IA     +D+G+        +    V V++++ ND  PM+
Sbjct:   95 NRRWYQLVSTVPLDREQLCSFALQPERVQLASTCCSKSFDLPADVVMATINQPCCIFLGITISTKGTHVLRIQIIDVNDNAPRFNVQLRATNDLPYFANILGKNVIGISESVPPGSWIPIPAAIDNDEGPNGAVRYVLEPLSENLLWTEYFRLINNIRAAGLHANSTSAPFMINDQRKSKSFEPNDYTGPGLLILHPLDREKISSFGFRLVANDLGIPVQLSSSVNIRIVVLDENDNAPTFEKSDYQVQIRENQ-AGVSLVHAKVQDADVDNNGRLSYFMQPTRL-DPTM----PATSAVSADFLRTHIQLVPVNDGVTLRVSQPLDYEKQPEFTFDLIA-----VDHGQPPL-----SATAHVHVSVINVNDYPPMI 456          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A4S2LR15 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005458 PE=4 SV=1)

HSP 1 Score: 323.168 bits (827), Expect = 2.261e-89
Identity = 262/881 (29.74%), Postives = 408/881 (46.31%), Query Frame = 3
Query:  282 DREEYCSKSNKHQTYINSQ-CCGGQ---------------CCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPE----------KTYYKEIL--------ENSKINSRISLPMAYDADDLPFGVESYEIEK-PNENFDVYFKLMTE--------------------------DFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKP-PRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQD-------IQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINE--GTT-----KDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVT-----------INKDPILATDKDEGENGTVEYYISNVVDDMK----------------------------NYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRS---SSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASN--PNPLDYG-KDLFR--------QFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVN---PEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAM-EKLPPIGDYKTVIVAED--GDFNNSRKQEFLINIHIKED 2519
            DRE  C K    +    SQ CC  +               CC+++G+     +K   +I+I V D+NDN+P F             TY KEI+        E +  NS  +LPMA D D+   G   Y I     E +  YF+L+                               D   P  +V   +DRE I      L+A D G+P  R    ++ + VLDEND  P F + +YE+++ E++  G+ LL+++  D DS NNG++ + F   +  D       ++   QL     GV L+L   LDYE    + F+LVA D G+ P SS+  + + V NVND PP I F+   +P+ + YAR+ + E  GT       D ++C V VTD D+  D I C +E+    F L  + T+ +++ RK YE+ +    DRE+     ++I C D +G ++L    +L + +KD+NDN P F   +Y+G V EN VN IV            I+   I A D D G N  ++Y +   ++D +                              F ID  +G ++T   LD EK K       A D   P  S   ++VK+ + V+D NDN P ++   Y F++ EN P  + VG++  TD D    N+R + ++++++       +  A Q+  I++ +G I T+ VLDRE   QIPF +IA N  PN +    +D  R        +F D  E SVTV + D+NDN+P+M+ +   +  +       V+ I  +TN  +    CV FPY F D D+  N +V V M+ N YF       ++C + +  PP+G     I   D   D +   ++ F + +H+ ++
Sbjct:  149 DRESICDKRLYPERMTVSQTCCPLEFTAPEELSLTPTNYPCCVYLGVTVL--SKGTYFIRIDVGDVNDNAPFFSATNSNTNRNFMSTYRKEIIGKVIISIPEGTPPNSWFALPMATDPDEGMNGAIRYSISTIGEERWAEYFRLLNNLKTASLPVNSTQVNVAWNNAGMTSHLSLGDYSGPGFMVLQTLDRESIADFSLRLVAADLGEPIARSSVIQLQILVLDENDNAPVFEKAVYEVEVNENQ-AGIPLLYVKANDSDSDNNGRV-VYFMKPSRTDNTVSFDFLRTHIQLVPMNDGVTLRLSQPLDYERSPAFHFDLVAADQGRVPLSSSTSILITVKNVNDHPPLIRFFLHGEPLEQDYARLSVTEHFGTVPKQSLHDNLLCHVHVTDADSNLDKIQCNVESGDRKFVLREVMTDQLVQRRKIYELTTTTLLDRESTPTQLITIRCQDDDGPSRLVSQKQLHLTLKDVNDNPPKFIQEQYHGYVFENAVNAIVVLHLSNATWKDGIDSSVICAVDNDTGINANIQYSLQRWLEDEEVTKLGTENGSQTEEEKNSILRYDHSQDATQFYIDPTSGQLRTRTALDCEKQKLYRFVAIAMDKAQPPESRYTTTVKVTIEVRDENDNPPVIEKRHYVFKVKENLPRHSRVGQIQTTDADVSPENRRTVYELRDIV-------NINASQMLFIESHTGVIRTRKVLDREEIQQIPFMVIARNEFPNTMQQTLRDSIRVHSNMNNSKFYD--EASVTVEVEDENDNAPVMLARGSDRQSSTTDGLSTVADITFNTNIKVQQSPCVEFPYYFADADDKSNGEVDVVMEPNPYFEFRLANTLICQISDSAPPVGQSNLRITVSDCPSDLSKVLRRRFTVRVHVIQE 1016          
BLAST of Protocadherin-1 vs. TrEMBL
Match: A0A4S2LR01 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_005458 PE=4 SV=1)

HSP 1 Score: 323.553 bits (828), Expect = 5.763e-89
Identity = 262/881 (29.74%), Postives = 408/881 (46.31%), Query Frame = 3
Query:  282 DREEYCSKSNKHQTYINSQ-CCGGQ---------------CCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPE----------KTYYKEIL--------ENSKINSRISLPMAYDADDLPFGVESYEIEK-PNENFDVYFKLMTE--------------------------DFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKP-PRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQD-------IQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINE--GTT-----KDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVT-----------INKDPILATDKDEGENGTVEYYISNVVDDMK----------------------------NYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRS---SSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASN--PNPLDYG-KDLFR--------QFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVN---PEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAM-EKLPPIGDYKTVIVAED--GDFNNSRKQEFLINIHIKED 2519
            DRE  C K    +    SQ CC  +               CC+++G+     +K   +I+I V D+NDN+P F             TY KEI+        E +  NS  +LPMA D D+   G   Y I     E +  YF+L+                               D   P  +V   +DRE I      L+A D G+P  R    ++ + VLDEND  P F + +YE+++ E++  G+ LL+++  D DS NNG++ + F   +  D       ++   QL     GV L+L   LDYE    + F+LVA D G+ P SS+  + + V NVND PP I F+   +P+ + YAR+ + E  GT       D ++C V VTD D+  D I C +E+    F L  + T+ +++ RK YE+ +    DRE+     ++I C D +G ++L    +L + +KD+NDN P F   +Y+G V EN VN IV            I+   I A D D G N  ++Y +   ++D +                              F ID  +G ++T   LD EK K       A D   P  S   ++VK+ + V+D NDN P ++   Y F++ EN P  + VG++  TD D    N+R + ++++++       +  A Q+  I++ +G I T+ VLDRE   QIPF +IA N  PN +    +D  R        +F D  E SVTV + D+NDN+P+M+ +   +  +       V+ I  +TN  +    CV FPY F D D+  N +V V M+ N YF       ++C + +  PP+G     I   D   D +   ++ F + +H+ ++
Sbjct:  127 DRESICDKRLYPERMTVSQTCCPLEFTAPEELSLTPTNYPCCVYLGVTVL--SKGTYFIRIDVGDVNDNAPFFSATNSNTNRNFMSTYRKEIIGKVIISIPEGTPPNSWFALPMATDPDEGMNGAIRYSISTIGEERWAEYFRLLNNLKTASLPVNSTQVNVAWNNAGMTSHLSLGDYSGPGFMVLQTLDRESIADFSLRLVAADLGEPIARSSVIQLQILVLDENDNAPVFEKAVYEVEVNENQ-AGIPLLYVKANDSDSDNNGRV-VYFMKPSRTDNTVSFDFLRTHIQLVPMNDGVTLRLSQPLDYERSPAFHFDLVAADQGRVPLSSSTSILITVKNVNDHPPLIRFFLHGEPLEQDYARLSVTEHFGTVPKQSLHDNLLCHVHVTDADSNLDKIQCNVESGDRKFVLREVMTDQLVQRRKIYELTTTTLLDRESTPTQLITIRCQDDDGPSRLVSQKQLHLTLKDVNDNPPKFIQEQYHGYVFENAVNAIVVLHLSNATWKDGIDSSVICAVDNDTGINANIQYSLQRWLEDEEVTKLGTENGSQTEEEKNSILRYDHSQDATQFYIDPTSGQLRTRTALDCEKQKLYRFVAIAMDKAQPPESRYTTTVKVTIEVRDENDNPPVIEKRHYVFKVKENLPRHSRVGQIQTTDADVSPENRRTVYELRDIV-------NINASQMLFIESHTGVIRTRKVLDREEIQQIPFMVIARNEFPNTMQQTLRDSIRVHSNMNNSKFYD--EASVTVEVEDENDNAPVMLARGSDRQSSTTDGLSTVADITFNTNIKVQQSPCVEFPYYFADADDKSNGEVDVVMEPNPYFEFRLANTLICQISDSAPPVGQSNLRITVSDCPSDLSKVLRRRFTVRVHVIQE 994          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 229.18 bits (583), Expect = 1.363e-61
Identity = 195/702 (27.78%), Postives = 324/702 (46.15%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFN-KPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRY-YGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVD-DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKN---NDYFSLTPDYGMLCAMEKLP-PIGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       + EN+ + +  ++P A D D    GV  Y++    E     F L   +    K P LIV   +DRE  D  + T+ AVDGG P R     + + + D ND  PQF +  YE ++ E+   G  +L ++  D D G NG+I      +++  +    Q+ ++   +++K    LD E I+ + F+++A+D G  P+SST  V + VT+ ND+ P +       +  S   A   I+E       + LV+V+D D   +++   +      F L     ++V +N+K Y +++    D E    + V IV  D+ G   L  TN L V + D NDN+P+FS P +     +EN+  E V      ++A D D G N  + Y I  + D   +  F ID ++G V+    LD E  +     ++A D GVP    +  +++ V D NDN P+  LS YSF + EN P  + VG V V D D   N +  +         P +G        F + N +G I + +  DRE  S   F + A     +D G+     +     + VT+N+LD+NDN+P++        + ++P  +    S  E +  E          D+D G N+++  ++     ++ F ++P  G +   ++L    G    ++V        SR    L++I++ E
Sbjct:  125 NDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEA-SALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP-VPKMLQIERSTGIISVK--GPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVAN--ISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSV-DNKKKYFLQTTTPLDYERIRDYRVEIVAVDS-GNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVL----DVIALDADSGTNAELVYSI--IADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVE------PDVGN-------FVVQNGTGTILSSISFDREKESSYTFRLKA-----VDGGEPPRSSY-----VGVTINVLDENDNAPVVTKPSNSSFRRLSPLAA--PDSVVEVVEAE----------DIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNE 777          

HSP 2 Score: 126.716 bits (317), Expect = 4.065e-29
Identity = 148/558 (26.52%), Postives = 235/558 (42.11%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLI--SKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILAT--------DKDEGENGTVEYYIS------------NVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK 2357
            ++V D ND  PQF   +  + ++E+   G      +  D+D+  NG +  + ++        + Q++        +LI    LD E  + Y   + A D G P R S+AL+ V +T+ ND+ P     QF K  S   A   ++E +     +  VK  D D   +    EIE    + +  +     +L+  R T  I  K   DRE  +     ++  D +G +    T  + + + D NDNAP        GI      + +  I++D  + T        DKDEGEN  V   ++            + VD+ K YF        ++T   LDYE+I+   +EI A D G P  SS+  L V V DTNDN P      +  E  E    G  V  V   D D+  N + +           ++        +F ID  SG++  +  LDRE   +  F + A+     D G    R        +V + +LD+NDN P  ML             SF   S  EN+ P + V    +  D+D+GEN++V+++++
Sbjct:  119 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAP-----QFEK--SSYEAE--VSENSPVGYSVLQVKANDSDLGPNG---EIEY---TIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARD-KGPSPKSSTTYVSIEVTDQNDNAPAV---EIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYF--------LQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVY----------SIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAA-----DKGVPSHRG-----TATVVIKVLDRNDNDPKFMLS----------SYSF---SVLENMPPLSPVGMVTVL-DMDKGENAQVQLSVE 615          

HSP 3 Score: 88.9669 bits (219), Expect = 1.707e-17
Identity = 104/369 (28.18%), Postives = 156/369 (42.28%), Query Frame = 3
Query: 1326 KTYEI-KSKIDFDRET-------KTLHFVSIVCSDTEGI-NQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSI----DKNTGVVKTI-LG-LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTP 2384
            KT EI  ++I  DRET           F+    S T+ I NQ  +  +  + ++DINDN P F SP     V+EN  +     I +    ATD+D   NG ++Y +S    +    FS+    D+   + + I LG LD E      + I+A D G P R SS  L V + D NDN P+ + S Y  E+ EN P+G  V +V   D D   N +      +          S P  ++  I+  +G I  K  LDRE  S   F +IA +  P       +          V++ + D+NDN+P +      +++ +         +      P           D DEGEN+ V   +  +  F L P
Sbjct:   69 KTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQ----ATDRDTERNGVLKYDLS-AGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQ---------ASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTY----------VSIEVTDQNDNAPAV------EIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRP 407          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 230.335 bits (586), Expect = 1.541e-61
Identity = 195/702 (27.78%), Postives = 324/702 (46.15%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFN-KPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRY-YGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVD-DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKN---NDYFSLTPDYGMLCAMEKLP-PIGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       + EN+ + +  ++P A D D    GV  Y++    E     F L   +    K P LIV   +DRE  D  + T+ AVDGG P R     + + + D ND  PQF +  YE ++ E+   G  +L ++  D D G NG+I      +++  +    Q+ ++   +++K    LD E I+ + F+++A+D G  P+SST  V + VT+ ND+ P +       +  S   A   I+E       + LV+V+D D   +++   +      F L     ++V +N+K Y +++    D E    + V IV  D+ G   L  TN L V + D NDN+P+FS P +     +EN+  E V      ++A D D G N  + Y I  + D   +  F ID ++G V+    LD E  +     ++A D GVP    +  +++ V D NDN P+  LS YSF + EN P  + VG V V D D   N +  +         P +G        F + N +G I + +  DRE  S   F + A     +D G+     +     + VT+N+LD+NDN+P++        + ++P  +    S  E +  E          D+D G N+++  ++     ++ F ++P  G +   ++L    G    ++V        SR    L++I++ E
Sbjct:  161 NDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPE-ASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDP-VPKMLQIERSTGIISVK--GPLDREEISSFKFHVIARDKGPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVAN--ISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSV-DNKKKYFLQTTTPLDYERIRDYRVEIVAVDS-GNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVL----DVIALDADSGTNAELVYSI--IADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGMVTVLDMDKGENAQVQLSVE------PDVGN-------FVVQNGTGTILSSISFDREKESSYTFRLKA-----VDGGEPPRSSY-----VGVTINVLDENDNAPVVTKPSNSSFRRLSPLAA--PDSVVEVVEAE----------DIDYGSNAELVYSIAGGNPHELFYISPSDGEIKLTKELTRKHGGLHRLVVKVSDRGKPSRHAIALVHIYVNE 813          

HSP 2 Score: 129.028 bits (323), Expect = 1.010e-29
Identity = 147/558 (26.34%), Postives = 234/558 (41.94%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLI--SKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILAT--------DKDEGENGTVEYYIS------------NVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK 2357
            ++V D ND  PQF   +  + ++E+   G      +  D+D+  NG +  + ++        + Q++        +LI    LD E  + Y   + A D G P R S+AL+ V +T+ ND+ P     QF K     Y    ++E +     +  VK  D D   +    EIE    + +  +     +L+  R T  I  K   DRE  +     ++  D +G +    T  + + + D NDNAP        GI      + +  I++D  + T        DKDEGEN  V   ++            + VD+ K YF        ++T   LDYE+I+   +EI A D G P  SS+  L V V DTNDN P      +  E  E    G  V  V   D D+  N + +           ++        +F ID  SG++  +  LDRE   +  F + A+     D G    R        +V + +LD+NDN P  ML             SF   S  EN+ P + V      +D+D+GEN++V+++++
Sbjct:  155 IEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTERNGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAP-----QFEK---SSY-EAEVSENSPVGYSVLQVKANDSDLGPNG---EIEY---TIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARD-KGPSPKSSTTYVSIEVTDQNDNAPAV---EIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPAGDSSVDNKKKYF--------LQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEKVLDVIALDADSGTNAELVY----------SIIADSSTRGLFEIDPSSGEVRARSPLDREHKERYEFRVTAA-----DKGVPSHRG-----TATVVIKVLDRNDNDPKFMLS----------SYSF---SVLENMPPLSPVGM-VTVLDMDKGENAQVQLSVE 651          

HSP 3 Score: 90.5077 bits (223), Expect = 6.593e-18
Identity = 108/374 (28.88%), Postives = 164/374 (43.85%), Query Frame = 3
Query: 1326 KTYEI-KSKIDFDRET-------KTLHFVSIVCSDTEGI-NQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSI----DKNTGVVKTI-LG-LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTN--ENIYPENCVTFPYIFV---DLDEGENSKVRVTMKNNDYFSLTP 2384
            KT EI  ++I  DRET           F+    S T+ I NQ  +  +  + ++DINDN P F SP     V+EN  +     I +    ATD+D   NG ++Y +S    +    FS+    D+   + + I LG LD E      + I+A D G P R SS  L V + D NDN P+ + S Y  E+ EN P+G  V +V   D D   N +      +          S P  ++  I+  +G I  K  LDRE  S   F +IA +  P       +          V++ + D+NDN+P +      +++ +      ++T ++   NI  +  V      V   D DEGEN+ V   +  +  F L P
Sbjct:  105 KTGEIFTTEIPIDRETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQ----ATDRDTERNGVLKYDLS-AGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQ---------ASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDKGPSPKSSTTY----------VSIEVTDQNDNAPAV------EIRGIG-----LRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRP 443          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 225.328 bits (573), Expect = 3.616e-60
Identity = 178/608 (29.28%), Postives = 288/608 (47.37%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVA-LKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGI--VKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDM-KNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVS 2243
            NDN+P FP       I EN+ + +  S+P+A D D    G+  Y++   ++  ++ F L   D  D K P LIV   +DRE  D  + ++  +DGG PPR     + + + D ND  P+F +  YE ++ E+   G  +L ++  D D G NG+++ +F    +Q   N  +L    H    +++   +D E +    F++ A+D G   +SS A+V + V + ND+ P+I    F   ++ +     ++E       + LV+V+D D   +++   +      F L +   +     RK Y +++    D E    + + IV  D+ G   L  TN L+V + D+NDNAPVF SP  Y +   +EN+  + V      ++ATD D G N  + Y I  + D   K  F I+ NTG V+ +  LD E  +     + A D GVP    +  ++V V D NDN P+  L+ YSF + EN P  + VG V V D D   N    +             + +P +  F I N +G I + +  DRE  S   F + A +      G D  R    +  + +T+N+LD+NDN+P +        K + P  S
Sbjct:  137 NDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNL-FSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSF----HQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGL-VAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRK-YFLQTTTPLDYERIKEYRIEIVAVDS-GNPALSSTNSLKVQVTDMNDNAPVF-SPSLYEVDFAEENQPGDKVL----DVVATDADSGTNAELLYSI--ITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQL-------------SVEPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVD------GGDPPR----SSYVGITINVLDENDNAPYVTKPSNSSYKFLQPLTS 706          

HSP 2 Score: 134.806 bits (338), Expect = 1.422e-31
Identity = 159/564 (28.19%), Postives = 238/564 (42.20%), Query Frame = 3
Query:  717 GKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLS---QTLHGVA-LKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILAT--------DKDEGENGTVEYYISNVVDDMKNYFSIDKNTG----VVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK 2357
            G  PR  + +I  ++ DEND  PQF   I E+ I E+   G         DKD+G+NG    ++  ++  D  N F L     T   V  L ++  LD E  + Y  ++   D G PPR S+AL+ + +T+ ND+ P      +   ++         E T     +  VK  DDD  A+           SF+  +     +L  +  T  I+ K   DRE   L   S+   D  G         + + +KD NDNAP     R +G+V     + I  +++D  + T        DKDEGEN  V   ++  V       S   +T      ++T   LDYE+IK   IEI A D G P  SS+  L V V D NDN P    S Y  +  E    G  V  V  TD D+  N + +           ++ T      +F I+  +G++     LDRE   +  F + A+     D G    +        +V V +LD+NDN P  ML             SF   S  EN+ P + V      +D D+GEN+ V+++++
Sbjct:  121 GSGPRLIEGRI--EIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGI--ADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMA---------ENTPVGQSVLQVKANDDDLGANGQVT------YSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDN-GPQAKSSKAMVTITVKDRNDNAPSIRI-RGFGLVAHE--DGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLY----------SIITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAA-----DKGVPSLKG-----TATVVVRVLDRNDNDPKFMLNG----------YSF---SVLENMPPLSPVGM-VTVIDADKGENAHVQLSVE 627          

HSP 3 Score: 62.003 bits (149), Expect = 3.303e-9
Identity = 67/230 (29.13%), Postives = 91/230 (39.57%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELL--------HLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAK--DFGQPPRSSTALVEVFV 1091
            NDN P F    Y   +LEN    S + +    DAD          +E  N  F           + N    ++     DRE      F L AVDGG PPR     I + VLDEND  P      Y  K   S    L+ L         +  ED D+G N ++     S T  +    F++S T   + L       +  +++    LV K  D G+P R +TALV +FV
Sbjct:  581 NDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPENGKF----------VIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAP------YVTKPSNSSYKFLQPLTSPDTRVEKVDAEDIDTGLNAEL---VYSITGGNPHGLFRISSTDGEITLAKEFTRKHNGLHR----LVVKVSDKGKPSRHTTALVHIFV 787          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh7a (protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-1])

HSP 1 Score: 208.379 bits (529), Expect = 8.322e-55
Identity = 188/701 (26.82%), Postives = 307/701 (43.79%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEI--------------------------EKPNENFDV------YFKLMTEDFVDN-KQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRV--NEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL---TPDYGMLCAMEKL 2417
            NDN+P+FP       + EN  I +   LP A D D    G++ YE+                           +  E   V       F+L   D  D  KQP LIVK  +DRE  D  E  L   DGG PPR  +  + + + D ND  P+F + +YE ++ E+   G  +L +R  D+D G NG++   F ++T + ++   +L +      L ++ ++D E +++  F + A+D GQPPR+  A V + V + ND+ P +   +  + + +  A + + E    D  + LV+V+D D  +  ++TC +      F L     N    N+K + + +    D E    + V+IV  D+     L   + L V + DIND+AP F+         EN      +VT     ++A D D G+N  + Y +   V+     F ID + G ++    LD E+ +     + A+D G P    S  ++V V D NDN P+     ++F + EN    + VG V VTD D   N +  +   ++       G  Q   ++F+I+N +G I++    DRE  S   F + A +      G +  R    T+ + VT    D+NDN+P +          + P  S  +T           V    +  D D G N+ +R  +   + F L    P  G++   E L
Sbjct:  140 NDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIDRYELVQDSRDQRRPASATMPAGINNGAGDRRRGQEAGSVPAGRSNVFELQVADTPDGQKQPQLIVKGPLDREARDSYELVLRVRDGGNPPRSSQALLRVAITDVNDNSPRFERAVYEAEMGENTPPGTPVLQVRASDRDIGVNGQVEYVFGAAT-ESVRRLLRLDEASG--WLSVLHRIDREEVSQLRFTVTARDRGQPPRTDRATVILNVRDENDNVPVVEIRKIGRILVRDGAAM-VPENVLVDTPVALVQVSDRDQGENGAVTCTV-VGDVPFTLKPAGEN---RNKKKFFLHTSALLDYEATRDYTVTIVAVDSG-SPSLSSNSTLMVRVVDINDHAPTFAQSLVEVHFAENNAPGERVVT-----VVAADADSGKNAEIAYSLDPSVN---GAFYIDADNGDIRATGALDREQRERYEFRVIARDKGSPSLQGSATVVVQVTDRNDNAPKFVQEVFTFYVKENLLANSPVGMVTVTDADEGENAELCLFVEEDEEEEEAGGRRQ---ELFSIENNTGTIFSAASFDRESRSTYTFRVRAVD------GGEPPRSATATVSLFVT----DENDNAPSVTAPANESYTLL-PPASGART-----------VVRTVMASDGDAGSNADLRYALVGGNPFQLFEIGPSSGVITLAEPL 798          

HSP 2 Score: 56.6102 bits (135), Expect = 1.622e-7
Identity = 64/262 (24.43%), Postives = 103/262 (39.31%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELL--HLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQT--LHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVI 1205
            NDN+P F ++ +   + EN   NS + +    DAD+         +E+  E  +   +      ++N    +      DRE      F + AVDGG+PPR     + L V DEND  P  +    E        +G   +   +   D D+G+N  +             N FQL +     GV + L   L+      +   +   D G P   +TALV VF   +N+S  N         +  Q   ++   GT + +V+
Sbjct:  614 NDNAPKFVQEVFTFYVKENLLANSPVGMVTVTDADEGENAELCLFVEEDEEEEEAGGRRQELFSIENNTGTIFSAASFDRESRSTYTFRVRAVDGGEPPRSATATVSLFVTDENDNAPSVTAPANESYTLLPPASGARTVVRTVMASDGDAGSNADLRYALVGG------NPFQLFEIGPSSGV-ITLAEPLERRHRGLHRLVVRVNDSGVPSLCATALVHVF---INESLTNATL------VDAQCEHVHQRTGTQRCIVV 859          
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:103034658])

HSP 1 Score: 207.608 bits (527), Expect = 3.202e-54
Identity = 200/742 (26.95%), Postives = 333/742 (44.88%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEI-------------------EKPNENFD------VYFKLMTEDFVDN-KQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTK-------DMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRV-NEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL---TPDYGMLCAMEKLPP--IGDYKTVIVAEDGDFNNSRKQEFLINIHIKEDPHTLNN 2537
            NDN+P+FP       + EN  I +   LP A D D    G+E YE+                         FD        F+L   D  D  KQP LI+K  +DRE  D  E TL   DGG P R  +  + + + D ND  P+F + +YE  + E+   G  +L L+  D D G NG+I   F ++T + ++   +L ++     L ++ ++D E +++  F ++A+D GQPP++  A + + + + ND+ PNI          ++  RIY+ +G          D  I LV+V+D D   +  +TC +      F L          N+K Y + +    D E    + V IV  D+   +     + + V + DINDN P+F+         EN    E V      ++A D D G+N  + Y + + V+ +   FSID ++G ++    LD E+ +    ++ AKD GVPV   S  ++V V D NDN+P+     ++F + EN    + VG V V D D   N +  +   +              ++IF+I+N +G I++ V  DRE  +   F + A +      G D  R    +   +V++ ++D+NDN P +          +N   + +  S+N        V    I  D D G N+ +  ++   + F L    PD G++  + KL     G ++ V+   D     S+    L+++++ E   TL+N
Sbjct:  133 NDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDGAESSVRRLGSASTDAHSGKRRFDDAQSRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPARSSQAILRVMITDVNDNSPRFEKSVYEADLPENSSPGAPILQLKAMDADVGVNGQIEYVFGAAT-ESVRRLLRLDESTG--WLSVLHRIDREEVSQLRFTVMARDRGQPPKTDKATMIINIKDENDNVPNIDI--------RKIGRIYLRDGVANVAEDVVVDTPIALVQVSDRDKGPNGVVTCTV-VGDVPFQLKPASEIEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLI-VKVGDINDNPPIFTKSTVEVSFPENNAPGERVAT----VVALDADSGKNAEIFYSLDSSVNGI---FSIDADSGDIRVNTILDREQTERYEFKVIAKDKGVPVMQGSATVVVLVADKNDNEPKFMQDVFTFYVKENLQPNSPVGMVTVMDSDKGQNAEMSLYIEE-------------EEEIFSIENNTGTIFSTVAFDREQKTTYSFRVKAVD------GGDPPR----SATATVSLFVMDENDNPPSVTFP-------INSSYTLLPPSSN-----IRTVVRTVIATDTDTGVNADLSYSIIGGNPFKLFEIDPDTGVISLVSKLEQKHFGLHRLVVQVNDSGV-PSQSTTTLVHVYVNE---TLSN 815          

HSP 2 Score: 101.293 bits (251), Expect = 3.313e-21
Identity = 118/455 (25.93%), Postives = 192/455 (42.20%), Query Frame = 3
Query:  477 ILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLM----TEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSP---RYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVD 1820
            + E+  +++ I+L    D D  P GV +  +       DV F+L      E  ++ K+  L     +D E +      ++AVD G P       +I+KV D ND  P F++   E+   E+   G  +  +   D DSG N +I  +  SS N      F +      + +  I  LD E   +Y F ++AKD G P    +A V V V + ND+ P  +   F           Y+ E    +  + +V V D D          + ++ S Y+   +    +EN  T  I S + FDRE KT +   +   D  G      T  + + + D NDN P  + P    Y  +   + +  +V      ++ATD D G N  + Y I  +  +    F ID +TGV+  +  L+ +      + +   D GVP +S++  + V V +T  N   VD
Sbjct:  402 VAEDVVVDTPIALVQVSDRDKGPNGVVTCTVVG-----DVPFQLKPASEIEGDMNKKKYFLHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDINDNPPIFTKSTVEVSFPENNAPGERVATVVALDADSGKNAEIFYSLDSSVN----GIFSIDADSGDIRVNTI--LDREQTERYEFKVIAKDKGVPVMQGSATVVVLVADKNDNEPKFMQDVFT---------FYVKENLQPNSPVGMVTVMDSDKG--------QNAEMSLYIEEEEEIFSIEN-NTGTIFSTVAFDREQKTTYSFRVKAVDG-GDPPRSATATVSLFVMDENDNPPSVTFPINSSYTLLPPSSNIRTVVRT----VIATDTDTGVNADLSYSI--IGGNPFKLFEIDPDTGVISLVSKLEQKHFGLHRLVVQVNDSGVPSQSTTTLVHVYVNETLSNSTVVD 820          

HSP 3 Score: 92.8189 bits (229), Expect = 1.253e-18
Identity = 147/537 (27.37%), Postives = 217/537 (40.41%), Query Frame = 3
Query:  759 VLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNG-----------KISINFASSTNQDIQNT---------------FQLSQTLHG---VALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVL------ENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVI--IKDINDNAP---VFSSPRYYGIVKENRVNEIVTINKDPIL--ATDKDEGENGTVEYYI-----------SNVVDDM--KNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNIL--DKNDNSPMMM 2198
            +LD ND  P F   +  + ++E+   G   L     D+D G NG           + S+    S + D  +                 Q++ T  G     L +   LD E  + Y   L  +D G P RSS A++ V +T+VND+ P     +F K + +      + E ++    I  +K  D D     +  +IE      Y+    T +V       E+     +  +ID + E   L F +++  D     Q  +T+K  +I  IKD NDN P   +    R Y       V E V ++    L   +D+D+G NG V   +           S +  DM  K YF        + T   LDYE ++  ++ I A D G P  SS+  LIV V D NDN P    S       EN   G  V  V   D D+  N +             +L +S   + IF+ID +SG I    +LDRE + +  F +IA      D G  +       M+ S TV +L  DKNDN P  M
Sbjct:  129 ILDINDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDGAESSVRRLGSASTDAHSGKRRFDDAQSRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPARSSQAILRVMITDVNDNSP-----RFEKSVYEA----DLPENSSPGAPILQLKAMDADV---GVNGQIE------YVFGAATESVRRLLRLDESTGWLSVLHRIDRE-EVSQLRF-TVMARDR---GQPPKTDKATMIINIKDENDNVPNIDIRKIGRIYLRDGVANVAEDVVVDTPIALVQVSDRDKGPNGVVTCTVVGDVPFQLKPASEIEGDMNKKKYF--------LHTSAPLDYEAVQEYNVVIVAVDSGSPSLSSNNSLIVKVGDINDNPPIFTKSTVEVSFPENNAPGERVATVVALDADSGKNAEIFY----------SLDSS--VNGIFSIDADSGDIRVNTILDREQTERYEFKVIAK-----DKGVPV-------MQGSATVVVLVADKNDNEPKFM 610          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 208.764 bits (530), Expect = 1.094e-55
Identity = 211/711 (29.68%), Postives = 323/711 (45.43%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKL-MTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINF-----ASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQAD-SITCEIETSQESFYLNALK--TNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRV--NEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVR---VTMKNNDYFSLTPDYGMLCAMEKLPPI--GDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P F        + EN+    R  +  A D D    GV  YE+   +      F+L +TE     K P L+V+  +DRE     E  L AVDGG PP  G   + + V D ND  P F Q    ++I E+   G  ++ L   D+D+G+N ++          + + Q  +  F+L Q    V +  +  L+ E    Y   ++A D G  P  +TA V V VT+VND+ P I       P++     IYI+E +  ++ + L+ V+D D  A+ ++TC I   +  F L  L      +LE R+T         D ETK  + V I  +D  G   L +T  + + + D NDNAPVF+ P Y   V EN V    ++T++     ATD+D  +N  + Y++     D    F +D  TG++     LD EK  + S  I AKD G+PV   +  +IVNV D NDN+P   L+ + F + EN P  + VG V V D D   N +  +           LGT     Q+F+ID ESG I + V  DRE        + A++      G +  R    +  + V ++++D NDNSP++++         N    F+   T     P   VT     VD D   N+++R   V    ++ F + P  G +  ME L     G ++ V+   D           L+++ + E
Sbjct:  147 NDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGL--LNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVN---GVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRET--------LDYETKNEYVVQIKAADA-GATSLSRTMSVTIKLLDSNDNAPVFTEPTYKVSVPENNVIGKHLITVS-----ATDRDMDKNAEMVYFLG---PDAPTMFHMDPETGIISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGMVTVADSDEGENGRVRLS---------ILGTDN--RQLFSIDPESGMIRSNVGFDREQRHYYVLEVQATD------GGEPVR----SSTVKVVIHVMDINDNSPIVLMPPS------NTTYKFVVPRT----LPGTIVT-EVSAVDNDAEINAELRYHIVGGNPHNLFHIDPVIGNITLMEPLTETHHGLHRLVVRVSDIGIAVQHHAVALVHVFVNE 803          

HSP 2 Score: 66.2402 bits (160), Expect = 3.180e-11
Identity = 66/231 (28.57%), Postives = 106/231 (45.89%), Query Frame = 3
Query: 1440 KLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPIL-ATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILG-----------LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNP 2096
            ++ + ++DINDNAP F++P     V EN         + PI  A D D   NG   Y +        + F +     V +T  G           LD E+ +   + + A D G P  S S  L +NV DTNDN P  D +  + E+ EN P+GT+V +++ +D+D   N + +     +       G+ Q   ++F +D  SG +    +L+RE S      I+A++  P
Sbjct:  138 EVRINVEDINDNAPAFAAPVLTVSVPEN----APAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELS----VTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTG---GAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGP 357          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 182.57 bits (462), Expect = 8.773e-47
Identity = 194/721 (26.91%), Postives = 314/721 (43.55%), Query Frame = 3
Query:  237 SFQLINGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPN--ENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQL-SQTLHGVALKLISK---LDYETINKYSFNLVAKDFGQP-PRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQES--FYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFS-SPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNND 2366
            S +   GR+     IDREE      + +   NS    G+  + + +                 D+N+++P F   +Y   I E+  +NSR     A D D    G   YEI + N  E F +        F D +   L V++++DRE  +    T+ A+D G  P      + + VLD ND +P F+   Y     E +  G  +  ++  D D+G+NG ++ +F     +  Q  F+L S+T    +L++  +   +       +SF++VA D G+P P    A V+VFV +VND+PP     QF K + +      ++E  +    +  V  +D D+    ++   I    E   F ++A           T +I      DRE +T  +  +V +   G + L  +  + V + D NDN P F+ S      ++  RV E++      + A+D+D G +G V Y I  V  +    F+ID++TG V     LD+E  +   + +SA+D G P RSS+  L+V+V+D NDN P          + EN PIGT V  V   D D D+N +      +   PG            FTID ESG+I T   +DRE++  + F +     +     K +    R +   +VTV + D+NDN+P  +      V  +      +  +   +              D DE EN+ VR  +   D
Sbjct:  705 SIEWSGGRIFTANAIDREEQAFY--QLRVVANSGGVAGEASVSVLV----------------HDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGI--------FPDGQ---LYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF-----EKPQVNFELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPP-----QFAKSVYQAS----VSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGKFTVDA----------STGQITLLGSLDRE-ETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLIT----LTASDEDTGPSGDVRYAI--VAGNTHATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPG----------AHFTIDPESGEICTAAEIDREVTGGL-FEVTVRATD-----KAIPVHTRRSALKNVTVLVTDENDNAPRFVTPTAILVDGLRAAAGSVVGTLQAS--------------DPDEAENAAVRYAVTGGD 1335          

HSP 2 Score: 147.517 bits (371), Expect = 6.071e-36
Identity = 175/659 (26.56%), Postives = 268/659 (40.67%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEIL-ENSKINSRISLPMAYDADDLPFGV--ESYEIEKPNENFDVYFKLMTEDFVDNKQPI-LIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETS--------QESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPAD--QIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNND 2366
            NDN+P+FPE    +    E++ +  ++ L  A D D  P GV   +Y+I   NE      +L+    V  +  + L     +DRE        + A DGG P R G+ ++ + V D ND  P F +  Y   + E    G  L  L    +     G +++ F   T   + +T Q               LD+E   +Y+ +L A D G PP S  A   + + +VND+ P I F  +  P ++  +   ++E      V  LV VTD    ADS T   E S        +  F L+A     +    +  ++ S++  DRE   ++ ++I+ SD         T  L V + D+ND+AP F+   Y   + E       +  KD + A D D G N  + Y I  V  +   +FS+D++TG+V T   +D E    V + ISA+D G   +++   L V + D ND  P    + Y     EN   G +V  V+  D D   N         ++          PA   ++F +D+ +GK+ T   LDRE   + P  + A +      G              VTV + D NDN P+             P   F     NE   P           D D G N  VR  +   D
Sbjct:   17 NDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVDRDVGPNGVNHHAYKIVSGNEEG----RLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAALRDLLHRGR-----GPLAVPFDPKTG--MVSTRQ--------------PLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFV-YLPPAARSAS---VDESAAPGTVAALVTVTD----ADSPTANGELSVSIVGGNERGHFVLHAPGVPGL----RVLKVASQL--DRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEG--APAGSYVKD-VTAMDADSGLNAKLRYSI--VSGNDLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDM----------PAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGS----------TAKVTVVVGDLNDNHPVFY-----------PVQYFASILENE---PGGTAVTTVTATDPDRGANGTVRYQLTAGD 597          

HSP 3 Score: 142.51 bits (358), Expect = 2.017e-34
Identity = 157/605 (25.95%), Postives = 248/605 (40.99%), Query Frame = 3
Query:  645 LIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPI--SKQYARIYINEGTTKDMVICLVKVTDDDNQAD-SITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRE-------TKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKN----NDYFSLTPDYGMLCAMEKL 2417
            +   + IDRE     +  ++A  GG     G+  + + V D N+  P F +  YE+ I E E        +R  DKDSG NG++          +    F   Q      L +  +LD ET  +YS  + A D G  P SS+  V V V +VND          NKP+  S  Y   +  E     +V   V+ TD D  ++  +T   E  Q +F L++          +T  I S   FDRE         +  F S+V +D      L+    ++V ++D+NDN P F+   Y   V E+  N    +    + A+D DEG NG + Y I+   +  K  F++D +TG +  +  LD E+    ++ +SA D G    ++S  + V V D NDN P    S  S +  E+  +G  +  +  +D+DT             ++ G T  T       F ID  +G ++    LD E        + A         +D  R  R +  I V V++ D NDN P  +  D             +  S  ENI P           D D   N ++  ++        +F++ P+ G +C   ++
Sbjct:  713 IFTANAIDREEQAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQ------LYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVND----------NKPLFNSSSYVFHFCEEQEVGSLV-GAVQATDADAGSNGGVTYSFEKPQVNFELDS----------ETGRIASLRVFDREALIRQGGAASFSF-SVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLR---VTASDVDEGVNGALRYAINEGNEGGK--FTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESLLSVDALESTRVGELLITLTASDEDTG----PSGDVRYAIVAGNTHAT-------FAIDRSTGSVFLARRLDFETQRLYRLNVSA---------EDGGRPPRSSATILV-VHVRDFNDNPPAFLPGD-------------VFASIMENI-PIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEI 1246          

HSP 4 Score: 139.043 bits (349), Expect = 2.552e-33
Identity = 159/603 (26.37%), Postives = 251/603 (41.63%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIY------EIKIKESEMTGLELLHLRVEDKDSGN-NGKISINFASSTNQDIQNTFQL-SQTLHGV-ALKLISKLDYETINKYSFNLVAKDFGQP-PRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEY-YISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKD 2207
            NDN P F +  Y   + E+S + + +         DL        + +      V F        D K  ++  +  +D E   +   +L A DGG PP  G+   ++++LD ND +P   + +Y         + ES   G     + V D DS   NG++S++      +     F L +  + G+  LK+ S+LD E I  Y+  ++A D G+P  RS+TA + V+V +VND  P           +       ++EG      +  V   D D+    +  ++  S  S   N L   +V E+        K+D  RE  +   ++I   D +G         L V + D+ND  P+F+  +Y     EN +  +  ++   + A D D GENGTV Y +  ++    +  F +D  TG V T+  LD E+++   + + A+D G P   S+ K+ V V D NDN P      Y   + ENEP GT V  V  TD D   N               T G +      F ++  +G + T+V LDRE  +     + A     LD G       R      VT+ + D  D  P     D
Sbjct:  130 NDNPPAFEKPAYRASVAEDSPVGAALR--------DL--------LHRGRGPLAVPF--------DPKTGMVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAI-RFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNER---GHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRF---------ALSAYAAALSEGAPAGSYVKDVTAMDADS---GLNAKLRYSIVSG--NDLGWFSVDESTGLVTTDGKVD--REVASSVVLNISAQD-QGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVS---VSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQL--------TAGDA----ARFQVNAVTGAVSTRVSLDREERAVYQLQVTA-----LDGG-----HLRARSPAIVTITVADAQDTPPTFARDD 662          

HSP 5 Score: 131.339 bits (329), Expect = 5.203e-31
Identity = 150/590 (25.42%), Postives = 249/590 (42.20%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQES--FYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMM 2195
            ND++P F    Y   + E +   S +    A DAD        Y I   N+    +F       VD    ++    ++DRE    +   + A D G  P+   T + + +LD ND  P F+Q  Y     E+ + GL ++ +   D D G NG +  NF        +  F+L  +L G    L S LD E + +Y   + A+D G PP  STA V V V ++ND+ P  VFY    P+ + +A I  NE       +  V  TD D  A+       T+ ++  F +NA+          T  + +++  DRE + ++ + +   D  G  + +    + + + D  D  P F+   Y  +V EN     +  +   + A+  D   N  V Y I  V  D +  FSI+ + G + T   +D E+     + + A   GV   +    + V V D N++ P  D + Y   + E+EP+ +    V  TDKD+  N +              +G     ++     +  G++Y +  LDRE   +    + A     +D G +       +  ++V V +LD NDN P+ 
Sbjct:  335 NDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLG--WFS------VDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRL-DSLTGKVTTLKS-LDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHP--VFY----PV-QYFASILENE--PGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAV----------TGAVSTRVSLDREERAVYQLQVTALDG-GHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGS---VSASTLD--LNANVTYLI--VSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYE----------IGEGNGGEKFGIFPD--GQLYVRYELDRETREEYSLTVSA-----MDTGVEPL-----SSSVTVNVTVLDVNDNKPLF 862          

HSP 6 Score: 128.642 bits (322), Expect = 3.554e-30
Identity = 145/586 (24.74%), Postives = 247/586 (42.15%), Query Frame = 3
Query:  642 ILIVKHQIDREFIDRIEFTLIAVDGGKP-PRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK---NNDYFSLTPD 2387
            +L V  Q+DRE I     T++A D GKP  R     +++ V D ND  P+F+   Y   + E    G  +  +   D DSG N K+  +  S  +      F + ++   V      K+D E  +    N+ A+D G  P+++   + V + +VND PP  +F Q       +Y    +        V+ +     D  +  ++    +    + Y    + +++     T ++ +    DRE +   +  +V +   G   L  T K+ V++ D+NDN PVF   +Y+  + EN   E        + ATD D G NGTV Y ++    D    F ++  TG V T + LD E+     ++++A D G     S   + + V D  D  P      YSF ++EN   GT VG V+ +  D + N   +      ++ G   G+       F+I+   G+I+T   +DRE  +     ++A++                  E SV+V + D N+++P+    D+        EVS  +        P N   F     D D G+N +V+  +      + F + PD
Sbjct:  291 VLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDL---GWFSVDESTGLVTTD--GKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPP--LFTQ------TKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSL-----TGKVTTLKSLDRE-ELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILEN---EPGGTAVTTVTATDPDRGANGTVRYQLT--AGDAAR-FQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLDLNANVTYL------IVSGDQRGS-------FSIEWSGGRIFTANAIDREEQAFYQLRVVANSGGV-------------AGEASVSVLVHDVNNHAPVF---DRASY-----EVSIAEDE------PVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPD 811          

HSP 7 Score: 127.102 bits (318), Expect = 1.168e-29
Identity = 151/607 (24.88%), Postives = 246/607 (40.53%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKE-----SEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGV--ALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDT--EGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISN-------VVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLK 2204
            NDN P F       E+ EN+     I    A DAD     + +Y +   +E   V         VD    +L    ++DRE       T+ A DG         ++ + V D ND  P+FS+  Y   + E      + T   +  +   D DSG  G+++   A S + D  +    +  LH V  AL +   LD E+   Y     A D G    ++TA + V V + ND+ P++     N  ++ +     + E       +  +  TDDD   + +  E+E     F +++             ++      DRE ++ + + +  SD       +L    ++ +I+ D+NDNAP F+SPR     +++ V  +V      + A D D G N  VEY ++                F+++  TG V+ +  LD E  +  ++ + A D G P  +S+  L V V D NDN P      Y   + E+EP GT V +++  D D   N +              + +  P    F +D   G +     LDRE ++    A+ A +      G    R   DT  + VT++  D ND SP   L 
Sbjct: 1510 NDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFV---------VDAASGVLRASRRLDREERASYLLTVRASDG---THATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADG---AFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQ----NDSLAAE-----VPEDAPPGTSLLRISATDDD---EGVNAELE-----FSISSGDPEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVAT----VQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYD----------IASGDPTGD-FRLDPVLGTLAVARPLDRERTASYELAVRARD------GGGPARS--DTASVRVTLS--DVNDCSPAFQLS 2057          

HSP 8 Score: 127.102 bits (318), Expect = 1.178e-29
Identity = 130/489 (26.58%), Postives = 203/489 (41.51%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSR-----ISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPI---LIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQ--PPRSSTAL-VEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENR--VNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYEN 1853
            NDNSP F    Y  ++ E++  + +     I   +A DAD  PFG  +Y +  P+E+ D        D      P+   L V   +DRE          A DGG        ++ + VLD ND  P         ++ E    G  LL +   D D G N ++  + +S    D +  F +        L +   LD E  + Y+  +   D  +  P R S+A+ V + +T+VND+ P      F  P S         E +    V+  V+  D D+  +S +   + T  E     A         N  T E++   + DRE +  + ++++  D +G   L  T  L V + D NDNAP F    Y   + E+     E++ ++     A D DEG NG + Y I++   D    F +D   G +     LD E+     + + A+D G P RS +  + V + D ND  P   LS Y+    EN
Sbjct: 1611 NDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYAL-APSEDSD------WADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSG---DPEGRFAVGNDGQ---LSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAP-----AFTSPRSA-----LAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVD-KGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLS-----AWDPDEGANGELRYDIAS--GDPTGDFRLDPVLGTLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYTVHAREN 2066          

HSP 9 Score: 94.3597 bits (233), Expect = 1.128e-19
Identity = 63/197 (31.98%), Postives = 88/197 (44.67%), Query Frame = 3
Query:  657 HQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS 1247
             ++DRE       T++AVD G+PP      + + V D ND  P+F +  YE  I E E  G E+L L   D D G NG++  + AS    D    F+L   L    L +   LD E    Y   + A+D G P RS TA V V +++VND  P      +          ++  E T    V+ L  V  DD+   S
Sbjct: 1905 RELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASG---DPTGDFRLDPVLG--TLAVARPLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAFQLSPYT---------VHARENTQGPPVLILQVVARDDDLGSS 2087          

HSP 10 Score: 92.0485 bits (227), Expect = 4.963e-19
Identity = 112/448 (25.00%), Postives = 180/448 (40.18%), Query Frame = 3
Query: 1035 AKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINK--DPILATDKDEGENGTVEYYI--SNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNN 2363
            A  F +PP SS   VE+ V +VND+PP     +           + + E T +  VI  +  TD D  Q   +T  + +  E  ++    +  +  +R+          DRE +  + +++  SD           +L V ++D NDN+P FS   Y   V E+   +  T       +LA D D G  G V Y +  S   D     F +   TG +     LD E      +   A D G    +++ +L VNV D NDN P V     + E+ E+ P GT + +++ TD D  +N +             ++ +  P  + F + N+ G++     LDRE  S     +  S+       +      R +  + V++ + D NDN+P       P+  A+ PE S           P   V      VD D G NS V   +  +
Sbjct: 1488 AGSFIRPPMSSFNQVEISVEDVNDNPPVFAVPEME---------LEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVVDAASGVLRASRR---------LDREERASYLLTVRASD----GTHATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGG--GLAATARLYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEF----------SISSGDPEGR-FAVGND-GQLSVARALDRERQSFYNLVVRVSD-------RARHPPARLSSAVRVSLILTDVNDNAPAFT---SPR-SALAPEDS-----------PVGAVVATVQAVDPDSGRNSYVEYALATD 1877          

HSP 11 Score: 54.6842 bits (130), Expect = 1.366e-7
Identity = 41/153 (26.80%), Postives = 69/153 (45.10%), Query Frame = 3
Query: 1440 KLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPIL--ATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILG------LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYV 1874
            ++ V++ D+NDNAP F  P     V E    E   + +  +L  A D+D G NG V ++   +V   +    +       +  L       LD E     ++ + A+D G P R   +++ V V+D NDN P  +   Y   + E+ P+G  +
Sbjct:    8 EVRVVVGDVNDNAPSFPEPG----VMEVAFKEDAAVGRQVLLDTAVDRDVGPNG-VNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL 155          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: si:ch211-199f5.1 (protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660])

HSP 1 Score: 176.407 bits (446), Expect = 1.558e-45
Identity = 150/541 (27.73%), Postives = 254/541 (46.95%), Query Frame = 3
Query:  234 DSFQLIN-----GRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRY-YGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVD------DMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEV 1817
            D F L++     G V+ R  IDRE+ C ++       +  C      L  G+       + V+ +++++DIND++P F     + EI E+  + +R+ L  A D D     + +Y +++ NE F +  +  T+     K   L+VK ++DRE        L A DGG PPR G T + + VLD ND  P F+Q    + ++E    G  LL L   D D G NG++  +F+S  + +++  FQL      ++LK   +LD+E  ++Y  ++ A+D G     +   V V V ++ND+ P I   + +  +  +   ++++EG   +  + LV V+D D+  +  + C +      F L        L  R  Y + +    DRE    +F+ +  SD  G        +  V + D NDN P F    Y   +++ N     VT     + A D D   NG + Y   NVV+       +  Y SI+ ++G +  +  LDYE +  ++ ++ A+D GVP   ++  + V + D NDN P V
Sbjct:   70 DDFSLVHVEEADGTVSAREVIDREQQCGQAPSCVIRFDVLCT-----LPRGL------FQLVHAEVELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHLDE-NERFGLALRARTDGA---KYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLK--GQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEI---KLDFIMQSRGDTVFVSEGAAYESFVGLVTVSDIDSAENGLVACHLR-GHPHFKL--------LPYRDDYVVVTNSSLDREQMADYFLVLEASDG-GTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTT----VTAWDADAEHNGMIAY---NVVESEVAGASVSTYVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPLVTNATVSVRIVDENDNAPVV 573          

HSP 2 Score: 110.538 bits (275), Expect = 7.929e-25
Identity = 131/503 (26.04%), Postives = 211/503 (41.95%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVA---LKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-----NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAP------VFSSPRYYGIVKENRVNE----IVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSID--KNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPN--PLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMM 2195
            +++LD ND  P F++    ++I ES   G  +      D D G N   + +     +++ +    L     G     L + S+LD E   +Y+  L A D G PPRS T LV + V + ND+ P  VF Q +         + + E  T   V+  +  TD D   +          E  Y  +   +A +      + KT ++  K   D E  + + +SI   D  G + +    K+ V ++DINDNAP      +  S      V E    E    +VT+       +D D  ENG V  ++         +F +   ++  VV T   LD E++    + + A D G P R ++ +  V + D NDN+P    S Y   L EN   G YV  V   D D + N       +++ + G ++ T        +I+  SG IY    LD E  + + F + A +    PL                +V+V I+D+NDN+P++
Sbjct:  124 VELLDINDHAPDFARSEMHVEISESVALGTRVPLEGARDLDVGGNALRAYHL----DENERFGLALRARTDGAKYAELVVKSRLDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSP--VFAQTS-------CNVTVREDATPGTVLLTLNATDVDEGPNG---------EVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDM-GPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYESFVGLVTV-------SDIDSAENGLVACHLRG-----HPHFKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPRFHRSTYEASLLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVST------YVSINPSSGAIYALRPLDYEAMTSLTFQVQARDDGVPPL------------VTNATVSVRIVDENDNAPVV 573          

HSP 3 Score: 72.0182 bits (175), Expect = 5.662e-13
Identity = 115/490 (23.47%), Postives = 196/490 (40.00%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQF-----------SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITC------EIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYY---GIVKENR---VNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVV----KTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVD 1820
            NDNSP F + +    + E++   + +    A D D+ P G   Y    P    D   + + +  +D K   L +K Q+D E     E ++ A D G        K+++ V D ND  P+            +  + E    ES   GL    + V D DS  NG ++ +     +      F+L        +   S LD E +  Y   L A D G PPR +     V + + ND+ P   F++     S       + E  +    +  V   D D + + +        E+  +  S Y++   ++  +     Y ++  +D++  T +L F   V +  +G+  L     + V I D NDNAPV + P      G+V+  R   +  +VT+    + A D D   NG + Y I  V  + +N F I++  G V     ++        +H S+ +  +D G P  S++  + + V    D     D
Sbjct:  239 NDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDEGPNGEVVYSFSSP---VDAEVRRLFQ--LDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSIPAHCKVLVHVEDINDNAPEIKLDFIMQSRGDTVFVSEGAAYES-FVGL----VTVSDIDSAENGLVACHLRGHPH------FKLLPYRDDYVVVTNSSLDREQMADYFLVLEASDGGTPPRVAARQFTVRLLDENDNEPR--FHRSTYEAS-------LLENNSPGAYVTTVTAWDADAEHNGMIAYNVVESEVAGASVSTYVSINPSSGAI-----YALR-PLDYEAMT-SLTFQ--VQARDDGVPPLVTNATVSVRIVDENDNAPVVTHPPLRNGTGVVRLPRDAGLGYLVTV----VRARDSDSEANGELSYRI--VQGNERNLFRINRLGGEVFTNAASVTDAAASATRH-SLVVMVRDRGSPALSATAAIEIRVGAHGDGDDGAD 687          

HSP 4 Score: 68.9366 bits (167), Expect = 5.365e-12
Identity = 94/386 (24.35%), Postives = 159/386 (41.19%), Query Frame = 3
Query: 1392 IVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPI-LATDKDEGENGTVEYYIS---------NVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGP----TLGTSQPAD----QIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFV------DLDEGENSKVRVTMKNNDYFSLTP---DYGMLC--AMEKLPPIGDYKTVIVAEDG 2462
            ++C+   G+ QL      EV + DIND+AP F+    +  + E+    +    + P+  A D D G N    Y++              D   Y  +     VVK+   LD E+    +++++A D G P RS +  + + V D+NDN P    +  +  + E+   GT +  +N TD D                 GP        S P D    ++F +D ++GK+  K  LD E++S+   +I A +  P                  V V++ D NDN+P + L              FI  S  + ++      +   FV      D+D  EN  V   ++ + +F L P   DY ++   ++++   + DY  V+ A DG
Sbjct:  108 VLCTLPRGLFQLVHA---EVELLDINDHAPDFARSEMHVEISES----VALGTRVPLEGARDLDVGGNALRAYHLDENERFGLALRARTDGAKYAEL-----VVKSR--LDREQEGEYTLQLTAWDGGDPPRSGTTLVRITVLDSNDNSPVFAQTSCNVTVREDATPGTVLLTLNATDVDE----------------GPNGEVVYSFSSPVDAEVRRLFQLDPKTGKLSLKGQLDHELNSEYEISIQARDMGPSSI----------PAHCKVLVHVEDINDNAPEIKLD-------------FIMQSRGDTVFVSEGAAYES-FVGLVTVSDIDSAENGLVACHLRGHPHFKLLPYRDDYVVVTNSSLDR-EQMADYFLVLEASDG 438          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 172.555 bits (436), Expect = 3.393e-44
Identity = 188/735 (25.58%), Postives = 306/735 (41.63%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVD------------------NKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQ-LIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASS-TNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQY---ARIYINEGTTKDMVICLVKVTDDD-NQADSITCEIETSQESFYLNALKTNAVLE--NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPR--------YYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVV--DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPE-VDLS-----FYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDK----PQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNND---YFSLTPDYGMLCAMEKLPPI--GDYKTVIVAEDGDFNNSRK 2483
            ND++P F        I E+  +  R+ LP A D D     ++ Y I   + +     +L     V+                    + +L ++ Q+DRE +   E  L   DGG P   G   + + V+D ND  P F       ++I E    G  ++ LR  D D+G NG I+ +F +  T+   Q    +  T   V ++   KLD ET+  +   +VA+D GQ  RS++  V V + + ND+ P  VF      +  +Y     + I E       + L+ V+D D   + ++   +E            T A L   N+  + +K+    D E    + VS++ +D  G  +L +   L + + DINDN PVF +P         Y   ++EN     V +N   +LATD D G NG + + +S +   + +   FS++  TG +     LD EK     + + A D G P R +   + V V D NDN P  V +S      Y F + E   +GTYVG V+ +D D   N +  +  ++   P    G           D   G + T VVLDRE   Q   ++ A     +D G+        +  +S+TV+  D NDN+P++   +       V+  +P    +  S   N              D+D G+N +    +   +    F L  D G L     +  +  G ++ V+   D   + SR+
Sbjct:  138 NDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGD---GLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAP--VFEVIA--LQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLE----------FPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAAD-RGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLN---LLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAG---------DTPGGVVRTLVVLDREDRVQYELSVRA-----VDSGRP---ALSASCRVSITVS--DTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTAN--------------DIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLARTVSSLDEGLHRLVVRVRDRGGSGSRR 818          

HSP 2 Score: 119.398 bits (298), Expect = 1.324e-27
Identity = 145/577 (25.13%), Postives = 238/577 (41.25%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQ-NTFQLSQTL-----------------HGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFY--LNALKTNAVLENRKT---YEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIK--DINDNAPVFSSPRYYGIVKENRVNEIV--TINKDPIL---ATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQP--------EVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVS-----FIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTM 2354
            L V D ND  P F      + I ESE  G  +   R  D D+G N       ++++   +Q   F L ++                  H   L+L  +LD E +  Y   L  +D G P  S + L+ + V + ND+ P      F  P ++    + I E +     +  ++  D D   +           SF+  L +L T A L    T     +++    DRET  +H + +V  D     QL ++  + V ++  D NDNAPVF      G    +   +IV    +  P++    +D D G +GTV+  +           S +K   ++KT   LDYE+ +  ++ + A D G P  S  + LI++V D NDN P        E D++ Y   L EN P GT V  +  TD D+  N        +       L   +   ++F+++  +G++     LDRE   +   ++ A +      G    R+ R      V V +LD+NDN+P  +         V+   +     F++  T+   Y     T      DLDEG+N++V + +
Sbjct:  132 LLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAP-----VFVDPPTRP---VRITEHSKVGTSVVQLRAADPDAGPNGAIA------YSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDG---GQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLE--FPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSE-------LAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACD------GGSPQRKARAI----VRVTVLDENDNAPTFV--------GVSNSTNCMYQFFVEEETSVGTYVGTVSTS-----DLDEGDNARVALNL 659          

HSP 3 Score: 58.9214 bits (141), Expect = 5.795e-9
Identity = 75/306 (24.51%), Postives = 121/306 (39.54%), Query Frame = 3
Query: 1353 DFDRETKTLHFVSIVC-SDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRY-YGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNY--FSIDKNT-------------------GVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPE-VDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVV--LDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPM 2192
            D  R T  +H V +   +  +G + L+  + ++++++DIND+AP F +P     I +   V   V + +    A D D G N    Y IS    D      FS+ ++                     +++    LD E +    + +  +D G P  S SV L + V D NDN P  VD       + E+  +GT V ++   D D   N          L       TS        +D  +G +  +    LDRE        ++A      D G     Q   +  ++VTV + D NDN+P+
Sbjct:  100 DACRSTGFMHTVQVAAMAKGQGSSNLRLLD-VQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPR----AIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKL-------TSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVAR-----DGG-----QLSRSASVTVTVELNDDNDNAPV 383          
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009557.1 (pep scaffold:Pmarinus_7.0:GL476748:59426:101420:1 gene:ENSPMAG00000008644.1 transcript:ENSPMAT00000009557.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.902 bits (372), Expect = 3.745e-36
Identity = 166/667 (24.89%), Postives = 281/667 (42.13%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADD---LPFG-VESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETS--QESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKD--PIL--ATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSS--VKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMK-NNDYFSLTPDYG 2393
            N++ P F    Y   + E +  N+ I    A D DD   L F  V S ++    +     FKL      D     L     +D E       T++  D   P +K    +++ V D ND  P F+   YE ++ ES   G  +L +   D+D G N +++ +  +  N+++ N+F +  T+ G+ L +  +LD   +  Y   + A D G+PPRS+T  V V VT  +++PP        K  SK Y+   ++EG      + +V  +       ++  EI     +++FY+N   T+ V+  ++  + + K  +  + +  + V            L     + + + D NDNAPVF   +Y G+V E    + V +N    P++  ATD D  +N  + Y I  V  + + YFSID +TG +K I  LDYEK      ++   D G P  S+     + + V D ND+ P    + Y   L      G  +  ++ TD DTD +               ++ T    D+ F I+  +G I  +      + S+   A+           K    +F  T +  V V + D NDN+P+ +  + P    V  + +               V +     D D G N +V  ++K  ++YF +    G
Sbjct:   10 NEHRPQFSRPRYEVSVAEETPPNTEILRLNATDRDDTSSLTFSIVSSTDVASLRK-----FKL------DYNTGALSTVESLDHETKQSHILTVMVRDSEIPVQKAYATVVVNVRDSNDHAPLFTSRHYEGRVVESAALGSAVLEVVALDRDRGPNAEVAYSIEAG-NRNVGNSFTIHPTM-GI-LSVAKELDRAVVEAYELVVRAVDRGEPPRSATTAVRVLVTVADNAPP--------KFTSKDYS-AEVSEGARPGSFVLMVTAS----SRSTVNYEIRDGNFEDTFYVN--PTSGVITTKELLDYERKPSYQLKIQATNMVG-----------LSTNASVSIHLSDENDNAPVFDRSQYRGVVSEEAQAQTVVLNDKNVPLVIRATDLDSEQNSLLVYQI--VEHEAQTYFSIDSSTGAIKMIKVLDYEKTPEFHFQVRVSDSGSPKLSAETPANVTITVLDANDSPPIFSRAVYETVLLTPTYSGVRLLSMSATDPDTDASLTF------------SISTGNVGDK-FAINARTGDISVQNAT--HLRSRYELAV-----------KVFDGKFVSTAQAVVAVRVEDVNDNAPVFV--NLPYYAVVEVDAA------------PGSVVYTIAAFDRDVGRNGEVSYSLKEEHEYFDVEARSG 594          

HSP 2 Score: 130.954 bits (328), Expect = 5.881e-31
Identity = 154/642 (23.99%), Postives = 272/642 (42.37%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKII-LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSG-NNGKISINFASS---TNQDI-----QNTFQLSQTLHGVALKLISKL-----DYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQES--FYLNALKTNAVLENR---------------------KTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGI-VKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPE 2237
            NDN P F    Y   ++EN      +    A D D    G  +Y + +         + +    VD +   +     +DRE     E  ++A D G P R   T  + + V D NDC P+F +  Y   + E    G  +  +  +D D+  +NG+++     +     +D      ++  + S+T+  ++++L++ L     + E+  +++  +   D G+PP  +TA V V V++ ND+ P  V  +      K  AR    E +     +C V   D D+ A++ ++  I+   E+  F+++    + V+  R                       +++  K   DRE +  + + +  +D   +++      ++V + D NDN+PV      Y + V E+    I  +    + A D D G N  ++Y +         +F +D  TG + T+  LD E +   ++ + A D G   RS   +++V+++D NDN P+   S Y+  +YE+  + T + +V  TD D  +N K             T      A   F ID  SG I  K  LDRE  +     + A +        D+FR    T+ +SV V  LD NDN P     ++ +  A  PE
Sbjct: 1266 NDNRPVFESSVYEGVVMENLPAGVPVVQVRATDRDGGANGQLAYSLAEEAGGEGGAARDLFS--VDAESGWVRTLRPLDREARAGHELAVVATDLGDPARLSATASVRVAVADANDCPPRFLRGSYAGDVPEDSAPGQVVAVVGADDADATPDNGQLTYYLTGAPRVAAEDALPGHGEHVLRESRTV-AISVELLTILPPTVRETESACQFNIGVSIVDGGEPPLQTTARVVVRVSDENDNAPQFVEKRVQV---KALAR----ERSVAREAVCRVYARDADHGANAELSYSIDGGNEAGKFFID--PKDGVISTRNPCPVGTNDFLTVPCDIYVVVGEWKLHLKQPVDREERDRYQIEVTATDGAFVSKAV----VDVAVLDANDNSPVCDKGLLYAVAVAEDVAPGIFLL---LVSARDADIGANAAIQYTLHG---PGAEHFRMDSATGELFTLAPLDREAVPAYALSVRATDGGG--RSCQAEILVSLEDVNDNAPQFPASHYAVSVYESTAVETLLTRVQATDSDLGLNRKV------------TYSFLDSAGGHFAIDERSGIISLKRPLDREHQAVYELTVRAED-------GDVFRPLTSTVGVSVAV--LDVNDNPPAF---EQREYHAAAPE 1859          

HSP 3 Score: 101.679 bits (252), Expect = 5.967e-22
Identity = 168/735 (22.86%), Postives = 276/735 (37.55%), Query Frame = 3
Query:  444 PTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVL------DENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQL-SQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPR-SSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNA-----------VLENRKTYEIKSKI-----DFDRETKTLHFVSIVCSDTEGIN-QLKQTNKLEVIIKDINDNAPVFSSPRYY--GIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKT--------------------ILG---------LDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLS-FYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTM--KNNDYFSLTPDYGMLCAMEKL--PPIGDYKTVIVAEDGD 2465
            P F E  Y   + E++++ S I +      D   +          N   D +  L       ++   L V   +D E +    F + A       R+ +  ++ +VL      D ND  P F   +YE  + E+   G+ ++ +R  D+D G NG+++ + A     +      L S       ++ +  LD E    +   +VA D G P R S+TA V V V + ND PP  +   +   +          E +    V+ +V   D D   D+        Q ++YL      A           VL   +T  I  ++        RET++    +I  S  +G    L+ T ++ V + D NDNAP F   R     + +E  V          + A D D G N  + Y I     +    F ID   GV+ T                    ++G         +D E+     IE++A D G  V  + V   V V D NDN P  D    Y+  + E+   G ++  V+  D D   N           L G       P  + F +D+ +G+++T   LDRE       ++ A++      G+        + +  + V++ D NDN+        PQ  A +  VS  +++  E +      T      D D G N KV  +       +F++    G++     L       Y+  + AEDGD
Sbjct: 1163 PAFTEAAYALTVAEDAEVGSEIGVARLAGNDSATYAAVPGGGGAENNADDTFVVL-------SQTGRLKVAKALDHETVRSYRFGVKATF-----RRDEVDVVAQVLVTVHVGDVNDNRPVFESSVYEGVVMENLPAGVPVVQVRATDRDGGANGQLAYSLAEEAGGEGGAARDLFSVDAESGWVRTLRPLDREARAGHELAVVATDLGDPARLSATASVRVAVADANDCPPRFLRGSYAGDVP---------EDSAPGQVVAVVGADDADATPDN-------GQLTYYLTGAPRVAAEDALPGHGEHVLRESRTVAISVELLTILPPTVRETESACQFNIGVSIVDGGEPPLQTTARVVVRVSDENDNAPQFVEKRVQVKALARERSVAREAVCR---VYARDADHGANAELSYSIDG--GNEAGKFFIDPKDGVISTRNPCPVGTNDFLTVPCDIYVVVGEWKLHLKQPVDREERDRYQIEVTATD-GAFVSKAVVD--VAVLDANDNSPVCDKGLLYAVAVAEDVAPGIFLLLVSARDADIGANAAIQYT-----LHG-------PGAEHFRMDSATGELFTLAPLDREAVPAYALSVRATDGG----GR--------SCQAEILVSLEDVNDNA--------PQFPASHYAVSVYESTAVETLLTRVQAT------DSDLGLNRKVTYSFLDSAGGHFAIDERSGIISLKRPLDREHQAVYELTVRAEDGD 1823          

HSP 4 Score: 96.2857 bits (238), Expect = 2.774e-20
Identity = 103/410 (25.12%), Postives = 178/410 (43.41%), Query Frame = 3
Query:  684 RIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPP--NIVFYQFNKPIS-KQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDT 1904
            R E  +   DG K     +  + ++V D ND  P F  L Y   ++     G  +  +   D+D G NG++S +      ++    F +      V+L+     D  +   ++ N+VA D G PP SS   V + +T +N + P     FY  + P + K +  I   +  + + +  +  +TD D            +Q S   N    N +               D ET+T   +++  +D+  +        L+++++D+NDN P+FS   Y   + E     ++ I+   + ATD D G N  + Y I N   +    F ID ++G++ T   LDYE+ +  +  + A D G+P  +S V + + V D NDN P  +   Y   + E  P G +V +V  +D D 
Sbjct:  507 RYELAVKVFDG-KFVSTAQAVVAVRVEDVNDNAPVFVNLPYYAVVEVDAAPGSVVYTIAAFDRDVGRNGEVSYSL-----KEEHEYFDVEARSGDVSLRRSFTADMSS-KDFTVNVVATDSGVPPLSSE--VSLPITVINKAMPIFERPFYSKSVPENIKPHTPILNLQAKSPEGLPLIFSITDGD----------PFNQFSIDFNTGVVNVIGS------------LDHETQTTFKLTVRATDS--VTGSHAEVNLDILVQDVNDNPPLFSQSAYATTLSEA---ALIGISVLQVSATDADIGSNKALYYQIINNGKNSSECFYIDSSSGLILTSRFLDYEQNQVHNFLVRASDSGMPFLTSDVPVTITVTDINDNPPVFNQLLYEAFVSELAPRGHFVTRVQASDADA 880          

HSP 5 Score: 93.2041 bits (230), Expect = 2.469e-19
Identity = 104/418 (24.88%), Postives = 167/418 (39.95%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAY--DADDLPFGVESYEIEKPNENFDVYF-------------KLMTEDFVDNKQPILIV--------KHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQ-LIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYI 1613
            NDN+P F EK    + L   +  +R ++   Y  DAD       SY I+  NE    +               + T DF+     I +V        K  +DRE  DR +  + A DG       K  + + VLD ND  P   + L+Y + + E    G+ LL +   D D G N  I         +  +      +      L  ++ LD E +  Y+ ++ A D G   RS  A + V + +VND+ P     QF  P S     +Y  E T  + ++  V+ TD D         +       +L++   +  ++ R    I  K   DRE + ++ +++   D +    L  T  + V + D+NDN P F    Y+    E+       ++   +LA  KD G N  V Y +
Sbjct: 1501 NDNAPQFVEKRVQVKALARERSVAREAVCRVYARDADHGANAELSYSIDGGNEAGKFFIDPKDGVISTRNPCPVGTNDFLTVPCDIYVVVGEWKLHLKQPVDREERDRYQIEVTATDGAF---VSKAVVDVAVLDANDNSPVCDKGLLYAVAVAEDVAPGIFLLLVSARDADIGANAAIQYTLHGPGAEHFRMDSATGE------LFTLAPLDREAVPAYALSVRATDGGG--RSCQAEILVSLEDVNDNAP-----QF--PASHYAVSVY--ESTAVETLLTRVQATDSD-------LGLNRKVTYSFLDSAGGHFAIDERSGI-ISLKRPLDREHQAVYELTVRAEDGDVFRPLTSTVGVSVAVLDVNDNPPAFEQREYHAAAPEDAAPGSAVLS---VLAISKDAGANAEVTYSV 1887          

HSP 6 Score: 91.6633 bits (226), Expect = 7.239e-19
Identity = 135/594 (22.73%), Postives = 232/594 (39.06%), Query Frame = 3
Query:  252 NGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLP--FGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQID------REFIDRIEFTLIA--VDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKI--KESEMTGLELLHLRVEDKDSGNNGKISINFASS------------------------TNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQ---YARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVII--KDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGV--PVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDT 1904
            +G V   RP+DRE        H+  + +   G    L               +++ V D ND  P F   +Y  ++ E+S     +++  A DAD  P    +  Y    P    +       E  +   + + I    +       RE     +F +    VDGG+PP +   +++++V DEND  PQF +   ++K   +E  +    +  +   D D G N ++S +                            TN  +     +   +    L L   +D E  ++Y   + A D       S A+V+V V + ND          N P+  +   YA + + E     + + LV   D D  A++           + L+         +  T E+ +    DRE    + +S+  +D  G     ++ + E+++  +D+NDNAP F +  Y   V E+   E +      + ATD D G N  V Y   + +D    +F+ID+ +G++     LD E      + + A+D  V  P+ +S+V + V V D NDN P  +   Y     E+   G+ V  V    KD 
Sbjct: 1332 SGWVRTLRPLDREARAG----HELAVVATDLGDPARL----------SATASVRVAVADANDCPPRFLRGSYAGDVPEDSAPGQVVAVVGADDADATPDNGQLTYYLTGAPRVAAEDALPGHGEHVLRESRTVAISVELLTILPPTVRETESACQFNIGVSIVDGGEPPLQTTARVVVRVSDENDNAPQFVEKRVQVKALARERSVAREAVCRVYARDADHGANAELSYSIDGGNEAGKFFIDPKDGVISTRNPCPVGTNDFLTVPCDIYVVVGEWKLHLKQPVDREERDRYQIEVTATDGA---FVSKAVVDVAVLDAND----------NSPVCDKGLLYA-VAVAEDVAPGIFLLLVSARDADIGANAAI--------QYTLHGPGAEHFRMDSATGELFTLAPLDREAVPAYALSVRATDGGG-----RSCQAEILVSLEDVNDNAPQFPASHYAVSVYESTAVETLLTR---VQATDSDLGLNRKVTY---SFLDSAGGHFAIDERSGIISLKRPLDREHQAVYELTVRAEDGDVFRPL-TSTVGVSVAVLDVNDNPPAFEQREYHAAAPEDAAPGSAVLSVLAISKDA 1877          

HSP 7 Score: 87.8113 bits (216), Expect = 1.184e-17
Identity = 140/554 (25.27%), Postives = 237/554 (42.78%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFT--LIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQAD-----SITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKE-NRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIK-HVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLG------TSQPADQIFTIDNESGKIYTKVVLDRE 2048
            NDN+P F    YY  +  ++   S +    A+D D    G  SY +++ +E FD          V+ +   + ++     +   + +FT  ++A D G PP   +  + + V+  N   P F +  Y   + E+      +L+L+ +  +      + + F S T+ D  N F +    +   + +I  LD+ET   +   + A D      +   L ++ V +VND+PP  +F Q        YA   ++E     + +  V  TD D  ++      I    + S E FY+++  +  +L +R           D E   +H   +  SD+ G+  L     + + + DINDN PVF+   Y   V E       VT     + A+D D  +   +EY I +  D M   F +D  +G++ +I  L  + +     + IS  D    V +S+ ++ VN++  N + P    + Y  E+ EN  +GT +  V  TDKD                 GP LG       +Q A   FTID E+G+I+T   LDRE
Sbjct:  535 NDNAPVFVNLPYYAVVEVDAAPGSVVYTIAAFDRDVGRNGEVSYSLKEEHEYFD----------VEARSGDVSLRRSFTADMSSK-DFTVNVVATDSGVPPLSSEVSLPITVI--NKAMPIFERPFYSKSVPENIKPHTPILNLQAKSPEG-----LPLIF-SITDGDPFNQFSID--FNTGVVNVIGSLDHETQTTFKLTVRATDSVTGSHAEVNL-DILVQDVNDNPP--LFSQ------SAYATT-LSEAALIGISVLQVSATDADIGSNKALYYQIINNGKNSSECFYIDS-SSGLILTSRF---------LDYEQNQVHNFLVRASDS-GMPFLTSDVPVTITVTDINDNPPVFNQLLYEAFVSELAPRGHFVT----RVQASDADASDTDKLEYSILSGNDHMN--FVVDGKSGII-SISNLRKQTLAPQYRLNISVSD---GVFTSTAQVHVNIQSANLHSPIFGQNEYVKEIPENSEVGTLLTLVQATDKDW----------------GP-LGHVSYSIVNQFAGDRFTID-ENGQIFTSEPLDRE 1018          

HSP 8 Score: 81.6481 bits (200), Expect = 8.951e-16
Identity = 139/605 (22.98%), Postives = 249/605 (41.16%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHG-VALKLISKLDYETIN-KYSFNLVAKD--FGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDD-NQADSITCEI--ETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYG--IVKENRVNEIVTINKDPILATDKDEGENGTVEYYI----SNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRD----TMEISVTVNILDKNDNSPMM 2195
            NDN P F +  Y   + E + I   +    A DAD        Y+I    +N    F      ++D+   +++    +D E      F + A D G P       + + V D ND  P F+QL+YE  + E    G  +  ++  D D+ +  K+  +  S  +        ++  + G   +  IS L  +T+  +Y  N+   D  F     +STA V V + + N   P  +F Q       +Y +  I E +    ++ LV+ TD D      ++  I  + + + F ++        EN + +  +     DRE        I     +G  ++  T  ++VI  D NDN P F +  Y+G  + +  +   I+      +LATD DEG N  + Y +    S+ V+D+     +  +    ++++GL+  ++   S  + A+D G   + S V + V+V   +   P    + Y+  + E+  +G+ +G   +   D+              +PG   G    AD  F + +++G++     LD E      F + A+           FR  RD      ++ VTV++ D NDN P+ 
Sbjct:  738 NDNPPLFSQSAYATTLSEAALIGISVLQVSATDADIGSNKALYYQIINNGKNSSECF------YIDSSSGLILTSRFLDYEQNQVHNFLVRASDSGMPFLTSDVPVTITVTDINDNPPVFNQLLYEAFVSELAPRGHFVTRVQASDADASDTDKLEYSILSGNDH-------MNFVVDGKSGIISISNLRKQTLAPQYRLNISVSDGVF-----TSTAQVHVNIQSANLHSP--IFGQ------NEYVK-EIPENSEVGTLLTLVQATDKDWGPLGHVSYSIVNQFAGDRFTID--------ENGQIFTSEP---LDREDPLERVFDINIMAKDGGGRVGFTT-VKVIATDENDNKPTFVTNEYFGNVLARAEKGTAILQ-----VLATDPDEGSNADLVYTLYKGESDAVEDVLEVQPLTGHVVTKESLVGLEGSRM---SFFVKAEDKGPERKHSVVPVSVSVLPADAELPAFTEAAYALTVAEDAEVGSEIGVARLAGNDS---------ATYAAVPGGG-GAENNADDTFVVLSQTGRLKVAKALDHETVRSYRFGVKAT-----------FR--RDEVDVVAQVLVTVHVGDVNDNRPVF 1272          

HSP 9 Score: 73.9442 bits (180), Expect = 1.771e-13
Identity = 111/493 (22.52%), Postives = 208/493 (42.19%), Query Frame = 3
Query:  744 KIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQE----SFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDL-GVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYV---GKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMM 2195
            ++ + V++ N+  PQFS+  YE+ + E      E+L L   D+D  +    S+ F+  ++ D+ +  +     +  AL  +  LD+ET   +   ++ +D   P + + A V V V + ND  P  +F       S+ Y    +        V+ +V +  D      +   IE        SF ++   T  +L   K        + DR     + + +   D  G      T  + V++   ++  P F+S  Y   V E  R    V +    + A+ +      TV Y I +   + ++ F ++  +GV+ T   LDYE+     ++I A ++ G+   S++  + +++ D NDN P  D S Y   + E     T V     V +  + TD+++++  + +  ++          A   F+ID+ +G I    VLD E + +  F +  S     D G     +       +VT+ +LD ND+ P+ 
Sbjct:    1 QVEVSVINTNEHRPQFSRPRYEVSVAEETPPNTEILRLNATDRDDTS----SLTFSIVSSTDVASLRKFKLDYNTGALSTVESLDHETKQSHILTVMVRDSEIPVQKAYATVVVNVRDSNDHAP--LF------TSRHYEGRVVESAALGSAVLEVVALDRDRGPNAEVAYSIEAGNRNVGNSFTIH--PTMGILSVAK--------ELDRAVVEAYELVVRAVD-RGEPPRSATTAVRVLVTVADNAPPKFTSKDYSAEVSEGARPGSFVLM----VTASSRS-----TVNYEIRD--GNFEDTFYVNPTSGVITTKELLDYERKPSYQLKIQATNMVGL---STNASVSIHLSDENDNAPVFDRSQYRGVVSEEAQAQTVVLNDKNVPLVIRATDLDSEQNSLLVYQIV-------EHEAQTYFSIDSSTGAIKMIKVLDYEKTPEFHFQVRVS-----DSGSP---KLSAETPANVTITVLDANDSPPIF 441          

HSP 10 Score: 55.0694 bits (131), Expect = 1.002e-7
Identity = 50/215 (23.26%), Postives = 87/215 (40.47%), Query Frame = 3
Query:  276 PIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGK-PPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASS 917
            P+DRE   +    +   + +   GG+ C    + S ++              NDN+P FP   Y   + E++ + + ++   A D+D    G+         ++   +F       +D +  I+ +K  +DRE     E T+ A DG    P      + + VLD ND  P F Q  Y     E    G  +L +    KD+G N +++ +  S 
Sbjct: 1702 PLDREAVPA----YALSVRATDGGGRSCQAEILVSLEDV-------------NDNAPQFPASHYAVSVYESTAVETLLTRVQATDSD---LGLNRKVTYSFLDSAGGHFA------IDERSGIISLKRPLDREHQAVYELTVRAEDGDVFRPLTSTVGVSVAVLDVNDNPPAFEQREYHAAAPEDAAPGSAVLSVLAISKDAGANAEVTYSVVSG 1890          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 201.83 bits (512), Expect = 1.320e-52
Identity = 187/672 (27.83%), Postives = 297/672 (44.20%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDF----VDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIY-INEGTTKDMVICLVKVTDDD--NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAII---ASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAMEKL 2417
            NDN+P F   +Y K + EN  I   ++   A D D+              EN  V ++L   D     V+    ++  K  +DRE        + A+D GKP +     I L + D ND  PQFSQ  Y + + E+   G  +L +   D D+G NG+++ +  S  +    N F++  T     + ++  +D E +  Y+  + AKD G PP  STA V + V + ND          N PI       Y I+EG +    + +V  TD D  + A      +     +F +NA+  N VL  +K        + +RET   + ++I  SD  G   +    +L V++ D+NDN PVF+S  Y G V+EN       +    + A D D G N  + Y I +  D+ +  F I+  +GV+ T   LD+E+     +E++A D     +++    ++N+   ND  P      Y+  + EN P  T V KV+ +D+D+            +++ G      + +D+ F+ID  SG I T  VLDRE+ S     +    A NP PL            +    VT+ ILD+NDNSP               + S   +S  EN  P +  +F     D DEG N+++   +  ND F +    G++   + L
Sbjct: 1093 NDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDE-------------GENAKVTYELSVGDTSKFEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHG---NAFRIDSTTG--RITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADEND----------NSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSAFAINAM--NGVLTVKK--------EINRETVPTYTLTIRASD-RGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLT---VAADDSDVGANAVLRYSIISGNDEKR--FKINSTSGVIMTTTPLDFEEKSQYGLEVTATDSKYTAKTNVTIRVINL---NDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS------FGSLSYSIVGG------KDSDK-FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNP-PL------------SNLTWVTIKILDENDNSPKF-------------DSSSYSSSILENSAP-SSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQPL 1677          

HSP 2 Score: 188.348 bits (477), Expect = 2.133e-48
Identity = 187/650 (28.77%), Postives = 289/650 (44.46%), Query Frame = 3
Query:  255 GRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFA--SSTNQDIQNT-FQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENR-VNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPM 2192
            G +T R P+DRE   S    +   IN+    G    F+   +         + I + D NDN PTF   + +  I E+S   +R+    A D D  P G  +Y I   N+     F+L      D +  IL V+  +DRE I      + A D G P +     I + VLD ND  P+F + ++  +I+E       +L ++VEDKD G+NG I+++ +   S N  I +T F LS+T           LDYET   Y   + A+D G P +S+TA V++ + NVND+ P+ V       I +  A   IN          +VK+   D+    +T +I            +++ ++   K          DRET T ++  +V +   G       N   + + D+NDNAPVF+   Y   + EN  + + V      + ATD+DEGEN  V Y +S V D  K  F ++  TG+V T   LD E     S+ ++A D G P +S+   + + + D NDN P+   S Y+  + EN   G+ + +V  +D D   N +     I           S      F ID+ +G+I    V+DRE  +     I A +     +    F          V + + D+NDNSP+
Sbjct:  740 GEITTRVPLDRETIAS----YSLTINAD--DGSLVRFMAATT---------VNISIADENDNQPTFTGPSRFN-ISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNS--FQL------DPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDNFTIDSTGFVLSKT----------PLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVA---IN--------THVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSGLISVAKR--------LDRET-TANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVA----KVTATDRDEGENAKVTYELS-VGDTSK--FEVNPATGLVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSII-----------SGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAF----------VAITVADENDNSPI 1307          

HSP 3 Score: 159.458 bits (402), Expect = 1.900e-39
Identity = 180/704 (25.57%), Postives = 288/704 (40.91%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTED---FVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVF----YQF----NKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRV--NEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAMEKLP------------PIGDYKTVIVAEDGDF 2468
            NDN+P F    Y   + E+  + S +    A D D    G+          N  + + L++ D   F  + Q ++  K   DRE     +  L A DGG P R G+  + +++LD ND  P FS   Y   + E    G  ++ +   DKD+GNN  +  +F   T+ +  + F L   + GV + +   LD+E  + Y+  L   D G PP + T+ + + V ++ND+PP  VF    YQ     N P   Q +    +  T   +V  ++K  DD                 F ++       +     YE K++ D             V +   G+     T ++ + I+D+ND++PVFS   Y   + E+ V  + +VT+      ATD D G  G +EY +  +  ++K  F+ID N+G ++    LD E     S+++ A+D G   RSSS ++ + ++D NDN P +    Y F + E+   G  +G+V  TD D   N         N               +F+I+  +G I  K  LD E  +Q    + A         KD     R ++ + V V + D NDN P                 S    +  EN+     V +     D D G N K+        Y  L+ +  M  AM++               I  Y   I A+DG  
Sbjct:  162 NDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLD---VGI----------NARLSYSLVSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSF---TSGNTNHAFTL-DAVTGV-VTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPP--VFSPSAYQSRVKENTPAGTQVSATDRDSSTNGALVFGIIKGNDDG---------------VFTIDGSTGIISIAKSPDYENKTRYDL-----------TVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVT-----ATDLDSGPRGRLEYRL--ISGNVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSP-IFQGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNT-------------DVFSINTSTGLITLKTQLDYEKKTQYMVTVTA---------KDGGTPSRSSLTV-VKVMVDDVNDNPPQFAK-------------SLYTCTVGENLAAGVAVCY-VTATDADSGANGKIS-------YSILSGNENMAFAMDRFTGEITTRVPLDRETIASYSLTINADDGSL 767          

HSP 4 Score: 146.362 bits (368), Expect = 2.184e-35
Identity = 181/684 (26.46%), Postives = 280/684 (40.94%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDE-NDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQAD---SITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNN-DYFSLTPDYGMLCAMEKL--PPIGDYKTVIVAEDG 2462
            NDN+P FP  +Y   I EN+   +++++  A D D       +Y +      F    K M        + +  + H+    +  RI     A DG     K  T + L  +D+ ND  P F+  +Y+  + E    G  +  L   D D G N ++S +  S       +T   +    GV ++     D ET   Y   L A+D G P RS  A VE+ + +VND+ P     Q+   + +  A           MV       D+ N AD   S T     +  +F L+A+ T  V  +R        +DF  E ++ + + +  +D  G   L  T+ L + + DINDN PVFS   Y   VKEN      T     + ATD+D   NG + + I    DD    F+ID +TG++      DYE      + + A+D GVPV+  + ++ + ++D ND+ P    S YS ++ E+  IG+ V  V  TD D+             L+ G   G        F ID  SG I     LDRE +      + A +                +    VT+ + D NDNSP+      P V  V           +E+  P + +       D D+  N  VR  + +N D FS+    G++    +L       Y   + A+DG
Sbjct:   64 NDNAPEFPLNSYVFNIRENTPA-AQVAIVTATDRDSGTNAAITYSL------FSGENKFMMNSKTGEIRTVTPLDHETKDSYTMRIS----AFDG-----KHTTFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSG------DTSYFTVDSQGV-IRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVA-------IGAAMVTVTASDKDNGNNADLRYSFTS--GNTNHAFTLDAV-TGVVTVSR-------SLDF--EQRSSYALGLSVTD-RGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKEN------TPAGTQVSATDRDSSTNGALVFGIIKGNDD--GVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDS----GPRGRLEYRLISGNVKGA-------FNIDANSGSIRVSSELDRETTPSYSLQVEARD----------GGSTSRSSSTRVTIALQDINDNSPIFQ---GPYVFRV-----------SESSSPGHQIG-QVAATDADDSSNGDVRYALSDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDG 660          

HSP 5 Score: 141.739 bits (356), Expect = 5.216e-34
Identity = 142/518 (27.41%), Postives = 237/518 (45.75%), Query Frame = 3
Query:  642 ILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPN-PLDYGKDLFRQFRDTMEISVTVNILDKNDNSPM 2192
            I     + DRE   R   T++A D      KG+T +++ V DEND  P+F    Y   I+E+     ++  +   D+DSG N  I+ +  S  N+ + N    S+T     ++ ++ LD+ET + Y+  + A D     + +T +  + V +VND+ P   F+  +   +  Y  + +       +V  L  V  D      ++  + +   S++   + +  V        I++K  FDRETK  + V++   D    ++  Q   +E+ I D+NDN PVFSS +Y   V E+       +    + A+DKD G N  + Y  ++   +  + F++D  TGVV     LD+E+    ++ +S  D G P  + +  L++NV D NDN P    S Y   + EN P GT   +V+ TD+D+             L+ G   G     D +FTID  +G I      D E  ++    + A +   P+ Y         DT +  VT+ I D ND+SP+
Sbjct:   21 ITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIREN-TPAAQVAIVTATDRDSGTNAAITYSLFSGENKFMMN----SKTGE---IRTVTPLDHETKDSYTMRISAFD----GKHTTFVPLITVDDVNDNAP---FFALSVYKTGVYEDVAVGS-----IVRQLTAVDLDVGINARLSYSLVSGDTSYF--TVDSQGV--------IRTKGAFDRETKASYQVALRAQDGGSPSRSGQAT-VEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVT---VTASDKDNGNNADLRYSFTS--GNTNHAFTLDAVTGVVTVSRSLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFSPSAYQSRVKENTPAGT---QVSATDRDS--------STNGALVFGIIKGND---DGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKY---------DTAQ--VTIFIEDVNDHSPV 477          

HSP 6 Score: 139.813 bits (351), Expect = 2.399e-33
Identity = 186/724 (25.69%), Postives = 305/724 (42.13%), Query Frame = 3
Query:  228 DTDSFQL--INGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSI---TCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIK--DINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            DT  F++    G VT +RP+DRE+  S S +  T ++           I +  ND              +NDNSP F +  Y   + EN+   S I   +A D D    G  +Y I   N      F+      +D+    + V   +DRE +     T+ A D G PP      + + V DEND  P F+       I E    G  +  +   D+D G+N ++   F S    D  + F +   ++GV L +  +++ ET+  Y+  + A D G P  +S   + V V +VND+PP      FN   S+ Y    + E + +   +  V   D D  A+++   +      ++ F +N+  T+ V        I +    D E K+ + + +  +D+      K T K  V I+  ++ND  P F+   Y   V+EN       +    + A+D+D    G++ Y I    D  K  FSID+ +G++ T   LD E +   +I++   D G P  S+   + + + D NDN P+ D S YS  + EN    ++  K+  TD D   N +             T   S+  +  F I   SG I     LDRE  S    AI A      D+G            I++ V ++D ND+ P++               S ++ S  EN  P+       +  D D G N+++  ++ +N++ S+
Sbjct: 1142 DTSKFEVNPATGLVTTKRPLDREDQASYSLR-VTAMDHGKPSQSAVAAITLTIND--------------LNDNSPQFSQSKYTLTVTENTANGSNILRVLASDPDAGANGRVTYSIISGNHGN--AFR------IDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQV---FYSIVRGD-TSAFAI-NAMNGV-LTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPP-----VFN---SQSYIG-SVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINS--TSGV--------IMTTTPLDFEEKSQYGLEVTATDS------KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVK---VSASDRDS--FGSLSYSIVGGKDSDK--FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARI------------TYNLSR--NDAFMIGASSGVITLAQPLDRENKSTYDLAIQAR-----DHGTP-----PQASSITIRVTVIDINDHRPLI-------------NSSSLRGSVREN-QPKETHVMRILASDADTGLNAELTFSLLSNEHKSV 1766          

HSP 7 Score: 135.961 bits (341), Expect = 2.987e-32
Identity = 162/652 (24.85%), Postives = 272/652 (41.72%), Query Frame = 3
Query:  255 GRVTLRRPIDREEYCSKSNKHQTYINSQCCG---GQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTED----FVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSP 2189
            GR+T+   +DRE   S    +   I+++  G        F+ I   D               NDNSP F        I E   I SR+++  A D D+               N  V++ ++  D     ++    +L VK +I+RE +     T+ A D G P      ++ + V D ND  P F+   Y   ++E+      +L +  +D D G N  +  +  S  ++     F+++ T  GV +   + LD+E  ++Y   + A D     +++   V + V N+ND  P   F Q N   S       + E +     +  V  +D D+   S++  I   ++S   +  + + ++              DRE  +L+ + +  +D  G   L     + + I D NDN+P F S  Y   + EN      +     + ATD DEG N  + Y +S       + F I  ++GV+     LD E      + I A+D G P ++SS+ + V V D ND++P ++ S     + EN+P  T+V ++  +D DT            +LL       S     +FT+DN +G I TKV LDRE  +     I  +     D G        D     V ++++D++DN P
Sbjct: 1258 GRITVVGVVDREALAS----YNLTISAKDSGVPPWVSTAFVAITVADE--------------NDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDE-------------GSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDE---KRFKINST-SGVIMT-TTPLDFEEKSQYGLEVTATDSKYTAKTN---VTIRVINLNDITP--AFTQQNYTAS-------VRENSPTSTSVVKVSASDRDSFG-SLSYSIVGGKDSDKFSIDQRSGIISTADV--------LDRELVSLYAIQVRVTDA-GNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFK---LAATDADEGTNARITYNLSR-----NDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADT----GLNAELTFSLL-------SNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVA-----DKGNPSLSSVAD-----VIIDVIDEDDNCP 1822          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 192.2 bits (487), Expect = 1.062e-49
Identity = 198/709 (27.93%), Postives = 302/709 (42.60%), Query Frame = 3
Query:  432 NDNSPTF-----PEKTYYKEIL-ENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTD-DDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPG-PTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIA--SNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNN--DYFSLTPDYGMLCAMEKLPPIGD---YKTVIVAEDGDFNNSRKQEFLINIHI 2510
            NDNSP       P     K I  ENS IN+ I+  +  D D         +I   ++      + +   F+  ++P+       DRE +     TL   D G P R     +++ V D ND  P F+   Y   I E    G  +L L   D D G+NG +S    S T  +    FQ+        +     LD E ++  +  + A+D G  P++ +  V V + + ND+ P  +   +   IS         EG +    +  V  TD D      IT EI +S         + N + E N +T  + +K   DRETK+L+  +++  D  G  QL  + K+E+ I DINDNAPVF    Y+  + EN     +      + ATD DEG N  + Y I  +  +    FSID +TGV+ T+  LD+E  +  S+ ISAKD G    + +  + V V +  DN P      Y+F +YEN P GT VG+V  T KD +            ++ G PT         +F +D+  G I     +DRE  +Q   A+IA      PL            + + +V + +LD+NDN+P           +V  ++        +  +    V +    VDLD G+N  VR  + +N      +    G++    KL   GD   Y   ++A D   + S  Q   + IHI
Sbjct:  307 NDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEGCFKVEFLGFYFIQLQKPL-------DRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSY---SITGGNDLGWFQVD--FQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTIS---------EGASIGATVLQVSATDVDSGDNGRITYEISSSDA-------QVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKD-HGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLL----QVTATDADEGTNAVISYDI--IGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKN------GSISYAIVSGDPT--------NLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPL------------SAQATVNIEVLDRNDNAPQF------STSSVIVDI--------DGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTSNAEGLLWINSTSGVIKLARKLTD-GDETQYTVQVLASD---SGSPPQHSTMTIHI 936          

HSP 2 Score: 189.889 bits (481), Expect = 6.903e-49
Identity = 187/705 (26.52%), Postives = 312/705 (44.26%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKI--SINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVF-----YQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSIT-CEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVR---VTMKNNDYFSLTPDYGMLCAMEKL-PPIGDYKTVIVAEDGDFNNSRKQEFLINIHI 2510
            NDN P FP   Y   I E+  +N+   +  A D D    G   Y I   +      F L T          +I K  +DRE  D  +  + A D G P   G   I + +LDEND  P F+Q  Y   I E+   G+ +L +   D+DSG+NG I  +I++ +  +  I   F L  +   +  K    LD+E  N Y+FN++A D G P ++  A V + V + ND+ P +       +  +K I  + + I  N        I  + VTD D+  +S T  +I    +            +E    Y I+ +   DRE    + +++  +D +G+        + + + D+NDN+P F+S  Y   + E   N    +  +   ATD DEG+NGTV Y I+   D    +F +D  +G+V T   LD E++  V+I I+A+D G   ++ S  + V + D NDN+P    S Y   + E   IG  V +V+ TD D+  N +                +    + +F ++ ++G ++TK  LDRE  S   F ++A      D+G     Q   ++++ +T++  D NDN+P+             P   F     NE   P   +       D DEG N+ +    +   NN  FS+    G++  +  L   + ++ ++I++     N    +  ++N+ +
Sbjct:   89 NDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNT--ATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSI---FDLDSSTGVIRTK--QNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTN--------IAYILVTDKDSNTNSQTELKITNGDDEGCFK-------VEFLGFYFIQLQKPLDRELVPFYNLTLNVTD-KGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLN---ATDPDEGDNGTVSYSITGGND--LGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISS---------SDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAK-----DHGD---PQLMSSVKVELTIS--DINDNAPVFY-----------PVEYFASIMENE---PPGKL-LQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTV 731          

HSP 3 Score: 124.79 bits (312), Expect = 9.587e-29
Identity = 151/586 (25.77%), Postives = 242/586 (41.30%), Query Frame = 3
Query:  186 GRSGLKSDSFYLSEDTDSFQL--INGRVTLRRPIDREEYCSKSNKHQTYINSQCCG-----GQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVF--YQF----NKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDT 1904
            G +G  S S     D   FQ+   +G VT  +P+DRE+  S +      I +Q  G     G   + + I                   NDN P F + +Y   I E + I + +    A D D    G  +YEI   +   +  F+L T+        +L  K Q+DRE      FT++A D G P      K+ L + D ND  P F  + Y   I E+E  G +LL +   D D G N  IS +     N      F +  +  GV +  ++ LD+E    +S  + AKD G    + TA+V V V N  D+ P  ++  Y F    N P      R+Y    TTKD             +  SI+  I        ++   TN  L +     IK   D DRE K  + ++++      +  L     + + + D NDNAP FS+      +    +   V  N     A D D G+NG V Y +++   + +    I+  +GV+K    L        ++++ A D G P + S+  + +++  + ++ P+  LS Y   +  ++P+      V   D+D+
Sbjct:  455 GDNGTVSYSITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVT----ITITAQDHGSAPKTGSTTVTVTIIDG----------------NDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQ------TGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPG-KLLQVTATDADEGTNAVISYDIIGGNN---NGNFSIDSST-GV-ISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVY---ATTKD-------------KNGSISYAI--------VSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIAR-VGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNA---AAVDLDAGKNGLVRYQLTS---NAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHST--MTIHITLSINHPPKFTLSSYVTHVLASQPLSYQFFYVVAVDQDS 975          

HSP 4 Score: 119.398 bits (298), Expect = 4.256e-27
Identity = 170/715 (23.78%), Postives = 289/715 (40.42%), Query Frame = 3
Query:  444 PTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETI------NKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS---ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQF---------RDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTM--KNNDYFSLTPDYGMLCAMEKLP--PIGDYKTVIVAEDGDFNNSRKQEFLINIHIKEDP 2522
            P F   +Y   +L +  ++ +    +A D D    G   Y I + NE  +  F +    F   K   L ++  + +      +  + A DGG P       + + + D ND    F    +   + E+   G  +  L     D      I  +  SS     ++ F +      +  ++  +LD E +      N Y     A       +   A+V V VT++ND+ P  VF       S+    I ++E +     +  +K  D D   ++    +    T  + F++N+           T E+      DRET + + + +  +D    N L  T K+E+ + D ND  PVF    Y   + E+ +   + IN +   A+DKD G+NG ++Y ISN   ++   F ++  TG +     LD+E  +   + I+A+D G+   SS+V + VNV D NDN P       +  + EN   G  VG+   +D+DT  N                   SQ   + F++++ + +I T   +D E                +  G+D F+           + +   S+TV + D+NDNSP  +    P   A    ++ + T T E               D D   N KV  ++   NN YF+L P  G L  + ++P  P   Y+  I A DG    SR+ + ++++  KE P
Sbjct:  944 PKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNE--EGLFGI----FPGGK---LYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQDSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISS-----ESHFAVDVRSGQITTRV--RLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAP--VF-------SRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINS----------STGELHLSKTLDRETTSSYNLVVKATDASNAN-LYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLN---ASDKDIGQNGLIKYSISN--GNLAAMFDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMY-----------SQTPSKTFSVNSATCEITTIAAIDLET---------------MPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFV---SPPAAAAGSSLN-VMTITAE---------------DPDRNSNGKVTYSIISGNNGYFNLHPSTGQLQMIHQIPDNPT-IYQLTIQASDGG-QPSRQTQTVVSV-FKEGP 1569          

HSP 5 Score: 116.316 bits (290), Expect = 3.595e-26
Identity = 149/543 (27.44%), Postives = 227/543 (41.80%), Query Frame = 3
Query:  192 SGLKSDSFYLSEDTDSFQLINGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETI--NKYSFNLV--AKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDIN-DNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKI-KHVSIEISAKD-LGVPVRSSSVKLIVNVKDTN 1799
            SG   D F+++  T       G + L + +DRE   S +                 +    ASN N      I+I V D ND  P FPE  Y   I E++ I S +    A D D    G+  Y I   N N    F       V++    LIV   +D E     E T+ A D G  P      + + VLD ND  P F      + ++E+  TG  +      D+D+G N  I+ +  S   Q    TF ++       +  I+ +D ET+   + SF LV  A D G P  S+   + V VT+ ND+ P  V    + P +   + + +   T +D          D N    +T  I  S  + Y N   +   L+    ++I        +  T++ ++I  SD  G    +QT  +  + K+      P FSS  Y G V EN+V     +    +LA       NG +EYY+++  D  K  F + K+TGVVKT  G+D E +    ++ + A D  G   R+SS  + + V+D N
Sbjct: 1200 SGTGMDKFFINSST-------GELHLSKTLDRETTSSYN---------------LVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSIS--NGNLAAMFD------VESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYS---QTPSKTFSVNSAT--CEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFV----SPPAAAAGSSLNVMTITAED---------PDRNSNGKVTYSI-ISGNNGYFNLHPSTGQLQ--MIHQIP-------DNPTIYQLTIQASD--GGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSVVT---VLAAYPQSSLNGNIEYYLTS--DSSKGGFEVVKSTGVVKTTRGIDREGMGASFNLVVYAVDKQGPSARTSSATVTITVQDVN 1677          

HSP 6 Score: 100.523 bits (249), Expect = 2.217e-21
Identity = 139/569 (24.43%), Postives = 223/569 (39.19%), Query Frame = 3
Query:  210 SFYLSEDTDSFQLINGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXX--NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKL-----MTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDD---NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTL---HFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGL-DYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYV 1874
            S   SE   +  + +G++T R  +DREE    +  +   + ++              ND T K+    + V     NDN+P F    Y   + E S   S +    A DAD+              +N   ++ L     M + F+++    L +   +DRE        + A D          KI + V D ND  P F +  Y + I E  + G  +++L   DKD G NG I     S +N ++   F +        L +   LD+ET   Y   + A+D G  P SST  V V V +VND+ P  +F         Q   + + E       +     +D D   N   + +   +T  ++F +N+           T EI +    D ET       F  +V +  +G  +L     + V + D NDN+P F SP               ++N   I A D D   NG V Y   +++     YF++  +TG ++ I  + D   I  ++I+  A D G P R +   + V  +      P    + Y   + EN+  GT V
Sbjct: 1088 SLISSESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAM-----------YNDTTIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADE-------------GDNAKFFYSLVSGTGMDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKY---SISNGNLAAMFDVESATG--RLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAP--LF-------PTQPVTLTVRENVNTGFPVGRCTASDRDTGTNAHIAFSMYSQTPSKTFSVNS----------ATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPAAAAGS--------SLNVMTITAEDPDRNSNGKVTY---SIISGNNGYFNLHPSTGQLQMIHQIPDNPTIYQLTIQ--ASDGGQPSRQTQTVVSVFKEGPIGGGPTFSSADYQGSVTENKVAGTSV 1595          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO48237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKF4])

HSP 1 Score: 171.785 bits (434), Expect = 3.049e-43
Identity = 143/494 (28.95%), Postives = 240/494 (48.58%), Query Frame = 3
Query:  435 DNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDF--VDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFY--LNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDT 1904
            +N P F        + E++++ + ++   A D D    G+  Y +  P++N      LM+  +  +D    ++  K  +DREF+DR  F + A DGG+P  +G   + + VLD ND  P F + IY   I E +  G  +L +R  D DSG+NG++     +S   +  + F + +     A+ ++ KLD E +  Y+  + A+D G PPRS+T  V++ + +VND  P     QF+K   K Y+   I E    + ++  V+ TD         C+  ++ E F+  ++    N    NR   E++ K   D E   + F  +V +  +G   L     +++ + D+NDNAP F S  +  ++ EN     V      + A DKD G NG + +  S + +D+   FSI++NTG +     LD EK+   +  I A+D GVP +  + ++ + + D NDN P+     Y   + EN   GT V +V   D D+
Sbjct:   15 NNPPQFSRLQEDASVSEDAEVGTVVATVSASDPDSGSNGMIRYSMS-PSQN------LMSATYFSIDQITGVITTKRGLDREFLDRHFFRVKAEDGGEPSLEGYMDLTINVLDVNDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDN--SAFSIGEV--SGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTP-----QFSK---KVYSAT-IREDVPVNQLVTTVRATD---------CDQGSNGEVFFEIVSGNDMNFFSINRINGEVRVKQKLDYEMIGV-FNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYA---VGQEFYRVQAYDKDHGTNGEITF--SFMQNDLP--FSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDS 471          

HSP 2 Score: 162.54 bits (410), Expect = 2.350e-40
Identity = 149/558 (26.70%), Postives = 249/558 (44.62%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNE-NFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQN--TFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQ---ESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASN 2087
            ND +P F +K Y   I E+  +N  ++   A D D    G   +EI   N+ NF    ++  E         + VK ++D E I      + A D G+P    +T + + ++D ND  PQF    ++  I E+   G E   ++  DKD G NG+I+ +F       +QN   F +++   G+++K   +LD E + K++F + A+D G P +  TA + + + ++ND+PP           S++     I E +     +  VK  D D+   ++   I +S      F +N               I      +  TK ++  S+  SD      L  T  + V + D N +AP F    Y   VKE+       +    +LATD+D G N  + Y I+ +V +    FS+D+ TGV+KT   LD EK+     E++A D G+P   +   + +++ D NDN P      Y  ++ E+   G  V +V+ +D D   N + I           +  ++      FTID+  G I T   LDRE   +    ++A++
Sbjct:  228 NDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGNDMNFFSINRINGE---------VRVKQKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDHGTNGEITFSF-------MQNDLPFSINENTGGISIK--EELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPK---------FSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNVVYSIVSSSGHDRCFRINPQGL-----------ITLSCTLNYNTKHVYVFSVSASD----GMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLT---VLATDRDTGSNAKISYSIATLVPE----FSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIY----------SFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATD 726          

HSP 3 Score: 150.984 bits (380), Expect = 1.031e-36
Identity = 183/688 (26.60%), Postives = 293/688 (42.59%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSI-EISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKA-----VNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNN----DYFSLTPDYGMLCAMEKL--PPIGDYKTVIVAED 2459
            NDN P F    Y  +I E+  I   +    A DAD    G   Y I   + +   +        +      + V  ++DRE +      + A D G PPR     + + +LD NDC PQFS+ +Y   I+E       +  +R  D D G+NG++     S  +    N F +++    V +K   KLDYE I  ++  + A+D GQP   +   V++ + +VND+ P  V   F   I + YA   + +   +      V+  D D+  +    EI     SF  N L  +    N  T  I  K + DRE K   F   + +  +G+   + T ++ + + DINDN P FS   Y+  + EN       +    + A D D G    V   +S+   D    F I+   G++     L+Y   KHV +  +SA D    + SS+  + VNV D+N + PE     YS E+ E+  +GT V  V  TD+DT  N K             ++ T  P    F++D  +G I T   LDRE      F + A+     D+G    +      +  V ++I D NDN P+ +   KP  +A     + P    I+ S +                D D G+N+++  +  +N      F++    G++  ++ L    I +Y+  +VA D
Sbjct:  122 NDNGPIFERNIYAADIPEDKSIGDFVLAVRASDADSGSNGEVKYCILNSDGDNSAF-------SIGEVSGAVTVMKKLDREKVPTYTLQVQAQDQGNPPRSATVTVKITLLDVNDCTPQFSKKVYSATIREDVPVNQLVTTVRATDCDQGSNGEVFFEIVSGND---MNFFSINRINGEVRVK--QKLDYEMIGVFNLLVTAQDKGQPFLYNQTTVDIALIDVNDNAPQFVSSHFQTMIPENYA---VGQEFYR------VQAYDKDHGTNG---EITF---SFMQNDLPFSI---NENTGGISIKEELDRE-KVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQ---VKAIDPDSGPTNVVYSIVSSSGHD--RCFRINPQ-GLITLSCTLNYNT-KHVYVFSVSASD---GMLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISY----------SIATLVPE---FSVDETTGVIKTAGSLDREKVDTYRFEVTAT-----DHGIPQLKA-----KSFVYIHIADVNDNDPVFL---KPSYEAKVREDIRPGGRVIEVSAS----------------DADIGKNAQIIYSFASNGDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATD 726          

HSP 4 Score: 149.828 bits (377), Expect = 2.220e-36
Identity = 165/599 (27.55%), Postives = 264/599 (44.07%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDF---VDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLS-QTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKEN-----RVNEIVTINKDPILATDKDEGENGTVEY-YISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMM 2195
            NDN+P F    +   I EN  +        AYD D                N ++ F  M  D    ++     + +K ++DRE + +  F + A D G P ++G  +I + +LD ND  P+FSQ  Y   I E+   G  +L ++  D DSG    +  +  SS+  D    F+++ Q L    + L   L+Y T + Y F++ A D      SSTALV V VT+ N   P     +F +   + Y+   + E  +    +  V  TD D  +++ I+  I T    F ++  +T  V        IK+    DRE    +   +  +D  GI QLK  + + + I D+NDN PVF  P Y   V+E+     RV E+         A+D D G+N  + Y + SN   D +  F+ID   G+++T+  LD E I    + + A D G P   +SVK+ V ++D  D+ P  +   Y   + E+ P  + V  V    +D       +   ++   P           Q+F I+  +G I T + LD E  S+    + A+          L   F +T   +V V + D NDN+P++
Sbjct:  333 NDNAPQFVSSHFQTMIPENYAVGQEFYRVQAYDKDH-------------GTNGEITFSFMQNDLPFSINENTGGISIKEELDREKVPKFTFGIKARDKGVPFKEGTAQITITLLDINDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPT-NVVYSIVSSSGHD--RCFRINPQGL----ITLSCTLNYNTKHVYVFSVSASD---GMLSSTALVYVNVTDSNTHAP-----EFKR---RSYS-AEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPEFSVD--ETTGV--------IKTAGSLDREKVDTYRFEVTATD-HGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVS--------ASDADIGKNAQIIYSFASN--GDGQGTFTIDSTQGIIRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPEDTPPRSPVITVKAKSQDLSPETGMMYSIVRGNSP-----------QVFDINPNTGAIQTLMKLDYETQSEYRLTVRAT----------LSPFFTET---TVMVYLKDINDNTPVL 854          

HSP 5 Score: 113.235 bits (282), Expect = 3.271e-25
Identity = 99/366 (27.05%), Postives = 164/366 (44.81%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRV 1529
            N ++P F  ++Y  E+ E++ + + +   +A D D       SY I            L+ E  VD    ++     +DRE +D   F + A D G P  K K+ + + + D ND +P F +  YE K++E    G  ++ +   D D G N +I  +FAS  N D Q TF +  T  G+ ++ +  LD ETI +Y   +VA D G PP  ++  V+V + +V DSPP      F KP+ +    + + E T     +  VK    D          ET      +          N  T  I++ +  D ET++ + +++  +    ++       + V +KDINDN PV  +      V+E +V
Sbjct:  537 NTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIAT----------LVPEFSVDETTGVIKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDPVFLKPSYEAKVREDIRPGGRVIEVSASDADIGKNAQIIYSFAS--NGDGQGTFTIDST-QGI-IRTLKPLDRETIPEYELTVVATDQGTPPGQASVKVKVILEDVKDSPP-----LFEKPLYE----VTVPEDTPPRSPVITVKAKSQDLSP-------ETGMMYSIVRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRAT----LSPFFTETTVMVYLKDINDNTPVLEAFHMNINVQEGKV 868          

HSP 6 Score: 105.916 bits (263), Expect = 5.895e-23
Identity = 119/469 (25.37%), Postives = 207/469 (44.14%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIET---SQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPIL---ATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVD 1820
            NDN P F ++ Y+  I ENS+  + +    A D D  P  V  Y I   +   D  F++       N Q ++ +   ++        F++ A DG          + + V D N   P+F +  Y  ++KE    G  +L +   D+D+G+N KIS + A+   +     F + +T  GV +K    LD E ++ Y F + A D G P   + + V + + +VND+ P      F KP  +   R  I  G     VI +     D  +   I     +    Q +F +++  T  ++   K          DRET   + +++V +D +G    + + K++VI++D+ D+ P+F  P Y   V E+      T  + P++   A  +D      + Y I  V  +    F I+ NTG ++T++ LDYE      + + A    +    +   ++V +KD NDN P ++
Sbjct:  436 NDNPPKFSQEEYHTSIAENSRWGTSVLQVKAIDPDSGPTNV-VYSIVS-SSGHDRCFRI-------NPQGLITLSCTLNYNTKHVYVFSVSASDG---MLSSTALVYVNVTDSNTHAPEFKRRSYSAEVKEDASLGTSVLTVLATDRDTGSNAKISYSIATLVPE-----FSVDETT-GV-IKTAGSLDREKVDTYRFEVTATDHGIPQLKAKSFVYIHIADVNDNDP-----VFLKPSYEAKVREDIRPG---GRVIEVSASDADIGKNAQIIYSFASNGDGQGTFTIDS--TQGIIRTLK--------PLDRETIPEYELTVVATD-QGTPPGQASVKVKVILEDVKDSPPLFEKPLYEVTVPED------TPPRSPVITVKAKSQDLSPETGMMYSI--VRGNSPQVFDINPNTGAIQTLMKLDYETQSEYRLTVRAT---LSPFFTETTVMVYLKDINDNTPVLE 855          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 164.466 bits (415), Expect = 5.932e-41
Identity = 171/590 (28.98%), Postives = 251/590 (42.54%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVL----ENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSP 2189
            NDN P F   +Y  E  EN++I   I    A D D   F +  + IE+ N +         E F  +   ++ +   +DRE  D    T+ AVDGG      K  + + VLD ND  P FS+  Y   I+E       + H+    +D G N ++  +  S  N D       + TL+     L S++D+E I      + AKD G PP    A V + V ++ND+ P     QFN         + + E T        V V D D+            + SF L  L     L     N     +   ID+    ++  +   V +   G      T  LE+ + D+ND +PVF +  Y   V E    +   I    ++ATD D GENG + Y   + VD  K  F + +N G +     LD E I+  ++++ A D G P RSSS  + V V D NDN P    + Y+F + ENEP+ TY+G V+ +D D   N          +               F +D ++GKI T  VLDRE  +   F+I+A++      G    R      +  VTV + D ND SP
Sbjct:  593 NDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNAD---------EVFSVDGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSI-SKGNTDNIVLINSTGTLY-----LQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNSP-----QFNS----SSILVRLPEDTPIGHTFYTVSVFDADSGV--------LGRVSFSL--LSNPGTLFNLDSNTGALSLTKLIDYGNSARS--YTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIE---VVATDVDSGENGRISYAFDSKVDTSK--FGL-RNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ-------------FIVDKQTGKITTSQVLDREAKASYVFSIVATD------GGSSPR----VDKTQVTVIVRDVNDCSP 1117          

HSP 2 Score: 163.696 bits (413), Expect = 1.052e-40
Identity = 175/604 (28.97%), Postives = 272/604 (45.03%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTE---------DFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPR-SSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDD---NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENR-VNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMK--NYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMM 2195
            NDNSP+F   T  K ++  +  + R  L +A D+D      +SY I   + N    FKL+++         D V N   I      +DRE +D     + A DGG P   G  ++ + V D ND +P+FS + Y   I E+   G  +L +   DKD G N +I   ++  T+ D Q  F +  T  GV +  + +LDYE    Y   + A+D G   + SS+A+V + V +VND+ P ++   +    S Q     + E  T    +  V V+D D   N   ++T E      S   + L   +++   ++         DRET    F+  VC D +G           + + D+ND AP F    Y   V EN  VN +V I    + A D+D G N  + Y I+N  +     ++F+ID ++G++ T   LD E+I  V + +   D G P  S +  +IVN+ D+NDN P  + S Y+  L+EN P G+ V ++   D D             +L+    L  + P    F +D   G +     LD E+ S   F + A+     D G    R    T+ +S+T    D NDN P+ 
Sbjct:   52 NDNSPSFVRGTSAKLVVFENDKDFRQKL-IAVDSDFGSNSTQSYTIV--SGNVGNVFKLISKRDTDGDLYADLVVNASSI-----GVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEI--QYSIETHSDPQAIFGIHPTT-GVIVNNV-RLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNP-VIHVSYTLGGSYQ-----VTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESIIAVGQS--------LDRETHDHFFLKAVCID-KGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAI----VNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQLLAQDPDIG---------ENSLILYSILTPNTP----FFLDPRKGLVTNSRTLDHEVQSSYTFQVAAT-----DGGG---RSCNATVHVSLT----DLNDNQPVF 599          

HSP 3 Score: 155.221 bits (391), Expect = 4.346e-38
Identity = 190/676 (28.11%), Postives = 295/676 (43.64%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNK-QPILIVKHQIDREFIDRIEFTLIAVD-GGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPP-RSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS---ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQ--LKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENC---VTFPYIFVDLDEGENSKVRVTMKNND---YFSLTPDYGMLCAMEKL 2417
            ND SP F +  Y   + E+  + S +   +A D D           + PN +         + F  N+   +L +   +DRE   R    ++A D GG    +  T I + VLD ND  P F        + E    G  +  +   D D G+NGK+        N +   TF++++T  GV +  +  LD+E  N+Y   + A D G+   ++S  LV ++V + ND+ P    +  N  I+  Y  + IN   T       +K  DDD+  +S    T + ++ +  F +N+          +T  I++    DRE  + + + +  +D     Q  L  T  L++II+D+NDNAP F S     ++++   N  VT     I A D D G+ G VEY I   V      FS+D  TGV+K I  LDYE +   ++ ISA DLG P  +S     V V D NDN PE     +   + EN+P GT V KV   D+D+  N +             ++ +    D+ F+ID  SG I T  +LDRE        + A+          +   FR     SV +N++D+NDN P          K ++P V+           PEN    + +     DLD G N+KV  ++ + +    F++    G L    KL
Sbjct: 1113 NDCSPKFSKNKYSVTVNEDLPVGSSLLTLIATDDDQ----------QGPNSDITYMIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIV---NGNTDGTFKINETT-GV-ISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPT---FDKNPIITWIYENVPINTNVTT------IKAHDDDSGLNSRIWYTIDSQSPRAHFKINS----------ETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVT----SITALDPDTGQGGNVEYRI---VSPDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTY----------SIPSGVEMDK-FSIDKHSGLIVTNSILDREKKDTYFLTVHATG---------VSYPFR-VSSTSVRINVMDRNDNPP----------KFISPVVTL--------KVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIGRSTGELSTTTKL 1708          

HSP 4 Score: 124.02 bits (310), Expect = 1.711e-28
Identity = 126/436 (28.90%), Postives = 206/436 (47.25%), Query Frame = 3
Query:  624 VDNKQPILIVKHQIDREFIDR-IEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNN-GKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIETSQE--SFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKD--PILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYE--KIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDT 1904
            +D    ++  +  ID    D  I+  + A+D G PP++    + + +  E    P+F    Y  K+ E+ M G  +L +RV D  +G   G+IS N  +S      N F++ Q   GV + +   LDYET  ++   + A D   P +     V + V++VND  P  VF Q     S   A+   +EG     ++  V   D D+ A+  +   I++  +  SF ++          RKT  I+++   D ET   H VS+  +D EG   +     + + + D+NDN PVF  P    +    +V E + +N     I ATD+D G N  + + +  +    +  F IDK +G + T +  DYE   +   S+ I A D G P  SS++ +IVNV D ++  P  +   Y F++  N  IG +VG+V  TD+D+
Sbjct: 2252 IDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITRE----PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENS------NYFRIGQR-SGV-ISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKP--VFGQ-----SGYMAQW--SEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGSFAID----------RKTGVIRTQRALDHETIKTHHVSVRATD-EGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDV----QVLENLPLNSRLYEINATDRDSGANARLSFTV--IGGTGQGLFLIDKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFVGQVTATDRDS 2649          

HSP 5 Score: 121.709 bits (304), Expect = 8.150e-28
Identity = 176/697 (25.25%), Postives = 287/697 (41.18%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVES---YEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGG-----KPPRKGKTKIILKVLDENDCEPQF--SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFV-----DLDEGENSKVRVTMKNN----DYFSLTPDYGMLCAMEKL--PPIGDYKTVIVAED 2459
            NDN PTF +      I EN  IN+ ++   A+D D    G+ S   Y I+  +++   +FK+ +E        ++   H IDRE I      + A D       +       KII++  D ND  P+F    L Y   + E E    ++  +   D D+G  G +     S       +T + S  L    LKLI  LDYE + +Y+ ++ A D G PP +S  L  V V +VND+PP      F   +S+            K     +VKVT  D  + S   E+  S  S     ++ +    ++ +  I +    DRE K  +F+++  +      ++  T+ + + + D NDN P F SP     V EN    ++      +   D D G N  V Y I  +  +    F+I ++TG + T   LD E      + + AKD+  P  ++   + + ++D NDN P    S YS  + E  P GT +  +  +DKD+  N   +       L   T G       +++ID+ +G +Y+    +  +  +  F  IA      D G+D          + V + I DKN+++P                  F KT    +I+P    +     V     D D+  N KV   + ++      F +  + G +        PP G +   I+AED
Sbjct: 1324 NDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDS---GLNSRIWYTID--SQSPRAHFKINSE------TGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQ--DLNDNAPKFVSRNLTY---VMEDEPFNFQVTSITALDPDTGQGGNVEYRIVS------PDTGKFSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSEN-----------KPTGTSVVKVTAYDRDSGS-NAELTYSIPS----GVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTS-VRINVMDRNDNPPKFISPVVTLKVPENSPARLIYT----LTVQDLDYGNNTKVLYSI--MSGNTDGAFTIGRSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYT-----LSNDTYG-------VYSIDSRTGIVYSAARFETSIKQEYNFFCIAK-----DQGQDPKMAI-----VPVRIKIEDKNNHAPQ-----------------FTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAED 1936          

HSP 6 Score: 121.324 bits (303), Expect = 1.278e-27
Identity = 168/668 (25.15%), Postives = 265/668 (39.67%), Query Frame = 3
Query:  435 DNSPTFPEKTYYK-EILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQ--IDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQF--SQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQAD-------------SITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFD------RETKTLHFV-SIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEG-ENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQ--IFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTM 2354
            D+ P F  +T  +  I ENSK+ S I+   A  + D      +Y I   N+    Y        VD    ++ V     +D E        L+A   G     G   + + V+D ND  P F  S ++ ++           ++ +   D DSG NGK++ +  +     +   F +  T   +    +  LD ET   +   +   D G PP+S+   V+V VT++ND+PP         P+S+    + I E T    V+  V  TD D ++              +I     T Q+S     +K +  + N    +I  KID D      R T  +    S +    + ++Q     +  V ++ I    P F  P Y+G V EN +     +    +  TD   G   G + Y I N      NYF I + +GV+     LDYE  +   + +SA D   P +   V + +NV D ND +P    S Y  +  E  P+GT V  V+  DKD+  N             G      Q  D    F ID ++G I T+  LD E       ++ A+     D G           ++SVT+ +LD NDN P+  +     V+ +            EN+ P N   +     D D G N+++  T+
Sbjct: 1957 DDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDAQV---TYSIISGNKGRAFY--------VDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGV---FTIDSTTGEITTAKL--LDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPP------LFDPLSE----VNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSD--QIDYKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMMGTSVLT---VRVTDNAAGLPLGRISYNIEN-----SNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGAN-------------GRVWFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRAT-----DEGSPPMH-----TDVSVTIRVLDLNDNPPVFRVPGPNDVQVL------------ENL-PLNSRLYEINATDRDSGANARLSFTV 2552          

HSP 7 Score: 107.842 bits (268), Expect = 1.544e-23
Identity = 146/610 (23.93%), Postives = 250/610 (40.98%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDAD-----DLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKII-LKVLDENDCEPQFS---QLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFAS-----STNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADS--ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQ------PADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMM 2195
            NDN P F   +Y   I EN  + + I    A D D     ++ + +E++    P   F ++    T   V+N +    + ++  R ++      + A D G   +   + I+ ++VLD ND  P       L    ++ E+   G ++  + V D DSG NG++++         S   D+ N   +        + +   LD ET + +    V  D G PPR++     + V +VND  P    + +         R++  E  T + ++ +V   D D  ++S  +     T++   YL+    +       +  I +  D DRE      ++++  D  G   L     + V + D NDN P F+   Y   + EN  +    +    +LA D D GEN  + Y I          F +D   G+V     LD+E     + +++A D G   RS +  + V++ D NDNQP  D S YS E +EN  IG  + ++   D+D+                 P    ++       AD++F++D  SG I    +LDRE        + A +      G+D   +        V + +LD ND  P+ 
Sbjct:  166 NDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHS--DPQAIFGIH--PTTGVIVNNVR----LDYEAKRSYL----IVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKNGEVNVTLEGGDGYFSMKFDVLNDESI--------IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYE-------TRVW--ENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDP-----SSGMITTATDLDREQIPQVVLTVLVHD-RGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPVVQ---LLAQDPDIGENSLILYSILT----PNTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGG--RSCNATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDS-----------------PKFAITRFIIEQGNADEVFSVDG-SGLITLAKLLDRETQDNYLLTVKAVDGG----GQDSVNK------AIVNITVLDVNDEPPIF 703          

HSP 8 Score: 107.071 bits (266), Expect = 2.481e-23
Identity = 116/496 (23.39%), Postives = 202/496 (40.73%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKI--KESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKEN----RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKD 1901
            NDN P F +  Y   I E +   + I    A D D    G   Y +   N+ + VY        +D++  I+    + +        F  IA D G+ P+     + +K+ D+N+  PQF++  YE+ I    S    + ++     D D   NGK++     S N     +  + ++  G +++  +        +++  ++A+D G PP     +V++ + N+ D PP          +++  AR+ I E +     I  V+     +   + +        +FY++       + +    + +S  +F      LH V+      +G   L     L++ + D NDN+P F        + E+    +   +V +      ATD D G NG V Y I     +    F+ID  TG + T   LD E      + I   D G+P +S++ ++ V V D NDN P  D       + E+   G  V  V  TD D
Sbjct: 1744 NDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLS--NDTYGVYS-------IDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNS---TSLFVVESNTG-SVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRF--------LNQTPARVSIPENSKVGSYITTVRARASSDAQVTYSIISGNKGRAFYVDPFTGVISVASADALDYESTKNF-----RLHLVAT----PQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVT-----ATDVDSGTNGKVTYSI--WTGNEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLFD-PLSEVNIREDTRTGAVVTSVVATDTD 2201          

HSP 9 Score: 89.7373 bits (221), Expect = 5.611e-18
Identity = 99/416 (23.80%), Postives = 183/416 (43.99%), Query Frame = 3
Query:  444 PTFPEKTYYKEILENSKIN-SRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQAD---SITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVI-IKDINDNAPVFSSPRY-YGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVV 1673
            P F   +Y+ ++ EN+ +  S +++ +  +A  LP G  SY IE  N     YF+      +  +  ++ V   +D E   R    + A+D   P +  +  + + V D ND +P F Q  Y  +  E    G  ++++   DKDSG NG++   FA  +  D + +F + +   GV ++    LD+ETI  +  ++ A D G PP  +   V + V ++ND+PP    ++   P   Q     + E    +  +  +  TD D+ A+   S T    T Q  F ++            +  + + I FD E   ++  S+    T+  N    +N   ++ + D ++  P F+   Y + +    ++ + V      + ATD+D G+ G V +   N      N   ++  TG++
Sbjct: 2302 PKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSN-----YFR------IGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVW--FAIQSGDD-KGSFAIDRKT-GV-IRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPP---VFRVPGPNDVQ-----VLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKF----------SGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSFNRMDYKFDVPGNAKIGDFV----GQVTATDRDSGDQGRVFFVFYN---PTSNALKMNATTGII 2676          

HSP 10 Score: 88.5817 bits (218), Expect = 1.094e-17
Identity = 140/514 (27.24%), Postives = 218/514 (42.41%), Query Frame = 3
Query:  993 LDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDD--DNQADSITCEIETSQESFYLNALK-TNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQT-NKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLI-VNVKDTNDNQPEVDLSFY---SFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTID----NESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNN-------DYFSLTPDYGMLCAM-----EKLPPIGDYKTVIVAEDG 2462
            LD E ++ Y+  +V  +F  PP+S T L  V+V ++ND+ P+ V            A++ + E   KD    L+ V  D   N   S T         F L + + T+  L         S I  DRE    + ++I  SD  G N       +L + ++D NDN P FS+  Y G + EN ++   +I +  + A+DKD G N  ++Y I     D +  F I   TGV+   + LDYE  +   I + A+D G   + SS  ++ + V D NDN P + +S+    S+++ EN  IGT V +V+V+D D+  N             G    T +  D  F++     N+   I     LDRE         +      +D G D  R    T E S  +N+ D ND +P             N  V+ +    N               VD D G NS++  T+ N         +F++ P  GM+        E++P +    TV+V + G
Sbjct:   20 LDREKVSAYNLTIV--EFSTPPKSYTVL--VYVQDLNDNSPSFV--------RGTSAKLVVFE-NDKDFRQKLIAVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVN-ASSIGVDRERLDSYVLNISASD--GGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPEN-IDVGTSILQ--VSASDKDIGTNAEIQYSIE-THSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVARVSVSDADSGKN-------------GEVNVTLEGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVC-----IDKG-DPPR----TTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNA--------------VDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQV--VLTVLVHDRG 474          
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 159.073 bits (401), Expect = 2.809e-39
Identity = 183/686 (26.68%), Postives = 291/686 (42.42%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLE-NRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVV----LDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTM---KNNDYFSLTPDYGMLCAMEKL--PPIGDYKTVIVAED 2459
            NDN P F    Y  E  E S   + I    A DAD    G  +  +    EN   Y  +     V     I +   Q+DRE  +   FT+ A D G P +     + +K++D ND  P F+   Y   ++E++  G  +L +   DKD G N K+S   +      +   F +      +  +    L+ E    Y+  L A D     R  T  V + VT+ ND  P     QF +     YA   + E       +  V  TD+D          + ++  +Y+++  T+ +   N  T  I +    DRE +   +  I+ +   GI  L+    + + I+D+NDN P+FS   Y   ++E+   +   +    ++ATD DEG NG   Y I+    D  + F ID NTG++     LDYEK    ++ +SA+DLG P  + +  + ++V D +DN P      YS ELYEN   G +V  VN TD D + ++KR+  +I+          S   D +F I  +SG I         L+RE  ++    + A +   L   K L         +   + +LD NDN+P      +  V++V  +   I  +T   +  +          D DEGE+ ++  T+     N  F +    G+L     L       Y  V++AED
Sbjct: 1288 NDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDAD---IGDNAAVLYSIVENVTDYVTVNAITGV-----ISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGV----LYTRFAIDPDTGNITTR--EPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVP-----QFTQ---SGYA-FSVREDVKVGHTVGRVATTDEDIN--------DNARVRYYISSGNTSLMFSVNETTGIISTTSTLDRE-QNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQ---VIATDPDEGANGQFTYKIT--AGDTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIE----------SGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSL---------VPAVITVLDVNDNAP--RFDSESYVRSVLEDTGPITDATILTVKAQ----------DGDEGESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAED 1905          

HSP 2 Score: 145.591 bits (366), Expect = 3.932e-35
Identity = 164/643 (25.51%), Postives = 266/643 (41.37%), Query Frame = 3
Query:  192 SGLKSDSFYLSEDTDSFQLINGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQAD--SITCEIETSQ-ESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSF--------YSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASN 2087
            SG+    F +  DT       G +T R P++REE  S +   +  ++S     +    + I   D               ND+ P F +  Y   + E+ K+   +      D D        Y I   N +      LM    V+    I+     +DRE        + A D G P  +  T +++ + D ND +P FS+ +Y + ++ES     +++ +   D D G NG+ +    +    D+   F +      + +K  +KLDYE  + Y+  + A+D G PP +    VE+ V++V+D+ P      F+KP  +  A +Y  E  T+   +  V  TD D +A    +   IE+   +S +L   ++  +     T         +RET   + + +       + + K      + + D+NDNAP F S  Y   V E+    I       + A D DEGE+G + + I  V  +    F +D  TGV+     LD E     S+ + A+D G P  SSSV + + V D NDN P +             +F + EN   G  VG V   D DT       I             T+    + F ++  SG++ T++ LDRE SS     + ASN
Sbjct: 1439 SGVLYTRFAIDPDT-------GNITTREPLNREETGSYTLTLRA-VDSAIRAREGTTRVIITVTD--------------ANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTS------LMFS--VNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDV---FYIDANTGLITIK--AKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAP-----VFHKP--RYSAELY--ENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVI-----TLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLED-TGPITDATILTVKAQDGDEGESGEIIFTI--VSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTKNLIYYYI-------------TNTEEQKYFILNETSGELRTRITLDREDSSVHYLYVKASN 2016          

HSP 3 Score: 128.642 bits (322), Expect = 5.511e-30
Identity = 162/601 (26.96%), Postives = 260/601 (43.26%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPI-SKQYARIYINEGTTKDMVICLVKVTDDDNQADS-ITCEIET--SQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKEN--RVNEIVTINKDPILATDKD-EGENGTVEYYI-SNVVDDMKNYFSIDKNTGVVK---TILG-LDYEKIKHVSIEISA-KDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMM 2195
            NDNSP F    YY  + EN    + + +  A D D       SY +            L T   +D     +  +  ++RE       TL AVD     R+G T++I+ V D ND  PQF+Q  Y   ++E    G  +  +   D+D  +N ++   + SS N  +   F +++T     +   S LD E    Y+  + AKD G P   S   V + + +VND          NKP+ SK    + + E       +  V  TD D  A+   T +I    + + FY++A        N     IK+K+D+  E  +L+ +++   D  G   L     +E+ + D++DNAPVF  PRY   + EN  R + ++T+N     ATD D E  +  V Y I S   D M   F I + +GV+    T  G L+ E      ++++A   + +  + S V  ++ V D NDN P  D   Y   + E+   G       +T K  D +       I  ++ G   G       +F +DN++G +     LDRE +S     ++A      D G+        +  ++V + +LD NDN P++
Sbjct: 1393 NDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSG---------VLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRY-YISSGNTSLM--FSVNETTG--IISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVND----------NKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDA--------NTGLITIKAKLDY--EKTSLYNLTVSAQDL-GTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVN-----ATDIDAEASHKRVYYRIESGNTDSM---FLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLED--TGPITDATILTVKAQDGDEGESGEIIFTIVSGNENG-------VFQMDNKTGVLTRTRPLDREDTSFYSLVVMAE-----DKGEPAL-----SSSVTVNITVLDMNDNLPIL 1931          

HSP 4 Score: 128.257 bits (321), Expect = 8.502e-30
Identity = 171/670 (25.52%), Postives = 279/670 (41.64%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDD--NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPIL---ATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKV--RVTMKN-NDYFSLTPDYGMLCAMEKL 2417
            ND SP F +  YY  + E++     I    A D D+    +  Y        F  Y    T D        +IV   +DREF +     + A +     +   T++ + V D  D +P F+     +K+ E+   G  +  +   DKD G+    SI      N D    F +        ++ +++LD E + +Y   + AKD      S    V V V +VND+PP      F+ P    Y   Y  E + +   I  VK  D D  + A  +   +E   +   +NA+     L + +          DRE +     +I  +D+ G+     T  + + + DINDN+PVF++  YY  V+EN+          P+L   A+DKD G N  + Y +S V   +   F+ID +TG + T   L+ E+    ++ + A D  +  R  + ++I+ V D ND+ P+   S Y+F + E+  +G  VG+V  TD+D + N +                +S     +F+++  +G I T   LDRE ++     I A      D+G             SV + I D NDN P+     K        E  F+KT   +            I  D DEG N +   ++T  + +D F +  + G++    KL
Sbjct: 1083 NDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAKF--YVSRSTGD--------IIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDTISYSI-----ANGDPYGLFTIDNVTG--EIRTVAELDRENVTQYELFVQAKD-SVNLVSDLLKVVVQVEDVNDNPP-----VFSMP---GYTIEYWEE-SPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLGSSQ---------LDREVEEYFNFTIRATDS-GVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQP------AGTPVLVVTASDKDVGTNAKLSYVLSGV---LYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYI-----------SSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAK-----DHGIPALES-----NTSVMITIEDVNDNKPLF---SKSVYNVTLRESVFLKTQVVQ-----------VIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKAKL 1671          

HSP 5 Score: 119.398 bits (298), Expect = 4.126e-27
Identity = 133/516 (25.78%), Postives = 218/516 (42.25%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRK-GKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISK-LDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVI--CLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFS-SPRYYGIVKENRVNEIVTINKDP---------ILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIK---------HVSIEISAKDLGVPV---RSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKD 1901
            NDN P F + +Y   + E     + I+   A DAD   FG  +YE+         YF +  ++   +   IL      D + + + +F+L+  DGG   ++     + + + D ND +P+F+ + Y   I E+   G  +  +   DKDSG NG++S N ++    D    F    +++G  L   ++ LD ETI  Y+  + A D G   R     + V V + ND+ P I                 I+EG     V+   +  V  D      +T  +      F LN+      +         S    DRE K  + + I  +D  G      +  + V I D+NDN P F  +P       ++    ++T+++ P         I ATD D   NG V Y +S    D   +F +D  TG +     LD E  +            ++I+A D   P+   +S++V++ + V+DTNDN P+     Y   L E    G+ V +V+ TD+D
Sbjct:  383 NDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQA---AYFSVNADNGTISAAQIL------DYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAG---DDGGHF----SINGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQIT--------DGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQI---------SPTGLDRELKDSYDLIINVTD-NGSPPNTNSTTVHVTILDVNDNTPAFDPNP------AQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSG---DEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQD 855          

HSP 6 Score: 117.087 bits (292), Expect = 2.312e-26
Identity = 188/805 (23.35%), Postives = 318/805 (39.50%), Query Frame = 3
Query:  210 SFYLSEDTDSF---QLINGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTX-------XXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQP-PRSSTALVEVFVTNVNDSPPNIVFYQF------NKPISKQYARI----------------------------------------------YIN--EGTTKDMVICLVKVTDDDNQADSITCEIETSQES-FYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKI-YTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDY--FSLTPDYGMLCAMEKL 2417
            ++ LS D   F     + G +++R+ +DRE         Q   N+Q   G     + I + D            V + I V D NDNSP F  + Y   + E ++  S +    A D D    G   Y I   +EN     + +   +  +K+  ++ K    +  ++R                  T +++ V D ND +P F+Q  Y   + E+  TG  +L +   D+D G NGKI+      TN +  + F ++     + +  +  +D E ++ +   + A+D G+P  R + A V + V + ND+ P   F  +      N P+      +                                              Y+N  E  ++ +VI  V  TD D   ++I        E+ FY+          +R T +I      DRE K ++ +++  ++     Q   T ++ + + D+ D+ P F+S      + EN     +  N   I A DKD G+  T+ Y I+N   D    F+ID  TG ++T+  LD E +    + + AKD  V + S  +K++V V+D NDN P   +  Y+ E +E  P GT + +V   D D   N   +   ++N+                T++  +G I      LDRE+     F I A+     D G         +   SV + ++D NDNSP+    D           ++++    EN  P           D D G N+K+   +    Y  F++ PD G +   E L
Sbjct:  747 AYSLSGDEHGFFRLDPVTGELSVRKELDRE-------SPQMSRNAQ---GDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCEVEKLVRHYNWHKKNCVLCKES--KCSVER------------------TYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKL---TNGNKDDAFSINNVTGEITVAGV--IDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMVPDQKISSSTLRPRSSPRAPAALLTAREKRPITLINDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAKFYV----------SRSTGDIIVDSPLDREFKNVYILNVTAANIVAGAQ-DTTTQVHITVTDVIDDKPYFNSSSLTVKLSENAS---IGTNVTKITALDKDIGD--TISYSIAN--GDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKD-SVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVT------------DYVTVNAITGVISLGSSQLDREVEEYFNFTIRAT-----DSGVP-----SKSSTASVAIKLVDINDNSPVFNNTDY---------YAYVR----EN-QPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGNITTREPL 1461          

HSP 7 Score: 108.612 bits (270), Expect = 8.335e-24
Identity = 155/607 (25.54%), Postives = 254/607 (41.85%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQ-LIYEIKIKESEMTGLELLH-LRVEDKDSGNNGKISINFASSTNQDIQNT----FQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEG-TTKDMVICLVKVTDDDNQADS-ITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLH---------FVSIVCSD--TEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPIL--ATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSP 2189
            NDN P F    Y  +I EN    + +    A D D    G  S+ I   ++    +F +       N   ++    ++DRE I     T+ A D G   R    ++ + VLDEND  PQ +  L     I E    G  LL  +   D D+G+NG+++ + +   ++   N+     Q+S T           LD E  + Y   +   D G PP +++  V V + +VND+ P    +  N   S     I ++EG  T +  +  +  TD D  A+  +   +   +  F+    + + V     T E+  + + DRE+  +           + I  +D  T   ++   T ++ + ++D NDN+P F S  Y     E R++E      + I   ATD+D    G V Y   N+ D  +N     +   V K +   ++ K   V      K+    V  + V  ++ V D NDN P  + S Y+ ++ EN P GT V +V+ +D+D   N K                T+   D  F+I+N +G+I    V+DRE        + A      D G+   R  +   E+ +TV   D+NDN P
Sbjct:  488 NDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGG--HFSI-------NGSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGGDSRFTLNSATGRLQISPT----------GLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTP---AFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHGFF----RLDPV-----TGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNY-----ETRLSEAARPGSNVIQVSATDQDLEYKGKVIY---NITDGDEN-----RKCEVEKLVRHYNWHKKNCVL----CKESKCSVERTYV--VIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKL-----------TNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAE-----DQGEPSSR--KTFAEVVITVK--DENDNFP 1024          

HSP 8 Score: 97.8265 bits (242), Expect = 1.495e-20
Identity = 160/622 (25.72%), Postives = 252/622 (40.51%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVES---YEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELL--HLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFN-----------------------LVAKDFGQPPR-SSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDD-NQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEV-DLSFYSFELYENEPIGT-YVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKI-YTKVVLDREMSSQIPFAI-IASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMM 2195
            +D  P F +  Y KEI EN+ I S +    A D D    G+ +   YEI   N   D  F       +D+   ++ V   ID E  D    T+ A +   P       +++ V+D ND  P F Q +Y   ++E       ++   L+V D D     +  +      + D       S TL+     +   LDYE    ++F+                       +VA +     + S+ A V + + NVND+ P      +N  + ++     I  GT     I  +  TD D     ++T E+   Q +++       +V  +  T      +D+D  T   +  S+V  D  G  Q      + V ++D+NDN P F+   Y   + EN     +      + ATDKD GENG + + IS    D   +FSI+  +G+V T   LD E I   ++ +SA D GV  R   V+L VNV D NDN P++ D    +  + E    GT  +  +   D D   N             G    +    D  FT+++ +G++  +   LDRE+       I +  N +P            +T   +V V ILD NDN+P  
Sbjct:  147 SDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGD---VGINNPILYEIISGNS--DGVFT------IDSNTGVITVNGSIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLY-----INKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEE-----ITPGTH----IADITATDADLGTFGALTYELRGGQAAYF-------SVNADNGTISAAQILDYD--TLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQ---VTATDKDSGENGRLSFNIS--AGDDGGHFSIN-GSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSN-------------GQLTYSMSGGDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSP-----------PNTNSTTVHVTILDVNDNTPAF 704          

HSP 9 Score: 97.8265 bits (242), Expect = 1.756e-20
Identity = 113/437 (25.86%), Postives = 188/437 (43.02%), Query Frame = 3
Query:  663 IDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQF------SQLIYEIKIKESEMT-GLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETI---------NKYSFNLVAKDFGQP---PRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYIN----EGTTKDMVI---CLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPIL---ATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPV-RSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKV 1883
            +DRE  D  +  +   D G PP    T + + +LD ND  P F      S   Y I + E   T    L+ +   D D+  NGK+    A S + D    F+L      ++++   +LD E+           ++  ++ A D   P    +S+T  V + V + ND+ P      +   +S+  AR   N      T +D+      +  +TD D   ++  CE+E     +  N  K N VL               +E+K        CS         +   + + + D+NDN PVF+  +Y   V EN      +    P+L   A+D+D+G NG + Y ++N   D  + FSI+  TG +     +D E +    + + A+D G P  R +  ++++ VKD NDN P+   + Y  E+ EN P+G+ +  V
Sbjct:  662 LDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKV----AYSLSGDEHGFFRLDPVTGELSVR--KELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEA-ARPGSNVIQVSATDQDLEYKGKVIYNITDGD---ENRKCEVEKLVRHY--NWHKKNCVLC--------------KESK--------CS--------VERTYVVIYVDDVNDNDPVFNQSKYAADVLEN------SPTGTPVLRVHASDRDQGANGKITYKLTNGNKD--DAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFTGYEGEIAENSPVGSTITMV 1048          

HSP 10 Score: 86.6557 bits (213), Expect = 4.694e-17
Identity = 74/220 (33.64%), Postives = 102/220 (46.36%), Query Frame = 3
Query: 1449 VIIKDINDNAPVFSSPRYYGIVKEN-RVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLG--TSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASN-PNP 2096
            +I+ D NDNAPVF+   Y   + EN RV    TI K  I A D D G N  V+Y  SN       +FS++   G +     LD+E  +   + + A+DLGVP   S   +I+ V D +D  P    SFY  E+ EN PIG+ V  V   D D               +  P L    S  +D +FTID+ +G I     +D E +      + AS  P+P
Sbjct:   34 LIVDDYNDNAPVFTEQPYMAKIAENARVG--TTILK--ISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVG-------------INNPILYEIISGNSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKASEVPDP 236          

HSP 11 Score: 73.559 bits (179), Expect = 4.542e-13
Identity = 55/177 (31.07%), Postives = 82/177 (46.33%), Query Frame = 3
Query:  681 DRIEFTLIAVD---GGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIV--FY----QFNKPISKQYARIYINEG 1184
            D  EFT+   D   GG   R+G     L V D ND  P F++  Y  KI E+   G  +L +   D DSG N ++   F+++T    Q  F    +++G  L L   LD+E    Y   ++A+D G P   S   V + VT+++D PP  +  FY    + N PI      +   +G
Sbjct:    7 DNYEFTVYVEDDFNGGGLARRGSKFFFLIVDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATAT--QTPFFSLNSVNG-ELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDG 180          

HSP 12 Score: 58.5362 bits (140), Expect = 1.459e-8
Identity = 43/155 (27.74%), Postives = 70/155 (45.16%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKI 896
            NDN+P F E+ Y  +I EN+++ + I    A DAD        Y+          +F L      ++    L +   +D E        +IA D G P  + +T +I++V D +D  P+F Q  Y  +I+E+   G  ++ +   D D G N  I
Sbjct:   40 NDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSL------NSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPI 188          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 239.965 bits (611), Expect = 3.277e-65
Identity = 200/703 (28.45%), Postives = 320/703 (45.52%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGI--VKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDD--MKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNND---YFSLTPDYG-MLCAMEKLPPIGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       + EN+ + +  S+P+A D D    GV  Y +     +    F L   D    K P LIV   +DRE  D  + T+ AVDGG P R  +  + + V D ND  P+F    YE ++ E+   G  +L ++ +D D G NG+I  +   + +  +    ++ +T   + +K    LD E IN  SF +VA+D G  P+SS   V + VT+ ND+ P +        ++       I+E       + LV+V+D D   +++   +      F L    +++  +N++ Y +++    D E    + V IV  D+ G   L  TN L+V + D+NDN+PVF SP  + +   +EN+  E +      + ATD D G N  + Y   N+V D  +K  F ID NTG VK    LD E  +     ++A D G PV   +  +++ V D NDN P+  LS YSF + EN P  + VG V V D D   N    +             + +P    F + N +G I + +  DRE  S   F + A     +D G+     +     + VT+N+LD+NDN P++        + ++P  S           P++ V       DLD G N+ +  ++   +    F ++P  G +  A E     G    ++V         R    L++I++ E
Sbjct:  126 NDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTA-GPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDP-VPKLLRIDRTTGIIYVK--GPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGL-VTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRP-ASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDS-GNPALSSTNSLKVQVTDVNDNSPVF-SPTIFEVDFAEENQPGETIL----DVTATDADSGTNAELFY---NIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHL-------------SVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKA-----VDGGEPPRSSY-----VGVTINVLDENDNDPVVTKPSNSSFRQLSPVAS-----------PDSHVDV-VEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNE 778          

HSP 2 Score: 118.242 bits (295), Expect = 1.699e-26
Identity = 155/572 (27.10%), Postives = 229/572 (40.03%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTF--QLSQTLHGVALKLI--SKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDR-ETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILAT--------DKDEGENGTVEYYISNVV------------DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYG 2393
            ++V D ND  PQF   +  I + E+ + G         D+DS  NG    ++A +   D    F  Q++    G   +LI    LD E  + Y   + A D G P R S AL+ V VT+ ND+ P      +   +S         E +     +  VK  D D   +    EIE S         K   +  +R T  I  K   DR E  +L F   V +  +G         + + + D NDNAP     R  G+V  +    I  I++D  + T        DKDEGEN  V   ++  V            D+ + YF        ++T   LDYE++K   +EI A D G P  SS+  L V V D NDN P    + +  +  E    G  +  V  TD D+  N +              +G S     +F ID  +G++  +  LDRE   +  F + A+     D G  + +        +V + +LD NDN P  ML             S    S  EN+ P + V      +D+D+GEN+ V        + S+ PD G
Sbjct:  120 IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNG--VADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVS---------ENSPVGHSVLQVKADDSDMGPNG---EIEYSLHQAVDPVPKLLRI--DRTTGIIYVKGPLDREEINSLSF--YVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEI-RGIGLVTHSE--GIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYF--------LQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYN---------IVGDSY-IKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAA-----DKGSPVHKG-----TATVVIKVLDCNDNDPKFML-------------SGYSFSVLENMPPLSPVGM-VTVLDMDKGENAHV--------HLSVEPDGG 620          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1a (protocadherin-1 [Source:NCBI gene;Acc:101157079])

HSP 1 Score: 241.891 bits (616), Expect = 3.312e-65
Identity = 200/703 (28.45%), Postives = 320/703 (45.52%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGI--VKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDD--MKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNND---YFSLTPDYG-MLCAMEKLPPIGDYKTVIVAEDGDFNNSRKQEFLINIHIKE 2516
            NDN+P FP       + EN+ + +  S+P+A D D    GV  Y +     +    F L   D    K P LIV   +DRE  D  + T+ AVDGG P R  +  + + V D ND  P+F    YE ++ E+   G  +L ++ +D D G NG+I  +   + +  +    ++ +T   + +K    LD E IN  SF +VA+D G  P+SS   V + VT+ ND+ P +        ++       I+E       + LV+V+D D   +++   +      F L    +++  +N++ Y +++    D E    + V IV  D+ G   L  TN L+V + D+NDN+PVF SP  + +   +EN+  E +      + ATD D G N  + Y   N+V D  +K  F ID NTG VK    LD E  +     ++A D G PV   +  +++ V D NDN P+  LS YSF + EN P  + VG V V D D   N    +             + +P    F + N +G I + +  DRE  S   F + A     +D G+     +     + VT+N+LD+NDN P++        + ++P  S           P++ V       DLD G N+ +  ++   +    F ++P  G +  A E     G    ++V         R    L++I++ E
Sbjct:  203 NDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNGVADYALTA-GPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVSENSPVGHSVLQVKADDSDMGPNGEIEYSLHQAVDP-VPKLLRIDRTTGIIYVK--GPLDREEINSLSFYVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEIRGIGL-VTHSEGIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRP-ASDSTSDNKRKYFLQTTTPLDYERVKEYRVEIVAVDS-GNPALSSTNSLKVQVTDVNDNSPVF-SPTIFEVDFAEENQPGETILD----VTATDADSGTNAELFY---NIVGDSYIKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAADKGSPVHKGTATVVIKVLDCNDNDPKFMLSGYSFSVLENMPPLSPVGMVTVLDMDKGENAHVHL-------------SVEPDGGKFVVQNGTGTILSSISFDREKESSYTFRLKA-----VDGGEPPRSSY-----VGVTINVLDENDNDPVVTKPSNSSFRQLSPVAS-----------PDSHVDV-VEAEDLDSGPNADLVFSIAGGNPYQLFRISPSSGEITLAKEMTRKHGGLHRLVVRVSDRGKPPRHATALVHIYVNE 855          

HSP 2 Score: 120.168 bits (300), Expect = 5.143e-27
Identity = 155/572 (27.10%), Postives = 229/572 (40.03%), Query Frame = 3
Query:  753 LKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTF--QLSQTLHGVALKLI--SKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDR-ETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILAT--------DKDEGENGTVEYYISNVV------------DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYG 2393
            ++V D ND  PQF   +  I + E+ + G         D+DS  NG    ++A +   D    F  Q++    G   +LI    LD E  + Y   + A D G P R S AL+ V VT+ ND+ P      +   +S         E +     +  VK  D D   +    EIE S         K   +  +R T  I  K   DR E  +L F   V +  +G         + + + D NDNAP     R  G+V  +    I  I++D  + T        DKDEGEN  V   ++  V            D+ + YF        ++T   LDYE++K   +EI A D G P  SS+  L V V D NDN P    + +  +  E    G  +  V  TD D+  N +              +G S     +F ID  +G++  +  LDRE   +  F + A+     D G  + +        +V + +LD NDN P  ML             S    S  EN+ P + V      +D+D+GEN+ V        + S+ PD G
Sbjct:  197 IEVQDINDNTPQFPLSVLTISVPENTIMGALFSIPLATDRDSERNG--VADYALTAGPDAATLFGLQVADDRGGKLPQLIVLGNLDRELKDSYDLTIKAVDGGNPQRYSQALLRVVVTDANDNSPKFEHPSYEAEVS---------ENSPVGHSVLQVKADDSDMGPNG---EIEYSLHQAVDPVPKLLRI--DRTTGIIYVKGPLDREEINSLSF--YVVARDKGPQPKSSKTFVTIEVTDQNDNAPAVEI-RGIGLVTHSE--GIANISEDMPVGTAVALVQVSDKDEGENAVVTCVVAGDVPFQLRPASDSTSDNKRKYF--------LQTTTPLDYERVKEYRVEIVAVDSGNPALSSTNSLKVQVTDVNDNSPVFSPTIFEVDFAEENQPGETILDVTATDADSGTNAELFYN---------IVGDSY-IKGLFEIDPNTGEVKARTPLDREHKERYEFRVTAA-----DKGSPVHKG-----TATVVIKVLDCNDNDPKFML-------------SGYSFSVLENMPPLSPVGM-VTVLDMDKGENAHV--------HLSVEPDGG 697          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 217.624 bits (553), Expect = 2.137e-57
Identity = 190/653 (29.10%), Postives = 303/653 (46.40%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEK-PNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKI--SINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRY-YGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            NDN+P F        I EN+   +  S+P+A D D    GV  Y +   P+ N    F L   + VD K P +IV   +DRE  D  +  +  VDGGKPPR     + + V D+ND  P+F +  YE ++ E+   G  +L +R  D D+G NG I  S++ AS T   +Q   ++ ++   + +K +  +D E  N   F +VA+D G   +SS A V + + + ND+ P I        I + +    I+E       + LV+V+D D   +++   +      F L     +A    RK Y +++    D E    + + IV  D+ G   L  TN L+V + DINDN P FS         ++N+  + V      ++ATD D G N  + Y I  +     + F I+ NTG ++    LD E ++     ++A D GVP ++ +  +++NV+D NDN P+  LS YSF + EN P    VG V V+D D   N++  +               +P +  F I N +G I + +  DRE  S   F + A     +D G      +     + VT+N+LD+NDN+P +        K  N   + +K S+     P +         D+D G N+++  T+   +   L
Sbjct:  145 NDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDAN--QLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDT---VQRLLRIDRSTGIIYVKGL--VDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFV-ANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRK-YFLQTTTLLDYERIKDYRIEIVAVDS-GNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVI----DVVATDADSGVNAELVYSI--IESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFV-------------EPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKA-----VDAGDPPRSSY-----VGVTINVLDENDNAPYV-------TKPANSSYTHLKPSS-----PPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGL 746          

HSP 2 Score: 142.51 bits (358), Expect = 7.363e-34
Identity = 167/557 (29.98%), Postives = 234/557 (42.01%), Query Frame = 3
Query:  750 ILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKL-----ISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILAT--------DKDEGENGTVEYYISNVV------------DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPN-PLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKV 2342
            I++VLD ND  PQFS  I  + I E+  TG         D+DSG+NG     +A S   D    F L Q    V  K+     I  LD E  + Y  N+   D G+PPR+S+AL+ + VT+ ND+ P     +F K    QY    + E +     +  V+  D D  A+    +    Q S  +  L    +  +R T  I  K   DRE   L    +V  D  G N      ++ + IKD NDNAP     R  G+V     N +  I++D  + T        D+DEGEN  V   ++  V            D  + YF        ++T   LDYE+IK   IEI A D G P  SS+  L V V D NDN P    +       E+   G  V  V  TD D+ +N + +                  A  +F I++ +G+I  +  LDRE   +  F + A++   P   G  +           V +N+ D+NDN P  ML             S    S NEN+ P N V       D D+GENS+V
Sbjct:  138 IIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNG--VAEYALSAGPDANQLFGL-QVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAP-----KFEK---NQY-EAELPENSPPGHSVLQVRANDADTGANG-DIDYSLHQASDTVQRL----LRIDRSTGIIYVKGLVDREEDNLLKFYVVARD-RGPNSKSSKAQVTISIKDQNDNAPAIEI-RGIGLVIHQ--NFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYF--------LQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSI-----------IESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAI-----------VVINVEDRNDNDPKFML-------------SGYSFSVNENMPPLNPVGV-VTVSDADKGENSQV 629          

HSP 3 Score: 102.449 bits (254), Expect = 1.393e-21
Identity = 110/375 (29.33%), Postives = 159/375 (42.40%), Query Frame = 3
Query: 1326 KTYEI-KSKIDFDRETKT------------LHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFS------IDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFV---DLDEGENSKVRVTMKNNDYFSLTP 2384
            KT EI  ++I  DRET +            L F   +    +GI    +  +  + + DINDN P FSSP     + EN      T+   P+ A D+D G NG  EY +S    D    F       +D+    V  I  LD EK     + I   D G P R+SS  L + V D NDN P+ + + Y  EL EN P G  V +V   D DT  N        +          S    ++  ID  +G IY K ++DRE  + + F ++A +  P             + +  VT++I D+NDN+P + ++    V   N    F+      NI  +  +  P   V   D DEGEN+ V   +  +  F L P
Sbjct:   85 KTGEIYTTEIPIDRETLSDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPEN--THTGTLFSIPV-AVDRDSGSNGVAEYALS-AGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQ---------ASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGP----------NSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQN----FVA-----NISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRP 427          

HSP 4 Score: 60.4622 bits (145), Expect = 9.334e-9
Identity = 58/222 (26.13%), Postives = 90/222 (40.54%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYE--IKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFV 1091
            NDN P F    Y   + EN    + + +    DAD       +  +E  N  F           + N    ++     DRE      F L AVD G PPR     + + VLDEND  P  ++        +K S      +  ++ ED D+G N ++   + + T  +    FQ+S   +   +KL      +    +   +   D G+PPR +TALV V+V
Sbjct:  588 NDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDNGKF----------IIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAEL---YYTITGGNPHGLFQISH--NSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYV 794          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 216.083 bits (549), Expect = 2.778e-57
Identity = 191/656 (29.12%), Postives = 303/656 (46.19%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEK-PNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKI--SINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRY-YGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPF---AIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL 2378
            NDN+P F        I EN+   +  S+P+A D D    GV  Y +   P+ N    F L   + VD K P +IV   +DRE  D  +  +  VDGGKPPR     + + V D+ND  P+F +  YE ++ E+   G  +L +R  D D+G NG I  S++ AS T   +Q   ++ ++   + +K +  +D E  N   F +VA+D G   +SS A V + + + ND+ P I        I + +    I+E       + LV+V+D D   +++   +      F L     +A    RK Y +++    D E    + + IV  D+ G   L  TN L+V + DINDN P FS         ++N+  + V      ++ATD D G N  + Y I  +     + F I+ NTG ++    LD E ++     ++A D GVP ++ +  +++NV+D NDN P+  LS YSF + EN P    VG V V+D D   N++  +               +P +  F I N +G I + +  DRE  S   F   A+ A +P    Y             + VT+N+LD+NDN+P +        K  N   + +K S+     P +         D+D G N+++  T+   +   L
Sbjct:  145 NDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNGVAEYALSAGPDAN--QLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDT---VQRLLRIDRSTGIIYVKGL--VDREEDNLLKFYVVARDRGPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFV-ANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRK-YFLQTTTLLDYERIKDYRIEIVAVDS-GNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVI----DVVATDADSGVNAELVYSI--IESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFV-------------EPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSY-------------VGVTINVLDENDNAPYV-------TKPANSSYTHLKPSS-----PPDTPVEVVKAEDIDAGVNAELYYTITGGNPHGL 746          

HSP 2 Score: 141.354 bits (355), Expect = 1.310e-33
Identity = 167/557 (29.98%), Postives = 234/557 (42.01%), Query Frame = 3
Query:  750 ILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKL-----ISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILAT--------DKDEGENGTVEYYISNVV------------DDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPN-PLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKV 2342
            I++VLD ND  PQFS  I  + I E+  TG         D+DSG+NG     +A S   D    F L Q    V  K+     I  LD E  + Y  N+   D G+PPR+S+AL+ + VT+ ND+ P     +F K    QY    + E +     +  V+  D D  A+    +    Q S  +  L    +  +R T  I  K   DRE   L    +V  D  G N      ++ + IKD NDNAP     R  G+V     N +  I++D  + T        D+DEGEN  V   ++  V            D  + YF        ++T   LDYE+IK   IEI A D G P  SS+  L V V D NDN P    +       E+   G  V  V  TD D+ +N + +                  A  +F I++ +G+I  +  LDRE   +  F + A++   P   G  +           V +N+ D+NDN P  ML             S    S NEN+ P N V       D D+GENS+V
Sbjct:  138 IIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRDSGSNG--VAEYALSAGPDANQLFGL-QVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAP-----KFEK---NQY-EAELPENSPPGHSVLQVRANDADTGANG-DIDYSLHQASDTVQRL----LRIDRSTGIIYVKGLVDREEDNLLKFYVVARD-RGPNSKSSKAQVTISIKDQNDNAPAIEI-RGIGLVIHQ--NFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYF--------LQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSI-----------IESSAASLFEINSNTGEIRVRNQLDREDVERYEFGVAAADKGVPSKTGTAI-----------VVINVEDRNDNDPKFML-------------SGYSFSVNENMPPLNPVGV-VTVSDADKGENSQV 629          

HSP 3 Score: 101.679 bits (252), Expect = 2.412e-21
Identity = 110/375 (29.33%), Postives = 159/375 (42.40%), Query Frame = 3
Query: 1326 KTYEI-KSKIDFDRETKT------------LHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFS------IDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFV---DLDEGENSKVRVTMKNNDYFSLTP 2384
            KT EI  ++I  DRET +            L F   +    +GI    +  +  + + DINDN P FSSP     + EN      T+   P+ A D+D G NG  EY +S    D    F       +D+    V  I  LD EK     + I   D G P R+SS  L + V D NDN P+ + + Y  EL EN P G  V +V   D DT  N        +          S    ++  ID  +G IY K ++DRE  + + F ++A +  P             + +  VT++I D+NDN+P + ++    V   N    F+      NI  +  +  P   V   D DEGEN+ V   +  +  F L P
Sbjct:   85 KTGEIYTTEIPIDRETLSDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPEN--THTGTLFSIPV-AVDRDSGSNGVAEYALS-AGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQ---------ASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDRGP----------NSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQN----FVA-----NISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRP 427          

HSP 4 Score: 60.8474 bits (146), Expect = 7.583e-9
Identity = 58/222 (26.13%), Postives = 90/222 (40.54%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYE--IKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFV 1091
            NDN P F    Y   + EN    + + +    DAD       +  +E  N  F           + N    ++     DRE      F L AVD G PPR     + + VLDEND  P  ++        +K S      +  ++ ED D+G N ++   + + T  +    FQ+S   +   +KL      +    +   +   D G+PPR +TALV V+V
Sbjct:  588 NDNDPKFMLSGYSFSVNENMPPLNPVGVVTVSDADKGENSQVTLFVEPDNGKF----------IIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAPYVTKPANSSYTHLKPSSPPDTPVEVVKAEDIDAGVNAEL---YYTITGGNPHGLFQISH--NSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYV 794          
BLAST of Protocadherin-1 vs. Ensembl Medaka
Match: pcdh7b (protocadherin 7 [Source:NCBI gene;Acc:101166584])

HSP 1 Score: 207.223 bits (526), Expect = 3.757e-54
Identity = 204/740 (27.57%), Postives = 335/740 (45.27%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPN-----------------ENFD------VYFKLMTEDFVDN-KQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTK-------DMVICLVKVTDDDNQADSI-TCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRV-NEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSL---TPDYGMLCAMEKLPP--IGDYKTVIVAEDGDFNNSRKQEFLINIHIKEDPHTLNN 2537
            NDN+P+FP       + EN  I +   LP A D D    G+E YE+ + N                   FD        F+L   D  D  KQP LI+K  +DRE  D  E TL   DGG PPR  +  + + + D ND  P+F + +YE  + E+   G  +L L+  D D G NG+I   F ++T + ++   +L ++     L ++ ++D E +++  F ++A+D GQPP+   A V + + + ND+ P I          ++  RI++ +G          D  I LV+V+D D   + I TC +      F L         +N+K Y + +    D ET   + V IV  D+ G   L   N L V + D NDN P+FS         EN    E VT     + ATD D G+N  + Y + + V+ +   FSID ++G ++    LD E+ +    ++ AKD G+     S  ++V V D NDN+P+     ++F + EN    + VG V V D D   N +  +   +              ++IF+I+NE+G I++ +  DRE  +   F + A +      G D  R    +   +V++ ++D+NDN+P +          +N   + +  S+         V    I  D D G N+ +  ++   + F L       G++  M KL     G ++ V+   D +   S+    L+++++ E   TL+N
Sbjct:  133 NDNTPSFPSPVLTLSVEENRPIGTLYLLPTATDRDFGRNGIERYELIQDNGENSRRSGSSGDSYSGKRRFDEGASRSSVFELQVADTTDGEKQPQLIIKGALDREQRDSYELTLRVRDGGDPPRSSQAILRVMITDVNDNNPRFEKSVYEADLPENSSPGSPILQLKAADADVGVNGQIEYVFGAAT-ESVRRLLRLDESTG--WLSVLHRIDREEVSQLRFTVMARDRGQPPKMDKATVVLNIKDENDNVPAIEI--------RKIGRIFLKDGVANVAEDVVVDTPIALVQVSDRDQGENGIVTCTV-VGDVPFQLKPASEMEGEQNKKKYFLHTSAPLDYETTQEYNVVIVAVDS-GSPSLTSNNSLLVKVGDTNDNPPIFSKNVVQVSFPENNAPGERVTT----VTATDADSGKNAEISYSLDSSVNGI---FSIDSDSGDIRVNTNLDREQKERYEFKVIAKDKGINTLQGSATVVVLVDDKNDNEPKFMQDVFTFYVKENLDPNSPVGMVTVIDADKGQNAEMGLFIEE-------------EEEIFSIENETGTIFSTLSFDREQKTTYTFRVKAVD------GGDPPR----SATATVSLFVMDENDNAPTVTF-------PINSSYTLLPPSST-----VRTVVRTVIATDTDTGINADLNYSIIGGNPFRLFEIDGATGVISLMAKLEQKHYGLHRLVVQVTD-NGQPSQSTTTLVHVYVNE---TLSN 813          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000042783.1 (SMESG000042783.1)

HSP 1 Score: 1908.26 bits (4942), Expect = 0.000e+0
Identity = 1007/1010 (99.70%), Postives = 1007/1010 (99.70%), Query Frame = 3
Query:   51 MEXXXXXXXFFCQLSELDACDSIKQVEITETTVSLFELADVSDHIGRSGLKSDSFYLSEDTDSFQLINGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAMEKLPPIGDYKTVIVAEDGDFNNSRKQEFLINIHIKEDPHTLNNKIRTSQGNHESKYNSEYPARSNERYFRNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNETSFGQVSTKNPPDSLECQDFFESIPDSKYNDLSFVKNRQPESYRNDYQFKSMEPKIIEKYESADPIFHEVRNFNNISNQMPQSYNYQTIPTQFLPDPMHLYHSLGNSKSELVFQPPNKFTN 3080
            MEIILLILIFFCQLSELDACDSIKQVEITETTVSLFELADVSDHIGRSGLKSDSFYLSEDTDSFQLINGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTKKKVYIKIKVVDINDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDRE IDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAP FSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDINNKRIIMKIKNLLPGPTL TSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAMEKLPPIGDYKTVIVAEDGDFNNSRKQEFLINIHIKEDPHTLNNKIRTSQGNHESKYNSEYPARSNERYFRNNIIYVIIGSIAAILFLLLIIILVKFRKFLINETSFGQVSTKNPPDSLECQDFFESIPDSKYNDLSFVKNRQPESYRNDYQFKSMEPKIIEKYESADPIFHEVRNFNNISNQMPQSYNYQTIPTQFLPDPMHLYHSLGNSKSELVFQPPNKFTN
Sbjct:    1 MEIILLILIFFCQLSELDACDSIKQVEITETTVSLFELADVSDHIGRSGLKSDSFYLSEDTDSFQLINGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTKKKVYIKIKVVDINDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREIIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPAFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDINNKRIIMKIKNLLPGPTLATSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAMEKLPPIGDYKTVIVAEDGDFNNSRKQEFLINIHIKEDPHTLNNKIRTSQGNHESKYNSEYPARSNERYFRNNIIYVIIGSIAAILFLLLIIILVKFRKFLINETSFGQVSTKNPPDSLECQDFFESIPDSKYNDLSFVKNRQPESYRNDYQFKSMEPKIIEKYESADPIFHEVRNFNNISNQMPQSYNYQTIPTQFLPDPMHLYHSLGNSKSELVFQPPNKFTN 1010          

HSP 2 Score: 85.8853 bits (211), Expect = 1.271e-16
Identity = 44/44 (100.00%), Postives = 44/44 (100.00%), Query Frame = 2
Query: 3080 YTNAQILNENNSPVFNNSQSTSIVVNTNKAKTTNVKSPFQSTFV 3211
            YTNAQILNENNSPVFNNSQSTSIVVNTNKAKTTNVKSPFQSTFV
Sbjct: 1011 YTNAQILNENNSPVFNNSQSTSIVVNTNKAKTTNVKSPFQSTFV 1054          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000033582.1 (SMESG000033582.1)

HSP 1 Score: 408.297 bits (1048), Expect = 9.319e-125
Identity = 272/814 (33.42%), Postives = 441/814 (54.18%), Query Frame = 3
Query:  108 CDSIKQVEITETT-VSLFELADVSDHIGRSGLKS----DSFYLSEDTDS--FQLINGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTXXXXXXXXXXXXXNDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYG-IVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDM-KNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIK--TSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAMEKLPPIGDYKTVIVAEDGD-FNNSRKQEFLINIHIK 2513
            CD I  + +TE        L D+   +  S L S    D+ Y ++  +S  F L +G++ +  P+DRE+ CS        +  +CC   CC+FIGI S +   K  YI++ + D NDN P FP+      + EN +I   + LP A D D   +G++SY++   +++    F++  E   DN+  +L+ K +IDRE        ++A+D GKP + G   IIL+V D ND  P F +    + ++E+  +G E+  ++V D D G N ++S N    T+Q  Q  F+L Q   G++L+L S LDYE  N + F ++AKD G P   STA V V VTN+ND PP I+FY     +     ++ + E   K   I L+ VTD D++   I CE+   ++ FYL   +   ++E +K +E+++ I+FDRET +++ ++I CSD+  I++L Q+ ++++ I D+NDN P+FSS  ++G I++ +  ++ V + +  I  TD D G N  ++Y++ + ++     YFS++     +K    +DYEK K     + A D G P  ++S ++ ++V D NDN+PE+   FY+F + E +PIGT +G++  +D DTD   +     I  +L        Q  + +F I+N +G I T+VVLD E    + F +   N N     KD    +  +  +++TV I+D NDNSP + LK+   V+     +S  K    T  +I    C  FPY F+D DEG N++V VT+K N  FSL   + ++C        G +   ++ +D +  N SR+ E LINIH+K
Sbjct:   23 CDYISVITVTENIPYPSSSLIDIGHLLLTSSLISQAEKDNIYFTDRKNSQPFSLSHGKLIVTGPLDREKICSPQTDQN--LIQKCCESSCCMFIGITSPNR--KINYIRVNIEDENDNEPIFPQSYIKIAVHENVEIGHTLVLPKAEDLDTPSYGIDSYKLIS-DKSCGSCFEVKNEP-KDNRL-VLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQ-AQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTD---QLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSS--VAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTVNVIGQDRNGGNGSRRAECLINIHLK 823          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000033582.1 (SMESG000033582.1)

HSP 1 Score: 374.785 bits (961), Expect = 2.182e-113
Identity = 237/699 (33.91%), Postives = 385/699 (55.08%), Query Frame = 3
Query:  432 NDNSPTFPEKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILIVKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYG-IVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDM-KNYFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIK--TSTNENIYPENCVTFPYIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAMEKLPPIGDYKTVIVAEDGD-FNNSRKQEFLINIHIK 2513
            NDN P FP+      + EN +I   + LP A D D   +G++SY++   +++    F++  E   DN+  +L+ K +IDRE        ++A+D GKP + G   IIL+V D ND  P F +    + ++E+  +G E+  ++V D D G N ++S N    T+Q  Q  F+L Q   G++L+L S LDYE  N + F ++AKD G P   STA V V VTN+ND PP I+FY     +     ++ + E   K   I L+ VTD D++   I CE+   ++ FYL   +   ++E +K +E+++ I+FDRET +++ ++I CSD+  I++L Q+ ++++ I D+NDN P+FSS  ++G I++ +  ++ V + +  I  TD D G N  ++Y++ + ++     YFS++     +K    +DYEK K     + A D G P  ++S ++ ++V D NDN+PE+   FY+F + E +PIGT +G++  +D DTD   +     I  +L        Q  + +F I+N +G I T+VVLD E    + F +   N N     KD    +  +  +++TV I+D NDNSP + LK+   V+     +S  K    T  +I    C  FPY F+D DEG N++V VT+K N  FSL   + ++C        G +   ++ +D +  N SR+ E LINIH+K
Sbjct:   23 NDNEPIFPQSYIKIAVHENVEIGHTLVLPKAEDLDTPSYGIDSYKLIS-DKSCGSCFEVKNEP-KDNRL-VLVFKTKIDRETNSVFNLLVLAIDRGKPSKTGSLSIILEVEDINDNRPHFEESTISLSVEENGRSGREIKRIKVTDSDIGANSQMSYNIEDYTSQ-AQRYFKLFQIKDGISLQLQSTLDYENKNIFEFRIIAKDQGTPYLMSTATVTVRVTNLNDEPPEILFYNRGSIVDPNSIQLTLPENGPKHQTIILIHVTDKDSKLSDILCEVSHPKDVFYLRETENVNIIEKKKIFELQNLIEFDRETTSIYRITITCSDSNTISKLTQSVEIQMKIDDVNDNPPIFSSSFHFGKIMETDLTDQDVHMTEGVIQVTDADIGMNSRIKYHLKDALNSTDSQYFSVNSEYPQIKNKEPIDYEKSKQFKFFLVAVDGGKPALTASTQITISVSDANDNRPEIGNKFYTFSVLEEQPIGTKIGQIVASDADTD---QLNRDVIFEMLSLDGTKRRQRQNDLFIIENNTGFIKTRVVLDHEKDQHVSFLVRVRNTNEYVGTKDKLDFYSSS--VAITVKIIDINDNSPKLALKESLIVEQAGSCLSSQKPIIITTSDIASNLCSEFPYTFLDADEGLNAEVVVTLKENPNFSLDMGHNLICLKNLHLSPGYFTVNVIGQDRNGGNGSRRAECLINIHLK 712          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000048159.1 (SMESG000048159.1)

HSP 1 Score: 274.633 bits (701), Expect = 1.290e-76
Identity = 271/883 (30.69%), Postives = 412/883 (46.66%), Query Frame = 3
Query:   78 FFCQLSELDACDSIKQVEITETTVSLFELADVSDHIGRSGLKSDSFY--------LSEDTDSFQL-INGRVTLRRPIDREEYCSKSNKHQTYINSQCCGGQCCLFIGIASNDNTX-XXXXXXXXXXXXNDNSPTFPE-KTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFV-----DNK-QPILIVKHQIDREFIDRIEFTLIAVDGGKPP--RKGKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLSQTLHG-VALKLISKLDYET-INKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHF--VSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKNY-----FSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEG--ENSKVRVTMKNNDY---FSL---TPDYGMLCAMEKLPPIGDYKTVIVAEDGDFN--NSRKQEFLINIHIKEDPHTLNNKIRTSQ-GNHESKYNSEYPARSNER 2609
            FF  LSE+     +K + ITE  +S+  LA++++ +        SF         L  D   F+L +N  +     ++RE  C  +   +  +   C    CC  IG      T     +I IK++D ND +P F   K  + +I EN ++   I LPMA D+D   + V  Y +        +Y    T DF      DN  +P LIV  ++D E I++  F L A D  +        T I +++ D ND  P+F+QL Y   I E++    +L+   V D DSG NG +++N    T++ +   F++ +       L+LI+ LDYET  + + F L+A D G P  SS+A V++ + N+ND+ P I F +    +S   + I   EG     ++  V+VTD D  ++ I C++    + FYL++      L N K + +K+    DRE+    F  ++I C+D+E   Q+     L + I+D+NDNAP+FS   Y G V EN+VN +V   K PI+ TD+D G NG  E+Y+    +D +N+     F IDK +G + T   LDYE       +I A D G    +SS  + +NV D NDN P    S Y F ++EN  +G  +G +  TD DTD  NK I           ++         F ID  +G + T+  LDRE    I   + A NPN   Y     R      E+ V + ++D NDN+P  +    P++  +  +V FI     + +    C   PY   D+D+G         T+  NDY   FSL   TP Y  +C   K      Y   ++A D   N       +    + I  DPH+   KI TS   NH    +S +P  S  +
Sbjct:   14 FFQVLSEV-----LKTITITENDMSIQVLANLTEILASKTNLPHSFLSKVEIVSLLENDLPPFKLQLNQLIQPNNGVNREAVCRDNPGEK--VRKFCKADLCCKLIGFQYLTPTDPGTFFILIKILDQNDKAPQFSSIKRPFFKIPENVEVGKVIDLPMAVDSDSEKYSVRRYSLSY------IYHLDQTHDFRLHVTNDNPPRPQLIVNSKLDYEKINKYVFRLFAYDFDEKSIGNSCSTTIEIEIEDLNDNVPKFNQLTYNANIDENKRDD-KLIKFTVSDPDSGRNGIVTVNIVDKTDE-LSKRFKIFEIQRNEFFLELINSLDYETDPHLFEFTLLATDQGTPSLSSSAQVKIHLKNLNDNGPKIKFKKLGFSVSNSVSII---EGLPAHSLVVEVRVTDADTHSNMIHCKLVDYNDLFYLDSPSKFNTLLNYKPFNLKTINKIDRESNHGSFLRITISCTDSEPSRQITTNESLNIQIEDVNDNAPMFSQQIYIGNVDENQVNVVVNFPK-PIIVTDRDSGLNGKFEFYL----EDFRNFSDSSDFLIDKISGKIFTQRSLDYETKNKFRFKIIAIDKGYQPLTSSSTITINVLDLNDNAPRFSESHYIFNVFENVSVGWKIGTLQATDDDTDRKNKDIFY---------SIEPKGDHSSYFDIDRYTGDLRTRKPLDRETLESISIKVTAKNPN--KYSSHFVRN--TDSEVDVMIKVMDVNDNAPKFI----PRLN-MKQKVEFI---VEQFVDGNTCTELPYTVQDIDDGGINGQNCCYTILENDYNKLFSLMTDTPSY--ICLQRKPEKYQSYTVTLIARDRPPNVEGGLTSKISFPVLIINDPHS---KISTSGFSNHP---DSRFPNPSESK 844          
BLAST of Protocadherin-1 vs. Planmine SMEST
Match: SMESG000053174.1 (SMESG000053174.1)

HSP 1 Score: 267.314 bits (682), Expect = 1.385e-74
Identity = 244/791 (30.85%), Postives = 380/791 (48.04%), Query Frame = 3
Query:  261 VTLRRPIDREEYCSKSNKHQTYINSQCCGG--QCC--LFIGIASNDNTXXXXXXXXXXXXXNDNSPTFP-EKTYYKEILENSKINSRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLM-TEDFVDNKQ-----PILIVKHQIDREFIDRIEFTLIAVDGGKPPRK-GKTKIILKVLDENDCEPQFSQLIYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQLS---QTLHGVA--LKLISKLDYETI-NKYSFNLVAKDFGQPPRSSTALVEVFVTNVNDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSITCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETK------TLHFVSIVCSDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTINKDPILATDKDEGENGTVEYYISNVVDDMKN-----YFSIDKNTGVVKTILGLDYEKIKHVSIEISAKDLGVPVR-SSSVKLIVNVKDTNDNQPEVDLSFYSFELYENEPIGTYVGKVNVTDKDTDXXXXXXXXXXXXLLPGPTLGTSQPADQIFTIDNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTM-EISVTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFPYIFVDLDEGENSK----VRVTMKNNDYFSLTPDYGMLCAMEKLP-PIGDYKTVIVAEDGDFNNSRKQEFLINIHIKEDPH 2525
            + + + IDREE C      Q    ++ CG    CC  L   I+ N+   +  +I++ V D NDN+P FP  +T Y  I EN  +  RI LP A D D+  F V SY++E P       FKL  + DF   K      P LI+   +DRE      FTLIA+DG +  R  GKT+I +K+ D ND  P+F + IY   IKE+ +    +  + V D+D   NG+I +   +S  + I   F L    Q++  V   ++ I+ LDYE + + + F +VA+D G+   SSTA + + + NVND  P I F +  + I+  ++   I+EGT  + ++  V+V+D D+  + + C + T +    +   +    +   K + +++  + DRE        +   V++ C D +    L     + +II D+NDN P F+   YYG ++EN  N  V +N   I A DKD   NG V Y+I     D KN     YF ID   G +      D+EK    S  + A D G P R SSS  +IV +KD NDN P+   S ++F + EN  IG  +G++N TD+D+   +K I   +K+        +   A ++ T+D  +G+I T+  +DRE +S I F + + NP+         R F D + E  + + + D ND+ P   LKD        P  S +  S       + C + P+   D D+  N      VR+    N   SL  D   +  + ++P  +      ++A D   N+S + E    I    DP+
Sbjct:   18 LKVSKQIDREELCPPQMMLQL---NKVCGSIHTCCHILDFQISCNNEEMQSNFIRVFVDDENDNNPVFPIVQTPYCTIEENKPLGYRIPLPKAQDLDNATFSVSSYKLELP-------FKLGNSSDFELAKHFKDGVPYLIITSTLDREKTSMYTFTLIAIDGVEGNRNTGKTEITIKIRDINDNAPKFERPIYIRTIKENVIVD-PIFQILVTDEDEDENGRIDLKMHNSGQEWINKIFTLDILDQSIGKVQAQVRAINNLDYEQLYHSFEFKIVAQDGGRNSLSSTATLRIQILNVNDMSPEIRFVRNGQQITGGFS---IDEGTLSNKILAYVQVSDADSMINQLQCSLLTPRNILMIEESRFRHPVNIYKQFSLRTTQNIDREANEPFLIDSKIIVTVQCDDYDNEIPLNTNASIFIIINDVNDNPPKFTQNVYYGQIEENINNHEVFMNA-AIHAADKDLHLNGKVTYHIQ----DFKNSSNAMYFRIDSQNGKIYNSQSFDFEKESIYSFIVVATDQGHPNRLSSSSTIIVRIKDQNDNAPQFSQSHFAFFVDENVEIGHLIGQINATDRDSLPEHKDIRFIVKS-------DSQNRASKLITLDPLTGQIRTRYPIDREKTSTITFFVESKNPS---------RIFNDLIQEAMIVITVRDLNDSPPTFRLKD--------PSKSQLIISLETLQQGQICESIPFEVEDADDNNNVNPCCVVRLKHNYNGLLSLADDTQNIICINQVPKKVKSLPVTLIASDKHGNDSIETEITFKILFINDPN 765          
The following BLAST results are available for this feature:
BLAST of Protocadherin-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH17.473e-6229.34protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH11.052e-6129.34protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
PCDH11Y2.984e-5629.81protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y6.332e-5629.81protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
PCDH11Y6.332e-5629.81protocadherin 11 Y-linked [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdh-14.615e-4125.46CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
fmi-12.048e-3426.02FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
fmi-11.175e-2926.30FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
hmr-11.256e-2525.43Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
hmr-11.256e-2525.43Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ds2.272e-4727.48gene:FBgn0284247 transcript:FBtr0078045[more]
ds2.272e-4727.48gene:FBgn0284247 transcript:FBtr0343249[more]
stan1.675e-4127.64gene:FBgn0024836 transcript:FBtr0304900[more]
stan1.940e-4127.64gene:FBgn0024836 transcript:FBtr0339463[more]
stan2.073e-4127.64gene:FBgn0024836 transcript:FBtr0304899[more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.593e-6228.88protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a4.576e-6228.88protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh7b2.512e-5728.62protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
pcdh7b3.088e-5728.62protocadherin 7b [Source:ZFIN;Acc:ZDB-GENE-081104-... [more]
CT030123.13.125e-5727.67protocadherin 1b [Source:NCBI gene;Acc:572016][more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh177.412e-6127.96protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh178.054e-6127.96protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.036e-6027.96protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.149e-6027.96protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh171.262e-6027.96protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh13.139e-6127.80protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh16.780e-6127.80protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh16.780e-6127.80protocadherin 1 [Source:MGI Symbol;Acc:MGI:104692][more]
Pcdh95.166e-5428.49protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh95.166e-5428.49protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q08174|PCDH1_HUMAN3.589e-6129.34Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q9BZA8|PC11Y_HUMAN1.433e-5529.81Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6WXV7|PC11X_PONPY1.538e-5529.96Protocadherin-11 X-linked OS=Pongo pygmaeus OX=960... [more]
sp|Q6X862|PC11X_GORGO1.786e-5529.81Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
sp|Q6WYY1|PC11X_PANPA3.974e-5529.67Protocadherin-11 X-linked OS=Pan paniscus OX=9597 ... [more]
back to top
BLAST of Protocadherin-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7JVJ32.042e-9330.17Protocadherin-9 (Fragment) OS=Clonorchis sinensis ... [more]
H2KTP11.335e-9230.06Protocadherin-9 OS=Clonorchis sinensis OX=79923 GN... [more]
A0A183AF392.284e-9229.09Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A4S2LR152.261e-8929.74Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LR015.763e-8929.74Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a1.363e-6127.78protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a1.541e-6127.78protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1b3.616e-6029.28protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh7a8.322e-5526.82protocadherin 7a [Source:ZFIN;Acc:ZDB-GENE-120206-... [more]
pcdh7b3.202e-5426.95protocadherin 7 [Source:NCBI gene;Acc:103034658][more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh111.094e-5529.68protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000008517.18.773e-4726.91pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
si:ch211-199f5.11.558e-4527.73protocadherin 8 [Source:HGNC Symbol;Acc:HGNC:8660][more]
ENSPMAT00000010725.13.393e-4425.58pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000009557.13.745e-3624.89pep scaffold:Pmarinus_7.0:GL476748:59426:101420:1 ... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO461891.320e-5227.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354121.062e-4927.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482373.049e-4328.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404705.932e-4128.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303642.809e-3926.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh1a3.277e-6528.45protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1a3.312e-6528.45protocadherin-1 [Source:NCBI gene;Acc:101157079][more]
pcdh1b2.137e-5729.10protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b2.778e-5729.12protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh7b3.757e-5427.57protocadherin 7 [Source:NCBI gene;Acc:101166584][more]
back to top
BLAST of Protocadherin-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042783.11.271e-1699.70SMESG000042783.1[more]
SMESG000033582.19.319e-12533.42SMESG000033582.1[more]
SMESG000033582.12.182e-11333.91SMESG000033582.1[more]
SMESG000048159.11.290e-7630.69SMESG000048159.1[more]
SMESG000053174.11.385e-7430.85SMESG000053174.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031442 ID=SMED30031442|Name=Protocadherin-1|organism=Schmidtea mediterranea sexual|type=transcript|length=3218bp
ATTTTTAGTATATCAATCAGACCTTTGACAAAAAATATTTCAAAAGAAAA
ATGGAAATTATTTTATTGATCTTAATTTTTTTCTGTCAACTCTCAGAACT
TGATGCATGTGACAGTATCAAGCAAGTAGAAATTACAGAAACTACAGTTT
CACTGTTTGAGTTGGCTGACGTTTCTGATCACATTGGCCGGTCTGGATTA
AAATCTGATTCGTTTTATCTGTCAGAAGACACCGATTCTTTCCAACTGAT
AAACGGCCGAGTTACATTGCGGAGACCAATAGATCGAGAAGAATATTGTT
CAAAATCCAATAAACACCAAACATATATCAACTCTCAGTGCTGTGGAGGT
CAGTGTTGCCTATTCATTGGTATAGCATCGAATGACAACACTAAAAAGAA
AGTCTACATAAAAATCAAAGTCGTCGATATCAACGATAACAGTCCAACTT
TTCCAGAGAAAACCTATTACAAAGAAATCTTAGAAAATTCTAAAATCAAT
TCTAGAATCTCCTTACCCATGGCTTACGATGCCGATGACTTACCCTTCGG
AGTCGAATCATATGAAATAGAAAAACCAAATGAAAATTTCGATGTTTATT
TCAAATTGATGACTGAAGATTTCGTTGACAACAAACAGCCGATTCTGATT
GTCAAGCACCAAATTGACAGGGAATTCATAGATCGTATAGAATTTACGTT
GATTGCCGTTGACGGTGGAAAACCTCCAAGAAAAGGCAAAACAAAAATAA
TTCTCAAAGTTCTTGATGAAAATGATTGTGAACCGCAATTTTCACAATTA
ATCTATGAAATTAAAATAAAAGAAAGTGAAATGACGGGTTTAGAATTACT
CCATTTAAGAGTCGAGGACAAAGATTCGGGAAATAATGGAAAGATATCCA
TCAACTTTGCCTCATCAACAAATCAGGATATTCAAAATACTTTTCAGTTG
AGTCAAACTTTACACGGGGTAGCTTTGAAGTTGATATCAAAATTGGACTA
CGAAACAATTAATAAGTATTCGTTTAACTTAGTGGCTAAAGATTTCGGAC
AGCCACCGAGAAGTAGCACGGCTTTGGTGGAGGTTTTCGTGACAAATGTA
AACGATTCACCTCCAAATATTGTTTTCTATCAGTTTAATAAGCCAATTAG
CAAACAATATGCAAGAATCTACATTAACGAAGGAACGACAAAGGATATGG
TCATATGCCTAGTCAAAGTCACAGATGATGATAACCAAGCCGATTCAATA
ACCTGTGAAATCGAGACTTCTCAAGAATCATTCTATTTAAATGCCCTTAA
AACTAATGCGGTTTTAGAAAACAGAAAGACTTATGAAATTAAAAGCAAAA
TTGATTTTGATAGAGAAACTAAAACCTTGCATTTTGTAAGCATCGTTTGC
TCTGACACTGAAGGTATCAACCAACTTAAACAAACAAACAAATTGGAGGT
CATAATAAAGGATATAAACGACAATGCCCCAGTATTTTCAAGTCCTCGTT
ATTATGGTATTGTCAAGGAGAATAGAGTGAATGAAATTGTAACAATTAAT
AAAGATCCAATTCTTGCCACTGATAAGGATGAAGGAGAAAATGGAACTGT
TGAATATTACATTAGCAATGTAGTGGATGATATGAAAAATTATTTTTCAA
TAGATAAAAACACCGGAGTTGTTAAAACAATTTTGGGATTAGACTACGAA
AAGATCAAACATGTTTCTATAGAGATTTCAGCAAAGGATTTAGGAGTTCC
GGTTCGATCTTCTTCAGTAAAATTAATTGTTAATGTAAAGGACACAAATG
ACAATCAACCGGAAGTCGATTTGTCATTTTATTCGTTTGAGTTGTATGAG
AATGAACCGATTGGCACATATGTCGGAAAAGTAAATGTCACAGATAAAGA
TACTGATATCAATAATAAAAGGATCATAATGAAAATAAAAAACCTGTTGC
CGGGACCAACGCTAGGGACCTCTCAGCCAGCTGATCAGATTTTTACCATT
GACAATGAAAGTGGTAAAATCTATACCAAAGTAGTTTTAGATCGGGAAAT
GTCTAGCCAAATCCCTTTTGCCATTATCGCATCCAATCCGAATCCTTTGG
ATTATGGAAAAGATTTATTTCGACAATTCAGAGACACAATGGAGATATCG
GTCACCGTTAACATACTGGATAAGAATGACAACAGTCCAATGATGATGTT
GAAAGATAAGCCACAAGTGAAAGCTGTAAATCCAGAGGTCTCATTTATTA
AGACATCAACAAATGAAAACATATACCCGGAAAATTGCGTAACATTTCCA
TATATTTTTGTCGATTTAGACGAAGGAGAAAACAGCAAAGTCAGAGTAAC
AATGAAAAATAATGATTATTTTTCATTGACTCCCGATTATGGAATGTTAT
GTGCCATGGAAAAATTGCCCCCCATTGGTGATTACAAAACAGTAATAGTT
GCCGAGGATGGAGACTTTAATAATTCGAGAAAACAGGAATTCCTTATCAA
CATACATATCAAAGAGGATCCACATACTTTAAATAATAAAATAAGGACAT
CTCAAGGCAATCATGAATCCAAATATAATTCGGAATATCCCGCACGAAGC
AATGAACGTTATTTTCGAAATAATATTATTTATGTCATTATCGGATCCAT
TGCGGCGATTTTATTTCTACTGCTTATTATTATTCTCGTCAAGTTTCGAA
AATTCCTCATTAATGAAACAAGTTTTGGACAAGTATCGACAAAAAACCCT
CCCGATTCGTTAGAATGTCAAGATTTCTTTGAAAGTATTCCTGATTCAAA
GTATAACGACCTCTCTTTCGTTAAGAATAGACAACCAGAAAGCTACCGAA
ACGATTACCAATTTAAAAGTATGGAACCGAAGATAATTGAGAAGTATGAA
TCAGCTGATCCAATCTTTCATGAGGTTAGGAATTTCAATAATATATCAAA
CCAGATGCCCCAATCATACAATTATCAGACGATTCCGACACAATTCCTTC
CTGATCCAATGCATTTATATCATTCTCTGGGCAACTCGAAATCAGAACTG
GTTTTTCAACCACCAAACAAGTTCACTAATATACAAATGCCCAAATTTTG
AACGAAAATAACTCTCCGGTTTTCAACAACTCCCAGTCAACTTCAATTGT
AGTTAACACTAATAAAGCTAAAACAACAAATGTCAAATCGCCGTTTCAGT
CGACTTTTGTGTGAAGCA
back to top

protein sequence of SMED30031442-orf-1

>SMED30031442-orf-1 ID=SMED30031442-orf-1|Name=SMED30031442-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1017bp
MEIILLILIFFCQLSELDACDSIKQVEITETTVSLFELADVSDHIGRSGL
KSDSFYLSEDTDSFQLINGRVTLRRPIDREEYCSKSNKHQTYINSQCCGG
QCCLFIGIASNDNTKKKVYIKIKVVDINDNSPTFPEKTYYKEILENSKIN
SRISLPMAYDADDLPFGVESYEIEKPNENFDVYFKLMTEDFVDNKQPILI
VKHQIDREFIDRIEFTLIAVDGGKPPRKGKTKIILKVLDENDCEPQFSQL
IYEIKIKESEMTGLELLHLRVEDKDSGNNGKISINFASSTNQDIQNTFQL
SQTLHGVALKLISKLDYETINKYSFNLVAKDFGQPPRSSTALVEVFVTNV
NDSPPNIVFYQFNKPISKQYARIYINEGTTKDMVICLVKVTDDDNQADSI
TCEIETSQESFYLNALKTNAVLENRKTYEIKSKIDFDRETKTLHFVSIVC
SDTEGINQLKQTNKLEVIIKDINDNAPVFSSPRYYGIVKENRVNEIVTIN
KDPILATDKDEGENGTVEYYISNVVDDMKNYFSIDKNTGVVKTILGLDYE
KIKHVSIEISAKDLGVPVRSSSVKLIVNVKDTNDNQPEVDLSFYSFELYE
NEPIGTYVGKVNVTDKDTDINNKRIIMKIKNLLPGPTLGTSQPADQIFTI
DNESGKIYTKVVLDREMSSQIPFAIIASNPNPLDYGKDLFRQFRDTMEIS
VTVNILDKNDNSPMMMLKDKPQVKAVNPEVSFIKTSTNENIYPENCVTFP
YIFVDLDEGENSKVRVTMKNNDYFSLTPDYGMLCAMEKLPPIGDYKTVIV
AEDGDFNNSRKQEFLINIHIKEDPHTLNNKIRTSQGNHESKYNSEYPARS
NERYFRNNIIYVIIGSIAAILFLLLIIILVKFRKFLINETSFGQVSTKNP
PDSLECQDFFESIPDSKYNDLSFVKNRQPESYRNDYQFKSMEPKIIEKYE
SADPIFHEVRNFNNISNQMPQSYNYQTIPTQFLPDPMHLYHSLGNSKSEL
VFQPPNKFTNIQMPKF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 458..477
score: 39.51
coord: 247..276
score: 25.63
coord: 477..490
score: 38.4
coord: 697..714
score: 39.27
coord: 60..79
score: 23.73
coord: 322..334
score: 32.53
coord: 537..563
score: 27.61
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 269..355
e-value: 2.8E-15
score: 66.7
coord: 156..245
e-value: 1.6E-9
score: 47.6
coord: 504..587
e-value: 1.9E-24
score: 97.2
coord: 388..477
e-value: 0.0078
score: 25.4
coord: 611..713
e-value: 7.7E-10
score: 48.7
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 504..579
e-value: 4.4E-13
score: 49.5
coord: 142..238
e-value: 4.7E-7
score: 30.2
coord: 594..688
e-value: 8.2E-12
score: 45.4
coord: 252..348
e-value: 8.5E-15
score: 55.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 354..474
e-value: 7.0E-13
score: 51.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 585..715
e-value: 1.4E-20
score: 75.8
coord: 133..242
e-value: 9.8E-21
score: 76.3
coord: 243..353
e-value: 1.2E-24
score: 88.9
coord: 475..584
e-value: 4.6E-26
score: 93.5
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 24..132
e-value: 1.1E-5
score: 27.6
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 547..933
coord: 8..588
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 480..589
score: 22.87
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 135..247
score: 18.069
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 55..134
score: 13.071
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 367..479
score: 13.378
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 248..357
score: 20.854
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 590..715
score: 19.692
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 372..475
e-value: 1.5924E-9
score: 53.8566
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 594..711
e-value: 2.19179E-17
score: 76.1981
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 251..352
e-value: 6.39558E-20
score: 83.5169
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 138..242
e-value: 3.06261E-16
score: 73.1165
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 484..585
e-value: 9.34897E-26
score: 100.081
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.802
NoneNo IPR availableTMHMMTMhelixcoord: 858..880
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 703..713
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 577..587
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 122..132
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 467..477
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 370..492
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 473..588
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 703..813
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 577..718
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 236..360
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 127..239