FMRFamide-activated amiloride-sensitive sodium channel

Overview
NameFMRFamide-activated amiloride-sensitive sodium channel
Smed IDSMED30031431
Length (bp)1888
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30031431) t-SNE clustered cells

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30031431) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FMRFamide-activated amiloride-sensitive sodium channel (SMED30031431) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FMRFamide-activated amiloride-sensitive sodium channel (SMED30031431) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031431

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30031431SMESG000016913.1 dd_Smed_v4_9790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30031431SMESG000016913.1 dd_Smed_v4_9790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30031431SMESG000016913.1 dd_Smed_v4_9790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30031431SMESG000016913.1 dd_Smed_v4_9790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30031431SMESG000016913.1 dd_Smed_v4_9790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30031431SMESG000016913.1 dd_Smed_v4_9790_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031431SMESG000016913.1 Contig40251newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30031431SMESG000016913.1 Contig40251uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30031431SMESG000016913.1 dd_Smed_v4_9790_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1G (sodium channel epithelial 1 gamma subunit [Source:HGNC Symbol;Acc:HGNC:10602])

HSP 1 Score: 57.7658 bits (138), Expect = 5.290e-8
Identity = 60/242 (24.79%), Postives = 102/242 (42.15%), Query Frame = 2
Query:  605 GESCKDDMLVVKRFSHPSYFNCYTV-----EPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCN-DNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHV 1312
            G SC  D      F HP + NCYT      E I   +M  S  G  + L  NE+        FLV     + G +V +H    YP ++ +G +IE   +  +      + +++ P  +C  D   V  +++  +  Y  ++CL+   Q  +VEKCGC    Y +   P    NYC +    N       L+    ++    G ++  +++C  +    ++ L  S+ +W P+     WL  V
Sbjct:  264 GVSC--DARNFTLFHHPMHGNCYTFNNRENETILSTSMGGSEYGLQVILYINEE----EYNPFLVS----STGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSDVPIRNI-YNAAYSLQICLHSCFQTKMVEKCGC--AQYSQPLPP--AANYCNYQQHPNWMYCYYQLH--RAFVQEELGCQSVCKEACSFK----EWTLTTSLAQW-PSVVSEKWLLPV 483          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 52.373 bits (124), Expect = 1.925e-6
Identity = 34/145 (23.45%), Postives = 61/145 (42.07%), Query Frame = 2
Query:  644 FSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPR 1078
            F HP Y NCYT        + +S +  I        + +R +Q   + +     G RV VH       +D  G  + PG    ++ +     R+      C  N +    +      Y +++C++   Q+ ++++CGC Y +YPR
Sbjct:  297 FHHPMYGNCYTFNDKNNSNLWMSSMPGI---NNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPR 438          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 52.373 bits (124), Expect = 2.434e-6
Identity = 35/147 (23.81%), Postives = 62/147 (42.18%), Query Frame = 2
Query:  644 FSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDI--RHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPR 1078
            F HP Y NCYT        + +S +  I     N  + +  R +Q   + +     G RV VH       +D  G  + PG    ++ +     R+      C  N +    +      Y +++C++   Q+ ++++CGC Y +YPR
Sbjct:  297 FHHPMYGNCYTFNDKNNSNLWMSSMPGI-----NNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPR 438          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 51.9878 bits (123), Expect = 2.808e-6
Identity = 35/147 (23.81%), Postives = 62/147 (42.18%), Query Frame = 2
Query:  644 FSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDI--RHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPR 1078
            F HP Y NCYT        + +S +  I     N  + +  R +Q   + +     G RV VH       +D  G  + PG    ++ +     R+      C  N +    +      Y +++C++   Q+ ++++CGC Y +YPR
Sbjct:  320 FHHPMYGNCYTFNDKNNSNLWMSSMPGI-----NNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPR 461          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 51.6026 bits (122), Expect = 4.552e-6
Identity = 35/147 (23.81%), Postives = 62/147 (42.18%), Query Frame = 2
Query:  644 FSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDI--RHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPR 1078
            F HP Y NCYT        + +S +  I     N  + +  R +Q   + +     G RV VH       +D  G  + PG    ++ +     R+      C  N +    +      Y +++C++   Q+ ++++CGC Y +YPR
Sbjct:  356 FHHPMYGNCYTFNDKNNSNLWMSSMPGI-----NNGLSLMLRAEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNLRPGVETSISMRKETLDRLGGDYGDCTKNGSDVPVENLYPSKYTQQVCIHSCFQESMIKECGCAYIFYPR 497          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 62.7734 bits (151), Expect = 5.961e-10
Identity = 92/382 (24.08%), Postives = 157/382 (41.10%), Query Frame = 2
Query:  653 PSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFN--YDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLR--CRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDXXXXXXXXXXXXXQMKSHLEYFKKFLNQANLSRHSDSENSQSIFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIG---LTFAFFAEV------IEYFYVCLFTRSDDDNQKASSTTVIIVN--ENSPKKN 1753
            P Y NCYT      V +  SR G +  L    ++   H+  ++     +A G+R+ VHE    P  D  G     G ++    +     R+++P   C+D    T++ +   +N  Y  E C     Q  V+E CGC     PR+  P++ H +C      N KS ID   CL   + S SG   +L + C  R  C    ++ A S + W             +Q+F+   D               S +    ++  EY+++  N A +           I+ ++ +F  +K     T V           L S  GG   L+IG   +TFA FAE+      + YF   ++ +     ++ +S++++ ++  + SPKK+
Sbjct:  442 PEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNV---HQSDYMPTT--EAAGVRLVVHEQDQEPFPDTFGYSAPTGFISSFGLKTKELHRLSAPWGNCSD----TFRPVPYIYNEHYSPEGCHRNCFQLKVLEICGC---GDPRFPLPSEEHRHC------NAKSKIDR-QCLSN-LTSDSGGYHHLHEQCECRQPCHEKVFETAYSASAW------------PSQNFKIGTDC-----------PAVSDIFNDTEACTEYYRQ--NTAYI----------EIYYEQLNFESLKETAGYTLVN----------LFSDFGGNIGLWIGFSVITFAEFAELFCEICKLMYFKGIVYVQKKMQGKEYTSSSLMHIDFLQRSPKKS 758          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 62.7734 bits (151), Expect = 6.327e-10
Identity = 59/211 (27.96%), Postives = 91/211 (43.13%), Query Frame = 2
Query:  653 PSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFN--YDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLR--CRNIDYDLAVSVTKW 1273
            P Y NCYT      V +  SR G +  L    ++   H+  ++     +A G+R+ VHE    P  D  G     G ++    +     R+++P   C+D    T++ +   +N  Y  E C     Q  V+E CGC     PR+  P++ H +C      N KS ID   CL   + S SG   +L + C  R  C    ++ A S + W
Sbjct:  441 PEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNV---HQSDYMPTT--EAAGVRLVVHEQDQEPFPDTFGYSAPTGFISSFGLKTKELHRLSAPWGNCSD----TFRPVPYIYNEHYSPEGCHRNCFQLKVLEICGC---GDPRFPLPSEEHRHC------NAKSKIDR-QCLSN-LTSDSGGYHHLHEQCECRQPCHEKVFETAYSASAW 631          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 62.3882 bits (150), Expect = 8.130e-10
Identity = 59/211 (27.96%), Postives = 91/211 (43.13%), Query Frame = 2
Query:  653 PSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFN--YDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLR--CRNIDYDLAVSVTKW 1273
            P Y NCYT      V +  SR G +  L    ++   H+  ++     +A G+R+ VHE    P  D  G     G ++    +     R+++P   C+D    T++ +   +N  Y  E C     Q  V+E CGC     PR+  P++ H +C      N KS ID   CL   + S SG   +L + C  R  C    ++ A S + W
Sbjct:  443 PEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNV---HQSDYMPTT--EAAGVRLVVHEQDQEPFPDTFGYSAPTGFISSFGLKTKELHRLSAPWGNCSD----TFRPVPYIYNEHYSPEGCHRNCFQLKVLEICGC---GDPRFPLPSEEHRHC------NAKSKIDR-QCLSN-LTSDSGGYHHLHEQCECRQPCHEKVFETAYSASAW 633          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: unc-8 (Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:Q21974])

HSP 1 Score: 62.3882 bits (150), Expect = 8.132e-10
Identity = 59/211 (27.96%), Postives = 91/211 (43.13%), Query Frame = 2
Query:  653 PSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFN--YDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLR--CRNIDYDLAVSVTKW 1273
            P Y NCYT      V +  SR G +  L    ++   H+  ++     +A G+R+ VHE    P  D  G     G ++    +     R+++P   C+D    T++ +   +N  Y  E C     Q  V+E CGC     PR+  P++ H +C      N KS ID   CL   + S SG   +L + C  R  C    ++ A S + W
Sbjct:  402 PEYGNCYTFNFNDSVELKNSRAGPMYGLRLLLNV---HQSDYMPTT--EAAGVRLVVHEQDQEPFPDTFGYSAPTGFISSFGLKTKELHRLSAPWGNCSD----TFRPVPYIYNEHYSPEGCHRNCFQLKVLEICGC---GDPRFPLPSEEHRHC------NAKSKIDR-QCLSN-LTSDSGGYHHLHEQCECRQPCHEKVFETAYSASAW 592          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Match: del-4 (DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P91835])

HSP 1 Score: 58.9214 bits (141), Expect = 6.649e-9
Identity = 87/402 (21.64%), Postives = 152/402 (37.81%), Query Frame = 2
Query:  113 TSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEV---SAQLGHN-QSMFHHCMWWYGKQMAFGESCKDDMLVVKRFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANL--EKSCLLRCRNIDYDLAVSVTKWR-----PTE 1285
            TS  G   I    + +++  W + ++ +  L       +L +Y  +SVN +T  +F   T FP VT C+  P+ L+               +N      SS     L  + T +   +   WT       +Y + L  +    +A + ++   M   C +         ++C  ++     F +PSY NC         +   SR G +  L     + +R  Q   +  + +A G+ + +H     P  D  G    PG  + L    V   R++ P   C     +          Y  E C    +Q+ ++  CGC   YYP Y   + T  Y   ++  N    + NLNC+   ++S+   + ++  +  C   C    Y + VS  +W      PTE
Sbjct:   19 TSTHGVPHIGMANARWLRAFWILVVVVSIALFIWQFITLLTNYLSFSVNTETTLQFAERT-FPTVTICHLNPWKLSETKSVDPDMSALIDAYNSD----SSSAQFGLPASLTADRQQQASKWTL------MYSERLNEKQYNDAADIAYSYDDMVVSCTY-------NAKTC--NITDFNDFYNPSYGNCLQFNTDGMYSS--SRAGPLYGL----RMVMRTDQDTYLP-WTEASGVIIDIHMQDEIPYPDVFGYFAPPGTASSLGVSYVQTTRLSKPYGSCTTKTKLKTTHY--TGTYTVEACFRSCMQEKIIASCGC---YYPAYSHASNTTQY---VSCDNGVQTLSNLNCV-DLINSADSTEFDVLTDCDCPQPCEIDSYGVTVSTAQWPSDSYVPTE 384          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: foxe3 (forkhead box E3 [Source:Xenbase;Acc:XB-GENE-480592])

HSP 1 Score: 63.5438 bits (153), Expect = 7.264e-10
Identity = 51/215 (23.72%), Postives = 81/215 (37.67%), Query Frame = 2
Query:  638 KRFSHPSYFNCYTVEPI-KQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTH--NYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKW 1273
            K F HP Y +C+TV P  K+ A+   R G    L     +D +H     + +  QA G R+ +H     P ++  G  I PG    +  +      +      C  +       L    +Y  + CLN   Q  + E CGC Y +YP    P  T   NY  H  +          +C  +  +     + +    C ++C    Y L+    +W
Sbjct:  254 KFFHHPIYGSCFTVTPQGKENALYSPRAGKKYGLSLKMKVDQKHN----MPLLSQAAGARIMIHNPNQPPRVEHQGFDIRPGTETSIGVKQDEVRHLGGKYGPCASDGNNLGLKLLYSTSYTLQACLNSCFQYKMTETCGCGYYFYP---LPPGTEYCNYNKHPGWG---------HCFYQLYEKMLDHRHHCFTQCPMQCTKTRYQLSAGTAQW 452          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 62.3882 bits (150), Expect = 1.755e-9
Identity = 57/236 (24.15%), Postives = 101/236 (42.80%), Query Frame = 2
Query:  644 FSHPSYFNCYTVEPIKQVAMDISRIGAIIW-LGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCN-DNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKWRP------TEW--QLYWLKHVNQH 1321
            F HP Y NCYT    ++  + +S +G   + L     ID      +L      A G ++ VH+   YP I+ +G ++E      +  Q   + +++ P   C  D   V+ ++L     Y  ++CLN   Q+ +V  CGC +   P    PN    YC +  + +   I        +++    G ++   +SC  +    ++ L  S+ KW        + W  QL+++ H N H
Sbjct:  276 FHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPYL----STAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENL-YSKKYTLQICLNSCFQREMVRTCGCAHYDQP---LPNGA-KYCNYEEYPS--WIYCYFKLYKQFVQEELGCQSACRESCSFK----EWTLTRSLAKWPSLNSEVRSAWVLQLFYVGHGNSH 496          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: copg2 (coatomer protein complex subunit gamma 2 [Source:Xenbase;Acc:XB-GENE-941264])

HSP 1 Score: 61.6178 bits (148), Expect = 2.593e-9
Identity = 55/222 (24.77%), Postives = 91/222 (40.99%), Query Frame = 2
Query:  641 RFSHPSYFNCYTVEP-IKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDF----NYDKELCLNYEIQKVVVEKCGCLYGYYP-----RYFFPNKTHNYCGHLNFTNDKSIIDN-LNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKW 1273
             F HP Y NC+T+    K+ +   SR G    L      D+       + +  QA G R+ +H     P ++  G  I PG  N ++ +    +R+     +C  + +    DLG+      +Y  + CLN   Q  ++E CGC Y +YP      Y   NK H   G+  +   + ++D+ L C  +               C  +C+  +Y L+    KW
Sbjct:  255 HFHHPIYGNCFTINNHWKENSWYSSRPGKQYGLSIVVKTDLHDN----MPLLSQAAGARIMIHNPNQPPLVEHQGFDIRPGTENSISVKQEEAIRLGGKYSQCTSDGS----DLGIKILYNTSYTMQACLNSCFQYKMIEVCGCGYYFYPLPPGMEYCNYNK-HPDWGYCFYQLYEKMLDHTLICFTQ---------------CPKQCKQTEYHLSAGTAKW 452          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: copg2 (coatomer protein complex subunit gamma 2 [Source:Xenbase;Acc:XB-GENE-941264])

HSP 1 Score: 61.6178 bits (148), Expect = 3.010e-9
Identity = 56/222 (25.23%), Postives = 90/222 (40.54%), Query Frame = 2
Query:  641 RFSHPSYFNCYTVEP-IKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDF----NYDKELCLNYEIQKVVVEKCGCLYGYYP-----RYFFPNKTHNYCGHLNFTNDKSIIDN-LNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKW 1273
             F HP Y NC+T+    K+ +   SR G    L      D+      L     QA G R+ +H     P ++  G  I PG  N ++ +    +R+     +C  + +    DLG+      +Y  + CLN   Q  ++E CGC Y +YP      Y   NK H   G+  +   + ++D+ L C  +               C  +C+  +Y L+    KW
Sbjct:  255 HFHHPIYGNCFTINNHWKENSWYSSRPGKQYGLSIVVKTDLHDNMPLL----SQAAGARIMIHNPNQPPLVEHQGFDIRPGTENSISVKQEEAIRLGGKYSQCTSDGS----DLGIKILYNTSYTMQACLNSCFQYKMIEVCGCGYYFYPLPPGMEYCNYNK-HPDWGYCFYQLYEKMLDHTLICFTQ---------------CPKQCKQTEYHLSAGTAKW 452          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Match: cdh12 (cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase;Acc:XB-GENE-982876])

HSP 1 Score: 58.151 bits (139), Expect = 3.294e-8
Identity = 51/212 (24.06%), Postives = 91/212 (42.92%), Query Frame = 2
Query:  644 FSHPSYFNCYTVEPIKQVAMDISRIGAIIW-LGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCN-DNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKW 1273
            F HP Y NCYT    ++  + +S +G   + L     ID      +L      A G ++ VH+   YP I+ +G ++E      +  Q   + +++ P   C  D   V+ ++L     Y  ++CLN   Q+ +V  CGC +   P    PN    YC +  + +   I        +++    G ++   +SC  +    ++ L  S+ KW
Sbjct:  276 FHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPYL----STAAGAKILVHDQDEYPFIEDLGTELETATETSIGMQLTESTKLSDPYSDCTMDGSDVSVENL-YSKKYTLQICLNSCFQREMVRTCGCAHYDQP---LPNGA-KYCNYEEYPS--WIYCYFKLYKQFVQEELGCQSACRESCSFK----EWTLTRSLAKW 472          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1g (sodium channel, nonvoltage-gated 1 gamma [Source:MGI Symbol;Acc:MGI:104695])

HSP 1 Score: 62.7734 bits (151), Expect = 8.559e-10
Identity = 62/241 (25.73%), Postives = 96/241 (39.83%), Query Frame = 2
Query:  605 GESCKDDMLVVKRFSHPSYFNCYTV-----EPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHV 1312
            G SC  D      F HP Y NCYT        I   +M  S  G  + L  NED        FLV     + G +V VH+   YP I+ +G +IE      +      + +++ P  +C ++ +        +  Y  ++CL    Q  +VEKCGC    Y +   P    NYC +    N       + C  +   +    +   +  C   C   ++ L  S+ +W P+E    WL +V
Sbjct:  270 GMSC--DARNFTLFHHPMYGNCYTFNNRENATILSTSMGGSEYGLQVILYINED----EYNPFLVS----STGAKVLVHQQNEYPFIEDVGTEIETAMSTSIGMHLTESFKLSEPYSQCTEDGSDVPVTNIYNAAYSLQICLYSCFQTKMVEKCGC--AQYSQPLPP--AANYCNYQQHPN------WMYCYYQLYQAFVREELGCQSVCKQSCSFKEWTLTTSLAQW-PSEASEKWLLNV 489          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 52.7582 bits (125), Expect = 1.177e-6
Identity = 46/221 (20.81%), Postives = 87/221 (39.37%), Query Frame = 2
Query:  641 RFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPT-VTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTN---------DKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKW 1273
            +F HP Y NCYT        + +S +  +        + +R +Q   + +     G RV VH       +D  G  + PG    ++ +      +      C +N + V  ++L     Y +++C++   Q+ +++KCGC Y +YP+     K   +C +L  ++             +D+L C  K               C   C   +Y L+   ++W
Sbjct:  217 QFHHPMYGNCYTFNNKNNSNLWMSSMPGV---NNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNL-YPSKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFCDYLKQSSWGYCYYKLQAAFSLDSLGCFSK---------------CRKPCSVTNYKLSAGYSRW 414          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 52.7582 bits (125), Expect = 1.210e-6
Identity = 46/221 (20.81%), Postives = 87/221 (39.37%), Query Frame = 2
Query:  641 RFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPT-VTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTN---------DKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKW 1273
            +F HP Y NCYT        + +S +  +        + +R +Q   + +     G RV VH       +D  G  + PG    ++ +      +      C +N + V  ++L     Y +++C++   Q+ +++KCGC Y +YP+     K   +C +L  ++             +D+L C  K               C   C   +Y L+   ++W
Sbjct:  217 QFHHPMYGNCYTFNNKNNSNLWMSSMPGV---NNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNL-YPSKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFCDYLKQSSWGYCYYKLQAAFSLDSLGCFSK---------------CRKPCSVTNYKLSAGYSRW 414          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 52.373 bits (124), Expect = 1.735e-6
Identity = 46/221 (20.81%), Postives = 87/221 (39.37%), Query Frame = 2
Query:  641 RFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPT-VTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTN---------DKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKW 1273
            +F HP Y NCYT        + +S +  +        + +R +Q   + +     G RV VH       +D  G  + PG    ++ +      +      C +N + V  ++L     Y +++C++   Q+ +++KCGC Y +YP+     K   +C +L  ++             +D+L C  K               C   C   +Y L+   ++W
Sbjct:  298 QFHHPMYGNCYTFNNKNNSNLWMSSMPGV---NNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNL-YPSKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFCDYLKQSSWGYCYYKLQAAFSLDSLGCFSK---------------CRKPCSVTNYKLSAGYSRW 495          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Match: Scnn1a (sodium channel, nonvoltage-gated 1 alpha [Source:MGI Symbol;Acc:MGI:101782])

HSP 1 Score: 52.373 bits (124), Expect = 1.735e-6
Identity = 46/221 (20.81%), Postives = 87/221 (39.37%), Query Frame = 2
Query:  641 RFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPT-VTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTN---------DKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKW 1273
            +F HP Y NCYT        + +S +  +        + +R +Q   + +     G RV VH       +D  G  + PG    ++ +      +      C +N + V  ++L     Y +++C++   Q+ +++KCGC Y +YP+     K   +C +L  ++             +D+L C  K               C   C   +Y L+   ++W
Sbjct:  298 QFHHPMYGNCYTFNNKNNSNLWMSSMPGV---NNGLSLTLRTEQNDFIPLLSTVTGARVMVHGQDEPAFMDDGGFNVRPGVETSISMRKEALDSLGGNYGDCTENGSDVPVKNL-YPSKYTQQVCIHSCFQENMIKKCGCAYIFYPK----PKGVEFCDYLKQSSWGYCYYKLQAAFSLDSLGCFSK---------------CRKPCSVTNYKLSAGYSRW 495          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q25011|FANA_CORAP (FMRFamide-activated amiloride-sensitive sodium channel OS=Cornu aspersum OX=6535 PE=2 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.467e-12
Identity = 109/570 (19.12%), Postives = 218/570 (38.25%), Query Frame = 2
Query:   86 DYTKTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGHN-QSMFHHCMWWYGKQMAFGESCKDDMLVVKRFS---HPSYFNCYTVEPIKQVAMDIS--RIGAIIWLGPNEDIDIRHKQG---FLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCG-----------HLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEK--------SCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDXXXXXXXXXXXXXQMKSHLEYFKKFLNQANLSRHSDSENSQSIFGDRYSFVVVK-RRDNNTFVKEERFVLT------------------FSALISRIGGLSSLYIGLTFAFFAEVIE 1654
            D      + ++  G ++I+ +     K +W + +I      ++ +  ++  Y Q+ V   +  +      +P+V+ CN +P SL         + +    FN + ++L + +L  ++K    ++        + M+ +  +Y++L  + + +L HN + M  HC +              ++  V  FS     +YFNC+T    +++ M  +    G  +     +D  +    G   F  +I   A G+RV VH  GS P+    G  I PG  + +  + +L+ R+  P   C ++     +     + Y    CL    Q++++++CGC     P    P+    +CG           H N  +++S  D       Y+      + NL           C   C    Y  +VS++ W P E+  Y L  V + F++       +                MK+  EY +K  + +      +  +   I    YS    +  ++ +  +++    L                    + L + IGG   L++G++     E+IE
Sbjct:   41 DIIAELGSESNAHGLAKIVTSRDTKRKVIWALLVIAGFTAATLQLSLLVRKYLQFQVVELSEIKDSMPVQYPSVSICNIEPISL---------RTIRRMYFNNESQNLIT-WLRFIQKFRFEQD--------SFMNSIRAFYENLGQD-AKKLSHNLEDMLMHCRF------------NRELCHVSNFSTFFDGNYFNCFTFNSGQRLQMHATGPENGLSLIFSVEKDDPLPGTYGVYNFDNNILHSA-GVRVVVHAPGSMPSPVDHGIDIPPGYSSSVGLKAILHTRLPYPYGNCTNDMLNGIK----QYKYTFFACLQLCKQRLIIQRCGCKSSALPE--VPSYNATFCGVIKDWQEINRNHSNEDHNQSEEDRAFIPTPYLACEEREQKNLNNDRTYELSCGCFQPCSETSYLKSVSLSYW-PLEF--YQLSAVERFFKQERQAGQNHF---------------MKTAYEYLEKLAHPSQKHLARNDSHMDDILSKSYSLSEKEMAKEASDLIRQNMLRLNIYLEDLSVVEYRQLPAYGLADLFADIGGTLGLWMGISVLTIMELIE 554          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|H2QAR5|SCNNG_PANTR (Amiloride-sensitive sodium channel subunit gamma OS=Pan troglodytes OX=9598 GN=SCNN1G PE=3 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 2.349e-11
Identity = 92/427 (21.55%), Postives = 167/427 (39.11%), Query Frame = 2
Query:   80 IFDYTKTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHL-SSKYLDELEKTPTVENMMKPLLWTTV---------MDRMSIYYQSLEPEVSAQLGHNQSMFHHCMWWYGKQMAFGESCKDDMLVVKRFSHPSYFNCYTV-----EPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCN-DNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHV 1312
            I +  + +  NT+  G  RI+ +     + LW  + +T   L+      ++  ++  SV+I+ + R      FPAVT CN  P+  +      +       E  K L     S+   E E   ++    +P     +           +   ++   + +V   + H  S   H      KQ+   +      L    F HP + NCYT      E I   +M  S  G  + L  NE+        FLV     + G +V +H    YP ++ +G +IE   +  +      + +++ P  +C  D   V  +++  +  Y  ++CL+   Q  +VEKCGC    Y +   P    NYC +    N       L+    ++    G ++  +++C  +    ++ L  S+ +W P+     WL  V
Sbjct:   25 IKELMRWYCLNTNTHGCRRIVVSRGRLRRLLWIGFTLTAVALILWQCALLVFSFYTVSVSIKVHFR---KLDFPAVTICNINPYKYSTVRHLLADLEQETREALKSLYGFPESRKRREAESWSSISEGKQPRFSHRIPLLIFDQDEKGKARDFFTGRKRKVGGSIIHKASNVMHI---ESKQVVGFQ------LNFTLFHHPMHGNCYTFNNRENETILSTSMGGSEYGLQVILYINEE----EYNPFLVS----STGAKVIIHRQDEYPFVEDVGTEIETAMVTSIGMHLTESFKLSEPYSQCTEDGSDVPIRNI-YNAAYSLQICLHSCFQTKMVEKCGC--AQYSQPLPP--AANYCNYQQHPNWMYCYYQLH--RAFVQEELGCQSVCKEACSFK----EWTLTTSLAQW-PSVVSEKWLLPV 419          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|H1AFJ5|SCNNA_NEOFS (Amiloride-sensitive sodium channel subunit alpha OS=Neoceratodus forsteri OX=7892 GN=scnn1a PE=1 SV=1)

HSP 1 Score: 66.6254 bits (161), Expect = 3.673e-10
Identity = 52/231 (22.51%), Postives = 94/231 (40.69%), Query Frame = 2
Query:  641 RFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRY 1333
            RF HP Y NCYT    +      S +  +   G    + +R +Q   +       G RV VH+    P ++  G  I PG    +  +  +  R+      C D   +   +L  + +Y+++ C+    Q  +V++CGC Y +YP    P+    YC   +++ +KS      C  K   + +  +    + C   C+  DY +     +W P+     W+  +     +Y
Sbjct:  266 RFRHPVYGNCYTYNDGQSATPWASFVPGV---GNGLSLVLRTEQNDFLPFLSTVAGARVLVHDQNQPPFMEDSGLDIRPGVETSIGMKKEIISRLGGVYGNCTDGSDIDVVNL-YNSDYNQQACVRSCFQATIVQQCGCGYYFYP---LPSGAE-YC---SYSRNKSW---GYCYYKLYKAFAADELGCFRRCRKPCQYTDYKMTAGYAQW-PSSVSESWITSILSQENQY 481          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|O13263|SCNNH_XENLA (Amiloride-sensitive sodium channel subunit gamma-2 OS=Xenopus laevis OX=8355 GN=scnn1g-b PE=1 SV=1)

HSP 1 Score: 64.6994 bits (156), Expect = 1.595e-9
Identity = 57/225 (25.33%), Postives = 98/225 (43.56%), Query Frame = 2
Query:  644 FSHPSYFNCYTVEPIKQVAMDISRIGAIIW-LGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDK----ELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKW---RPTEWQL 1294
            F HP Y NCYT    ++  + +S +G   + L     ID      +L      A G ++ VH+   YP I+ +G ++E G    +  Q   + +++ P   C    T+   D+ V+  Y+K    ++CLN   Q+ +V  CGC +   P    PN    YC +  + N   I   +    +++    G ++   +SC  +    ++ L  S+ KW      EW L
Sbjct:  278 FHHPLYGNCYTFNSAERGNLLVSSMGGAEYGLKVVLYIDEDEYNPYL----STAAGAKILVHDQDEYPFIEDLGTELETGTETSIGMQLTESTKLSDPYSDC----TIDGSDISVENLYNKKYTLQICLNSCFQREMVRSCGCAHYDQP---LPNGAK-YCNYEEYPN--WIYCYVKLYKQFVQEELGCQSTCRESCSFK----EWTLTRSLAKWPSLNSEEWML 484          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Match: sp|Q9WU39|SCNNG_MOUSE (Amiloride-sensitive sodium channel subunit gamma OS=Mus musculus OX=10090 GN=Scnn1g PE=1 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 5.987e-9
Identity = 62/241 (25.73%), Postives = 96/241 (39.83%), Query Frame = 2
Query:  605 GESCKDDMLVVKRFSHPSYFNCYTV-----EPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHV 1312
            G SC  D      F HP Y NCYT        I   +M  S  G  + L  NED        FLV     + G +V VH+   YP I+ +G +IE      +      + +++ P  +C ++ +        +  Y  ++CL    Q  +VEKCGC    Y +   P    NYC +    N       + C  +   +    +   +  C   C   ++ L  S+ +W P+E    WL +V
Sbjct:  270 GMSC--DARNFTLFHHPMYGNCYTFNNRENATILSTSMGGSEYGLQVILYINED----EYNPFLVS----STGAKVLVHQQNEYPFIEDVGTEIETAMSTSIGMHLTESFKLSEPYSQCTEDGSDVPVTNIYNAAYSLQICLYSCFQTKMVEKCGC--AQYSQPLPP--AANYCNYQQHPN------WMYCYYQLYQAFVREELGCQSVCKQSCSFKEWTLTTSLAQW-PSEASEKWLLNV 489          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3T201 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS935 PE=3 SV=1)

HSP 1 Score: 442.195 bits (1136), Expect = 2.611e-144
Identity = 243/600 (40.50%), Postives = 344/600 (57.33%), Query Frame = 2
Query:  101 FLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKTPTVEN----------MMKPLLWTTVMDRMSIYYQSLEPEVSAQLGHN-QSMFHHCMWWYGKQMAF-GESCKDDMLVVKRFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHL-----NFTNDKSIIDNLNCLGKYMDSSSGLKANLEKS--CLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDXXXXXXXXXXXXXQMKSHLEYFKKFLNQANLSRHSDSENSQS--IFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFYVCLFTRSDDDNQKASSTTVIIVNENS----PKKNDIQNVLLKEHH-LGTPTNNVQRSS 1822
            FL +TSIRG SRI+R+E+  I+W+W +Y+   T+ L  SI +++ +Y  Y+VNIQTY   D    FP+VTFCNHQPFS  AY LW  G V+SPT FN+ +RH +++      + P  +N          M + L    V D + +YYQS++     +LGHN + +   C+  YG Q A  G  C+D +L VKR S+P +FNCY+VE IK+ +  I  +G I+WLGP+E+     +Q FL D+FEQAYG++V++HE G   N+D+   Q+ PGR+NEL FQ V  L  + P K C  NPT TY DL   +NYD ELCLN  +Q+ +VE+CGCLY YYPR + PNKT  YCG L        + K++  N +C    + +++  +  +E S  C  RC  ++Y+  VSVTKWR T WQLYW    +  F    +      D                      + FL   NL   +D ENS S  +F +RY++++V+R+ N+T +KEE  VLT +AL SRIGGL SLYIGLT A F EV+E+ Y+  + R+    +K+S         NS     + N I+  LL  ++    P + V+ SS
Sbjct:   41 FLESTSIRGCSRIVRSENRTIRWMWAIYLCLTTLFLHGSILKLVTEYMNYAVNIQTYIDMDAPMDFPSVTFCNHQPFSNRAYELWKDGSVISPTRFNQLVRHRAAELFSRSIEIPHYDNGTVRILNKAMMFESLRQGIVYDSLPLYYQSVQWPRQLELGHNRKDLIALCLLQYGNQYAVTGPGCEDAVLRVKRLSNPKFFNCYSVEVIKEFSKSIKELGLILWLGPDENHGNEDRQAFLFDLFEQAYGIKVSIHEPGGMANLDKHSFQVAPGRMNELTFQTVKVLHYDRPPKPCAPNPTQTYTDLNEQYNYDFELCLNSHVQERIVEECGCLYAYYPRIYEPNKTLPYCGGLIDDGMGLLDIKAVEKNEHCAENIVKNAAAYRKAIEDSEICKRRCETVEYESQVSVTKWRATPWQLYWSLKTSSLFDSVANGSLSPRDA------------------RLIEHFLRTPNL---ADIENSTSSIVFDERYTYLLVRRKSNDTIIKEENLVLTVNALFSRIGGLCSLYIGLTLAVFMEVVEFIYIS-WVRAMSARKKSSGELAERNEHNSQQSPAEDNHIEATLLDNNNSRQKPNDQVECSS 618          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A4S2LIB5 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007029 PE=3 SV=1)

HSP 1 Score: 432.95 bits (1112), Expect = 9.567e-141
Identity = 220/562 (39.15%), Postives = 335/562 (59.61%), Query Frame = 2
Query:   77 KIFDYTKTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGH--NQSMFHHCMWWYGKQMAFG-ESCKDDMLVVKRFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHL---NFTNDKSIIDNLNCLGKYMDSSSGLKANLEKS--CLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDXXXXXXXXXXXXXQMKSHLEYFKKFLNQANLSRHSDSEN-------SQSIFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFYVCLFTRSDDDNQKASSTT 1717
            KI +    FL + SIRG +RI+R +S+FI+ LW  ++I  TV L +S+ R++ +Y  YSVNI+T  R D  T FP+VTFCNHQPFS  AY LW SG V+SPT+FN+ LR  + + +D          +     ++ V D + +YYQ+L+     +LGH  NQS++   + + G+++  G   C D+M+ +K  SHP ++NCYTV+    ++  +  +G I+WLGP E+ DIR++Q FL D+FEQA+GLRVA+HE G   N+D++G QIEPGR+NE+NF+ +      +P K C  +P   Y+DL  +++Y+ ELCL+  IQ++V+E+C C+Y Y PR   PN T  YCG L   N  + + + D   C+   +   + L+   E    CL RC+ ++YD  VSVT WR T+WQLYW +      ++       +T                K+ ++    +L  ANLS   ++ +        +  F DR++++++KR+ N+T V++E  VLT  AL+SRIGGL SLYIG+TFA F EVIE+FY+     S+   +K +  +
Sbjct:   26 KISENVSLFLESISIRGCNRIVRAQSMFIRLLWICFLICTTVFLIVSVRRIVKEYLLYSVNIETEERMDAPTEFPSVTFCNHQPFSEKAYELWRSGSVISPTQFNRILRQKAEELVDNNSGNINEHLLQMVAHYSIVFDTIKMYYQNLDWPDQKRLGHQRNQSIYMCLIRFSGEELLLGGPGCYDEMIHIKERSHPHHYNCYTVDINIYLSRRVQELGLIVWLGPPENYDIRYRQAFLQDVFEQAHGLRVAIHEPGQLVNLDRLGIQIEPGRMNEINFEVIRKEHQQTPRKPCIQDPKNRYRDLDGEYDYEFELCLDSLIQQIVIERCSCVYAYLPRIVIPNATLPYCGRLLRNNQLDAQGLFDRKECVRHVVQQFAKLRKQFEAEGKCLRRCQTLEYDKRVSVTTWRATQWQLYWSQETANALEQIMASSPNFT----------------KASVDRLIVYLKTANLSTAFNAPDVAHKGITRKYGFSDRHTYLLIKRKRNDTVVRKETLVLTLDALVSRIGGLCSLYIGMTFAIFIEVIEFFYMVYMKNSNSKKRKRADPS 571          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A074ZXV4 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_01690 PE=3 SV=1)

HSP 1 Score: 431.409 bits (1108), Expect = 4.778e-140
Identity = 218/545 (40.00%), Postives = 329/545 (60.37%), Query Frame = 2
Query:   77 KIFDYTKTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGH--NQSMFHHCMWWYGKQMAFG-ESCKDDMLVVKRFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHL---NFTNDKSIIDNLNCLGKYMDSSSGLKANLEKS--CLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDXXXXXXXXXXXXXQMKSHLEYFKKFLNQANLSRHSDSEN-------SQSIFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFYV 1666
            KI +    FL + SIRG +RI+R +S+FI+ LW  ++I  TV L +S+ R++ +Y  YSVNI+T  R D  T FP+VTFCNHQPFS  AY LW SG V+SPT+FN+ LR  + + +D      +   +     ++ V D + +YYQ+L+     +LGH  NQS++   + + G+++  G   C D+M+ +K  SHP ++NCYTV+    ++  +  +G I+WLGP E+ DIR++Q FL D+FEQA+GLRVA+HE G   N+D++G QIEPGR+NE+NF+ +      +P K C  +P   Y+DL  +++Y+ ELCL+  IQ++V+E+C C+Y Y PR   PN T  YCG L   N  + + + D   C+   +   + L+   E    CL RC+ ++YD  VSVT WR T+WQLYW +      +        +T                K+ ++    +L  ANLS   ++ +        +  F DR++++++KR+ N+T V++E  VLT  AL+SRIGGL SLYIG+TFA F EVIE+FY+
Sbjct:   25 KISENISLFLESISIRGCNRIVRAQSMFIRLLWICFLICTTVFLIVSVRRIVKEYLLYSVNIETEERMDAPTEFPSVTFCNHQPFSEKAYELWRSGSVISPTQFNRILRQKAEELVDNNSGNISEHLLQMVAHYSIVFDTIKMYYQNLDWPDQKRLGHQRNQSIYMCLIRFSGEELLLGGPGCYDEMIHIKERSHPHHYNCYTVDINIYLSRRVQELGLIVWLGPPENYDIRYRQAFLQDVFEQAHGLRVAIHEPGQLVNLDRLGIQIEPGRMNEINFEVIRKEHQQTPRKPCIQDPKDQYRDLDGEYDYEFELCLDSLIQQIVIERCSCVYAYLPRIVIPNATLPYCGRLLRNNQLDAQGLFDRKECVRHVVQQFAKLRKQFEAEGKCLRRCQTLEYDKRVSVTTWRATQWQLYWSQETANALEEIMASSPNFT----------------KASVDRLTVYLKTANLSTAFNAPDVTHKGITRKYGFSDRHTYLLIKRKRNDTVVRKETLVLTLDALVSRIGGLCSLYIGMTFAIFIEVIEFFYM 553          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: H2KTS4 (FMRFamide-activated amiloride-sensitive sodium channel OS=Clonorchis sinensis OX=79923 GN=CLF_106033 PE=3 SV=1)

HSP 1 Score: 430.639 bits (1106), Expect = 9.222e-140
Identity = 218/562 (38.79%), Postives = 335/562 (59.61%), Query Frame = 2
Query:   77 KIFDYTKTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGH--NQSMFHHCMWWYGKQMAFG-ESCKDDMLVVKRFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHL---NFTNDKSIIDNLNCLGKYMDSSSGLKANLEKS--CLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDXXXXXXXXXXXXXQMKSHLEYFKKFLNQANLSRHSDSEN-------SQSIFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFYVCLFTRSDDDNQKASSTT 1717
            KI +    FL + SIRG +RI+R +S+FI+ LW  ++I  TV L +S+ R++ +Y  YSVN++T  R D  T FP+VTFCNHQPFS  AY LW SG V+SPT+FN+ LR  + + +D      +   +     ++ V D + +YYQ+L+     +LGH  NQS++   + + G+++  G   C D+M+ +K  SHP ++NCYTV+    ++  +  +G I+WLGP E+ DIR++Q FL D+FEQA+GLRVA+HE G   N+D++G QIEPGR+NE+NF+ +      +P K C  +P   Y+DL  +++Y+ ELCL+  IQ++V+E+C C+Y Y PR   PN T  YCG L   N  + + + D   C+   +   + L+   E    CL RC+ ++YD  VSVT WR T+WQLYW +      ++       +T                ++ ++    +L  ANLS   ++ +        +  F DR++++++KR+ N+T V++E  VLT  AL+SRIGGL SLYIG+TFA F EVIE+FY+     S    ++ +  T
Sbjct:   25 KITENVSLFLESISIRGCNRIVRAQSMFIRLLWICFLICTTVFLIVSVRRIVKEYLLYSVNLETEERMDAPTEFPSVTFCNHQPFSEKAYELWRSGSVISPTQFNRILRQKAEELVDNNSGNISEHLLQMVAHYSIVFDTIKMYYQNLDWPDQKRLGHQRNQSIYMCLIRFSGEELLLGGPGCYDEMIHIKERSHPHHYNCYTVDINIYLSRRVQELGLIVWLGPPENYDIRYRQAFLQDVFEQAHGLRVAIHEPGQLVNLDRLGIQIEPGRMNEINFEVIRKEHQQTPRKPCIQDPKNRYRDLDGEYDYEFELCLDSLIQQIVIERCSCVYAYLPRIVVPNATLPYCGRLLRNNQLDAQGLFDRKECVRHVVQQFAKLRKQFEAEGKCLRRCQTLEYDKRVSVTTWRATQWQLYWSQETANALEQIMASSPNFT----------------QTSVDRLIVYLKTANLSTAFNAPDVAHKGITRKYGFSDRHTYLLIKRKRNDTVVRKETLVLTLDALVSRIGGLCSLYIGMTFAIFIEVIEFFYMVYMKNSHSKKRRRADCT 570          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Match: A0A0R3SVH1 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS9571 PE=3 SV=1)

HSP 1 Score: 425.631 bits (1093), Expect = 4.764e-138
Identity = 226/559 (40.43%), Postives = 325/559 (58.14%), Query Frame = 2
Query:  101 FLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKTP-----TVENMMKPLLWTT-----VMDRMSIYYQSLEPEVSAQLGHN-QSMFHHCMWWYGKQMAF-GESCKDDMLVVKRFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHL-----NFTNDKSIIDNLNCLGKYMDSSSGLKANLEKS--CLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDXXXXXXXXXXXXXQMKSHLEYFKKFLNQANLSRHSDSENSQS--IFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFYVCLFTRSDDDNQKASST 1714
            FL +TSIRG SRI+R+E+  ++W+W +Y+ + T+ L  SI +++ +Y +YSVNIQTY   D    FP VTFCNHQPFS  AY LW +G V+SPT FN+ +RH +++      + P     TV  + K L++ +     V D + +YYQS++      LGH+ + +   C++ YG Q A  G  C+D +L VKR S P +FNCY+VE IK+ +  I  +G I+WLGP+E+     +Q FL D+FEQAYG++V++HE G   N+D+   QI PGR+NEL FQ V     + P K C  NPT  Y DL   +NY  E+CLN  +Q+ +VE+CGCLY YYPR + PNKT  YCG L        + K +  + +C    + +++  +  +E S  C  RC +++Y+  VSVTKWR T WQLYW    +  F    +      D                      + FL   NL   +D ENS S  +F +RY++++V+R+ N+T +KEE  VLT +AL SRIGGL SLYIGLT A   E++E+ Y+    R +       S+
Sbjct:   38 FLESTSIRGCSRIVRSETHTLRWMWAIYLCSTTLFLIGSILKLVTEYMKYSVNIQTYNEMDAPMDFPTVTFCNHQPFSERAYELWKNGSVISPTRFNQLVRHRAAELFARSIQIPLNDNGTVRILNKSLMYESLRQGIVYDSLPLYYQSVQWPSQIDLGHDPKDLIALCLFQYGNQYAVTGPGCEDAVLRVKRLSDPKFFNCYSVEIIKEFSKSIKELGLILWLGPDENHGKEDRQAFLFDLFEQAYGIKVSIHEPGQMVNLDKYSFQIAPGRMNELTFQTVKIHHYDRPPKPCTHNPTQIYTDLNELYNYQFEVCLNSHLQRRIVEECGCLYAYYPRIYEPNKTLPYCGRLIDDSMRLMDMKVVEKHEHCAEGIVKNAAAYRKAIEDSETCKRRCVSVEYESQVSVTKWRATAWQLYWSLKTSSLFDSVANGSLSPPDA------------------RLIEHFLRTPNL---ADFENSTSPIVFDERYTYLLVRRKSNDTIIKEENLVLTVNALFSRIGGLCSLYIGLTLAVLMEIVEFIYISWVRRKEKKKSSDESS 575          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1A (sodium channel epithelial 1 alpha subunit [Source:HGNC Symbol;Acc:HGNC:10599])

HSP 1 Score: 56.9954 bits (136), Expect = 9.768e-9
Identity = 51/204 (25.00%), Postives = 79/204 (38.73%), Query Frame = 2
Query:  596 MAFGESCKDDMLVVKRFSHPSYFNCYTVEPIKQVAM-DISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDN----PTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTH------NYCGHLNFTNDKSII-DNLNCLGK 1171
            M  G  C D      RF HP+Y NCYT        +   S+ G    L     + +R +Q   +       G R+ VH+  S P +++ G  + PG    L  + +   R+  P   C ++    P +            +  C     Q  +VE CGC Y +YP    PN ++       + GH  +   +  I D L C+ K
Sbjct:  219 MFSGMPCSDSEY--SRFHHPTYGNCYTFNSANSSKLWQASKPGRDYGL----SLILRTEQNDYIPFLSTVAGARIMVHDQESPPFMEEGGFDMRPGFETSLGIRMLEATRMPDPYGNCTEDGSNVPVLNLYSSAYTVQVPECSCF----QLALVEACGCGYYFYP--LPPNASYCSYNNTAWAGHCYYKLYRQFISDELGCVDK 410          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: SCNN1B (sodium channel epithelial 1 beta subunit [Source:HGNC Symbol;Acc:HGNC:10600])

HSP 1 Score: 54.299 bits (129), Expect = 6.011e-8
Identity = 58/245 (23.67%), Postives = 94/245 (38.37%), Query Frame = 2
Query:  644 FSHPSYFNCYTVE-PIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCN-DNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKH---------VNQHFQRYEDVL 1345
            F HP Y NC+       +  M +S  G    L     ID      FL  I     G  + VH+  +YP +  +G  ++ G    +  +     R  +P   C  D   +   +L     Y  + CL    Q  ++E CGC Y  YP    P     YC + NFT  +       C  K  +       +    C   C   +Y +++S++ W P++    W+ H         V++ F R +D++
Sbjct:  268 FFHPMYGNCFIFNWGENETVMQVSNPGVEYGLKLVLSIDQDEYIPFLTTI----AGAVIMVHDQNTYPFLSDLGVFVKTGVETSVGIEVGQLQRQGAPYSDCTMDGTDLPITNLYNGTAYSVQACLRSCFQTKMIEMCGCGYYLYP---LP-PGEKYCQNQNFTGWRY------CYYKLYEQFVEEDMDCYTICKQPCIESEYKMSISMSDW-PSQSSEDWIFHILSKERKHNVSRIFNRKQDII 497          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Match: ASIC5 (acid sensing ion channel subunit family member 5 [Source:HGNC Symbol;Acc:HGNC:17537])

HSP 1 Score: 50.447 bits (119), Expect = 7.982e-7
Identity = 70/332 (21.08%), Postives = 123/332 (37.05%), Query Frame = 2
Query:   92 TKTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGHNQSMFHHCMWWYGKQMAFGESCKDDMLVVKRFSH--PSYFNCYTVE-PIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQ------AYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEK-CGC 1057
            T  F ++TS+ G +R    +S   +  W + ++    +    +   L  Y+ +  +      +    +FPAVTFCN        YN +    +   T+    L  LS+       KTP  E  +   LW     R+++   S  P        NQ +           +   ++  ++    + F H    Y NCYT      +    + +  A    G     D++ K   L D +E         G+R+ VH+    P ++ +G  I  G    ++ Q   ++    P   C+ +     + L     Y    CL  E +  +VE+ CGC
Sbjct:   15 TIAFSSSTSLHGVARATSAQSRAQRAFWMMVVVAGVAMAGWQVALRLAAYYAWPTSTSLTLHYVRDLSFPAVTFCN--------YNRYRRSSLHGTTDLLAALSILSAGI-----KTPHPE-YLSGFLW-----RITLRGYSSPPITQTYSARNQDLSTTI-------LEIDDTYCENSCTPQDFQHVFTEYGNCYTFNGGFSEEQRSLKQKTAGAGKGLQVLFDVQQKS-HLWDYWENPELGFTGVGIRLVVHDPDEPPQVEALGLSIGVGTQAYVSVQHTKSINQQYPWGDCDPS-----KKLQSPAPYSMARCLQ-ECEADLVERICGC 313          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO42137 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2F2])

HSP 1 Score: 56.6102 bits (135), Expect = 1.763e-8
Identity = 75/328 (22.87%), Postives = 132/328 (40.24%), Query Frame = 2
Query:  776 FLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNS-PTKKCNDNPTVTYQDL--GVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDXXXXXXXXXXXXXQMKSHLEYFKKFLNQANLSRHSDSENSQSIFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFYVCLFTRSDDDNQKASSTTVIIVNENSPKK 1750
            +L  I E A G++V + + G  P   Q G +I PG+   +    +   R++    + C  +  ++ ++L  G +  Y    C    +    +E+CGC     P      +    C  LN T    IID   CL K  D+      + ++ C   C  + +DL VS  +W    +++   K+   +F R   VL K    S+                   K F+N  N+++         ++     +++V          +E    TF +L+S IGG   ++IG++    AE+IE   V L   S+       S  ++ +N   P+K
Sbjct:  241 YLEGITEVA-GMKVTISDQGVLPFPGQQGIRIMPGQSTGIQMTKLQTRRIDPFKNRSCESSNEMSDKNLFFGYNMTYSIMACKYSCLNARKIERCGCTNYNTPE--MQKRNIPLCNRLNST----IID---CLNKAYDTFE--DGSCDRECPPSCSEVSFDLTVSSARWPARSFEV--TKYA--YFLRVR-VLNKIASSSS-------------------KYFVNSENIAQ-------VHVYYGELDYLLV----------QETLAYTFMSLLSDIGGQMGMWIGISALTCAELIELVCVILANMSN------RSKKIVHINSFRPEK 509          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO30892 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZH3])

HSP 1 Score: 50.447 bits (119), Expect = 9.311e-7
Identity = 61/278 (21.94%), Postives = 106/278 (38.13%), Query Frame = 2
Query:   95 KTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEK----------TPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQL---GHNQSMFHHCMWWYGKQMAFGESCKDDMLVVKRFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIR---HKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPG 880
            K FL NTS+ G  R +   S   + +W + ++         +++ +  Y+++       T +D    FPAVT CN    S   +                + R+ S    ++LEK           P  EN    LL     +  S +Y+     V+  L    H+        W    Q + GE C  D      F   ++  C+T    K+    +     +  LGPN  + +R    ++  + + +    G +V VH+   YP ++Q G  ++PG
Sbjct:    7 KDFLGNTSLHGV-RYLTENSFIRRVIWLLVVLAAFCGFGYQLYKSITFYYEWPTVTAMTTEWDEELDFPAVTICNLNTLSKENF-------------VKARKRYKSDATTEQLEKEVETFTFFMSAPLNENAKSKLLNDFFEN--STFYRERGNFVNKSLNDFSHSIDGILSIKWLRPCQFS-GEDC--DRKNFSSFVDLNFGLCHTFNSGKKEENALK----VESLGPNNGLRLRLNVQQEDHVSNFYWLPAGFKVLVHDRKEYPIMEQTGFALQPG 261          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO34318 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPS2])

HSP 1 Score: 49.6766 bits (117), Expect = 2.747e-6
Identity = 55/256 (21.48%), Postives = 91/256 (35.55%), Query Frame = 2
Query:  539 QLGHN-QSMFHHCMWWYGKQMAFGESCKDDMLVVK---RFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDI--DIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNS-PTKKCNDNPTVTYQD----LGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKW 1273
            +LGH   S+   C W        G  C+ +    +   RF H  Y NC+   P+        R    +  GPN  +  ++  +Q   +D      G  + V   G  P  ++ G  + PG    +    V   RV++   + C +  T   ++    +  +  Y K  CLN+ +     + C C+      Y FP +    C  +N T        + CL +  +     K N    C   C    Y    S + W
Sbjct:   24 RLGHQFDSLVRKCSW-------RGSDCRANATTGRYWGRFWHNKYGNCFVFNPLIGWNGKKRRALTALRAGPNYGLTLELNVEQDEYIDGLSTKAGAVIQVSPVGYMPFPEEEGIDVSPGFSTSIALTKVKISRVDAFGNRSCVNEITEKDRENLYHVKYNATYSKTACLNFCLAYNQRKTCNCM-----EYRFPVEEEAVCDTMNKT-------TVECLRRVREMLKMKKLNCTAECSAPCNQETYKTTSSFSMW 260          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Match: EDO37654 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SF66])

HSP 1 Score: 47.7506 bits (112), Expect = 5.901e-6
Identity = 27/103 (26.21%), Postives = 47/103 (45.63%), Query Frame = 2
Query:   77 KIFDYTKTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCN-------HQPFSLTAYNLWSSG 364
            KI    K FL  T+  GF+R++ +++   +  W +  +   V   + +H++   + +  V+     + +    FPAVT CN       H P SL  Y  +S G
Sbjct:    7 KIVTKIKDFLGYTTAHGFARLVESKNPVQRAFWVLACLGAFVAFGLQVHKLFSKFNRKPVDTYITVKHEMNLEFPAVTICNLNPIRKKHLPESLREYFKYSLG 109          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: ENSORLT00000021936.2 (acid-sensing ion channel 1C [Source:NCBI gene;Acc:101174951])

HSP 1 Score: 50.447 bits (119), Expect = 4.586e-6
Identity = 75/320 (23.44%), Postives = 130/320 (40.62%), Query Frame = 2
Query:   50 E*TNSLMQIKIFDYTKTFLANTSIRGFSRIIRT-ESIFIKWLWTV-YIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPF---SLTAYNLWSSG---QVMSP--TEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGHN-QSMFHHCMWWYGKQMAFGESCKDDMLVVKRFS--HPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLV--DIFEQAY--GLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNP 958
            E T S +Q  + + T  F+  T + G   I    +S F + +W + +++  ++  + S +R+      Y V  + Y  + +  +FPAVT CN   F   +LT  +L+ SG    +M+P  T  N+ L  L   +   L +     N   P  ++               E+ ++LGH  + M   C +        GE+C       + FS  +  Y  CYT          ++ +      G    +DI+  +   V  +  E +Y  G++V +H     P IDQ+G  + PG    ++ Q  L   +  P   C   P
Sbjct:   22 ESTPSSLQNTLKETTVEFIRRTKVHGLKFIFSPNKSKFQQIIWILAFLLCISLFCTWSWNRIFY-LMSYPVVTKIYMVWAHNMSFPAVTLCNKNVFRVSALTKDDLYHSGYWMDLMNPNHTLINRSLSILKESHRPGLLRLLDFRNYAPPPDYSVNTT-----------EMMSRLGHQLEDMLLECKFR-------GETC-----TFRNFSTIYTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGETDETSYEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQQQLLQYLPPPWGDCKSTP 317          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Match: ENSORLT00000035361.1 (acid-sensing ion channel 1C [Source:NCBI gene;Acc:101174951])

HSP 1 Score: 49.6766 bits (117), Expect = 7.503e-6
Identity = 76/320 (23.75%), Postives = 129/320 (40.31%), Query Frame = 2
Query:   50 E*TNSLMQIKIFDYTKTFLANTSIRGFSRIIRT-ESIFIKWLWTV-YIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPF---SLTAYNLWSSG---QVMSP--TEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGHN-QSMFHHCMWWYGKQMAFGESCKDDMLVVKRFS--HPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLV--DIFEQAY--GLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNP 958
            E T S +Q  + + T  F+  T + G   I    +S F + +W + +++  ++  + S +R+      Y V  + Y  + +  +FPAVT CN   F   +LT  +L+ SG    +M+P  T  N+ L  L   +   L +     N   P             Y     E+ ++LGH  + M   C +        GE+C       + FS  +  Y  CYT          ++ +      G    +DI+  +   V  +  E +Y  G++V +H     P IDQ+G  + PG    ++ Q  L   +  P   C   P
Sbjct:   22 ESTPSSLQNTLKETTVEFIRRTKVHGLKFIFSPNKSKFQQIIWILAFLLCISLFCTWSWNRIFY-LMSYPVVTKIYMVWAHNMSFPAVTLCNKNVFRVSALTKDDLYHSGYWMDLMNPNHTLINRSLSILKESHRPGLLRLLDFRNYAPP-----------PDYSVNTTEMMSRLGHQLEDMLLECKFR-------GETC-----TFRNFSTIYTRYGKCYTFNSGLDGNPLLTTLKGGTGNGLEIMLDIQQDEYLPVWGETDETSYEAGIKVQIHSQDEPPFIDQLGFGVAPGFQTFVSCQQQLLQYLPPPWGDCKSTP 317          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000016913.1 (SMESG000016913.1)

HSP 1 Score: 1232.62 bits (3188), Expect = 0.000e+0
Identity = 601/602 (99.83%), Postives = 601/602 (99.83%), Query Frame = 2
Query:   68 MQIKIFDYTKTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGHNQSMFHHCMWWYGKQMAFGESCKDDMLVVKRFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDXXXXXXXXXXXXXQMKSHLEYFKKFLNQANLSRHSDSENSQSIFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFYVCLFTRSDDDNQKASSTTVIIVNENSPKKNDIQNVLLKEHHLGTPTNNVQRSSIQTKLLTSSSDSLEQQP 1873
            MQIKIFDYTKTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGHNQSMFHHCMWWYGKQMAFGESCKDDMLVVKRFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDKSTTEKEKSTLELQMKSHLEYFKKFLNQANLSRHSDSENSQSIFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFYVCLFTRSDDDNQKASSTTVIIVNENSPKKNDIQNVLLKEHHLGTPTNNVQRSSIQTKLLT SSDSLEQQP
Sbjct:    1 MQIKIFDYTKTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGHNQSMFHHCMWWYGKQMAFGESCKDDMLVVKRFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDKSTTEKEKSTLELQMKSHLEYFKKFLNQANLSRHSDSENSQSIFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFYVCLFTRSDDDNQKASSTTVIIVNENSPKKNDIQNVLLKEHHLGTPTNNVQRSSIQTKLLTGSSDSLEQQP 602          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000062815.1 (SMESG000062815.1)

HSP 1 Score: 560.836 bits (1444), Expect = 0.000e+0
Identity = 271/570 (47.54%), Postives = 382/570 (67.02%), Query Frame = 2
Query:   83 FDYTKTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKT---PTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGHNQSMFHHCMWWYGKQMAFGESCKDDMLVVKRFSHPSYFNCYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANL--EKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDXXXXXXXXXXXXXQMKSHLEYFKKFLNQANLSRHSDSENSQSIFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFYVCLFTRSDDDNQKASSTTVIIVNENSPKKNDIQNVLLK 1777
            F+  + F ANTSIRGFSRI+++E+ F++ LW +++++    L +SI +V++DY QYSVNIQTY + DN T FPA+TFCNHQPFS  AY LW   +VMSPT+FN+  R  + K   ++ +T   P   +   PL  TT+ DR+S+YYQ+L   VS++LGHN S+  +C+W YG+ MAF   C+DDML+VK  SHPSYFNC+TVEP  + A   SR+G IIWLGP+E  +I+H+QGFL DIFEQAYGLRV +HE  SYPNI+  G QIEPGRLNELN+QP LN++V++  K C + P   Y+DL   F YD +LC N E+Q+ ++ +C C+YGYYPRY  P+K   YCG+L       ++   NC+ K  + +  +K+NL  +K C+  C +I+Y    SVTKWRPT+WQLYWLK V   + +Y +++ +  +   +    +T  + +++     + F  + NLS     E+ + +F +RY+FVVVKR+ NNTF+KEER VL+F+AL+SR+GGL SLYIGLTFAFF E+I++ Y  +F R     +  S    +  NE + +K   Q + LK
Sbjct:   14 FEVIRKFFANTSIRGFSRIVKSETTFLRTLWILFVVSTITFLIVSIFKVVIDYRQYSVNIQTYIQIDNATPFPALTFCNHQPFSERAYQLWEESKVMSPTQFNELFRSEALKQFKDMVRTKMTPKDSDFNHPLFLTTINDRLSVYYQNLPTTVSSELGHNISIIKNCVWSYGQHMAFDNHCQDDMLIVKNISHPSYFNCFTVEPHPKYASIFSRLGLIIWLGPDEQTNIKHRQGFLFDIFEQAYGLRVIIHEPNSYPNIESEGVQIEPGRLNELNYQPELNIKVDTERKPCINEPDRIYRDLDNVFKYDIDLCFNMELQQRIITECKCIYGYYPRYLHPSKELPYCGYLEPEKYHDLLFRKNCITKIFNEAPDIKSNLKADKKCIHSCSSIEYTTTTSVTKWRPTDWQLYWLKEVLDAWAQYYNLMARNIN-IPSNNMTTTDRIMLQNLTSRIETFFTRKNLSEFI-PESEKLLFNERYTFVVVKRKANNTFIKEERLVLSFNALVSRVGGLCSLYIGLTFAFFIELIDFLYTIIFLR-----KPLSREDSVEKNERTGQKRTSQTLFLK 576          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000043119.1 (SMESG000043119.1)

HSP 1 Score: 333.569 bits (854), Expect = 1.217e-105
Identity = 187/543 (34.44%), Postives = 300/543 (55.25%), Query Frame = 2
Query:  101 FLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLS--SKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGHNQSMFHHCMWWYGKQMAFGESC-KDDMLVVKRFSHPSYFNCYTVEPIK-QVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKC-NDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGH-LNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDXXXXXXXXXXXXXQMKSHLEYFKKFL---NQANLSRHSDSENSQSIFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFYVCLFTRSDDDNQK 1702
            F +  SIRG ++II+     ++ LW  +++  + +L  S   ++ D+  Y VNI T    D+ T FPA+T C+H PFS   Y +W SG+ MSP+ FN+K+R+L+     L+++E   T+          +  D +SIYYQ+L  E + Q+GHN S+F  CM+    Q+ F E+C K +   +K  SH  +FNCYT EP +  V+ ++  +G I+ LGP E      +Q F++D F QA GL+V VHE+G+ P+ID+ G  +EPG++NE+ ++P      N+P K C ND   + Y DL   +NY K LCL Y  Q+ ++ +C C++ Y PR   PN++  YCG  L   N  +I   + CL   ++  S  +   ++ C  RC  + +D  +S+TKWR TEW LYWL+         +  L    +++              +  + FK +L   N+ +L +     N   +  D ++++V++R   ++  K ER V+T   L+SRIGGL SL +G+T AF  E++E+ Y  LF+  + + +K
Sbjct:   64 FCSTISIRGINKIIKGPRP-LRLLWLCFVLIMSAILITSSCLLVRDFMLYDVNINTKLEIDSMTPFPALTVCHHHPFSHRGYRMWKSGKAMSPSYFNRKMRNLTLDQLLLNDVESAETI----------SYYDGISIYYQNLPYEQAIQMGHNSSIFLTCMYLLENQIYFAENCTKLEFYRIKLLSHHEHFNCYTFEPTQPHVSSNLDMLGIIVSLGP-EPKHFDMEQSFIIDTFRQAQGLKVIVHESGTLPDIDEAGLHVEPGKMNEIIYRPNQWQLTNTPAKPCINDTSRIAYVDLANTYNYTKHLCLKYAEQEDIMNQCHCMFIYNPRPMMPNESMPYCGSILKDFNLSNIYSYVKCLSDVLNQKSKRQQWEKEKCFHRCNYMTFDSTISITKWRATEWHLYWLRQQITSLGEMKQFLKANPNRNV-------------TESQAFKTWLIYGNKKDLRKTGLKANEFLLKDDNFAYIVLRRESKDSVKKYERLVITQYVLVSRIGGLCSLTVGITLAFIVELVEFCY--LFSAKETEKRK 579          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000060702.1 (SMESG000060702.1)

HSP 1 Score: 322.013 bits (824), Expect = 8.188e-102
Identity = 195/545 (35.78%), Postives = 300/545 (55.05%), Query Frame = 2
Query:  101 FLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGHNQSMFHHCMWWYGKQMAFGESCKD-DMLVVKRFSHPSYFNCYTVEPIKQVAMDISR--IGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKC-NDNPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTND-KSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDXXXXXXXXXXXXXQMKSHLEYFKKFLNQANLSRHSDSENSQSIFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFYVCLFTRSDDDNQKASSTTV 1720
            F    +IRG +++    S F+++LW+V+++  T++L  +   ++LDY++Y V +       N T FPA+T C+H PFS  AY LW S +V+SP+ FN  +R  +  YL++ +K     N           D + IYYQ+L    S  LGH  ++  +C+     Q+ F   C+  D  V+KR SHP +FNCYT EP + +++ +S      I+ LG  E     H+Q FL+D+FEQA GLR  VHE G+ P+I++ G  +EPG+LNE+NFQPVLNL++++P + C  DN +    DL   +NY     +N E Q ++V+ C C+Y  YPR  +P K   YCG L    D       +NC+  Y+  S  L   +EK C  RC    Y+  VS+TKWR  +WQL+WL          +    K  + + + +     +   KS+LE  ++ L+  N+   +DS  S ++ GD +++VV+K++ +    + E+ VL+   L+SRIGG  SL IGLT A   E IE+ Y+ L  ++   N    ST V
Sbjct:   46 FCRCMTIRGVNKMTSASS-FLRYLWSVFVLLMTIILVGATCLLILDYFKYDVTLHQRDLQKNST-FPAITICHHHPFSKDAYKLWDSKKVLSPSLFNLYMRQNALHYLNQDDKF--ANNFY-------YFDSIDIYYQNLLYNESIALGHKYTIVLYCLRRNDYQIDFENDCQQFDSYVIKRLSHPQHFNCYTFEP-RNISVSVSTRFFSLIVSLGRPEPDYANHEQAFLIDVFEQAKGLRAVVHEPGTIPDIEREGLHVEPGKLNEINFQPVLNLKLDTPKRPCIPDNESSKLIDLDSKYNYTFYEYINLEKQYLIVKHCKCMYILYPRPLYPTKEVPYCGKLWPKIDLDEFTTRINCVSNYLKMS--LTEEIEKKCRPRCSYYTYEATVSITKWRAKQWQLHWLS--------LQSNAQKALNANISAESYQNAKNSWKSYLE--RRDLSNVNI---ADSRKSLNLDGDDFAYVVLKKKSSILKERSEKEVLSLPVLLSRIGGFCSLLIGLTVAVVVEFIEFVYL-LILKTVYQNNPTKSTPV 562          
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Match: SMESG000000150.1 (SMESG000000150.1)

HSP 1 Score: 315.079 bits (806), Expect = 1.508e-98
Identity = 176/528 (33.33%), Postives = 297/528 (56.25%), Query Frame = 2
Query:  101 FLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSISIHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQVMSPTEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQSLEPEVSAQLGHNQSMFHHCMWWYGKQMAFGESCKDDM-LVVKRFSHPSYFNCYTVEPIK-QVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRVAVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCND-NPTVTYQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGHLNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKS-CLLRCRNIDYDLAVSVTKWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDXXXXXXXXXXXXXQMKSHLEYFKKFLNQANLSRHSDSENSQS---IFGDRYSFVVVKRRDNNTFVKEERFVLTFSALISRIGGLSSLYIGLTFAFFAEVIEYFY 1663
            F   TSIRG +++ +   IF++ LW  +++  T  L+++   ++L++ QY VN+ T    D+ ++FPA+T C+H PFS+ A++LW+   VMSP ++N+ LR +S+   D  +K     N       ++ +D MS+YYQ+L+   S  +GH++  +  CM   G  + F + C         R S   YFNC+T +P    V+     I  ++ L P  D    H+Q F+V+ F++A GLRV VHE GS+P+I Q G  +EPG++NE+ +QP+ + RVN+PTK C + +  +T++DL   F  DK+ C+  + Q+++++ C C++  +PR   P     YCG +   N   I D ++C+G  + S +  +  LE++ C  RC  + ++  +S+TKW  T W LYW++  N+     +  +   T                 +  + +K +L+ AN    SD E+++    + G+ +++VV++R+  NT +K+E+ V T   L+SRIGG+ SL IGLT AF  E IE+ Y
Sbjct:   70 FCTTTSIRGMNKVPKG-PIFLRLLWLSFVLIMTTGLTVATTFMVLEFLQYDVNVYTKIILDSNSSFPALTICHHHPFSIKAHDLWNRSIVMSPAKYNRYLRKMSN---DSFQK-----NQYGHGSVSSYLDTMSMYYQNLQMNESFMIGHDKETYLTCMNQLGFNINFEDDCSKLFNTSFHRLSLHEYFNCHTFQPENINVSYLFESINIVVSLEPKPDYR-EHEQAFIVETFQRAEGLRVVVHETGSFPDIAQDGLHVEPGKMNEIKYQPIQHKRVNTPTKPCVERDDLMTFKDLDQTFMSDKKNCILLKKQELIMKNCKCIFVSFPRPIEPTLDLPYCGKIQNDNFTVIEDRISCIGDIV-SDADYQKELERTICFPRCDILTFESTISITKWGATAWHLYWIRETNKALNLLKANVNNSTRV---------------TETKGYKMWLDYANKENLSDVESTKVNHFLQGENFAYVVLQRKSKNTVIKQEKLVTTPYVLLSRIGGVCSLTIGLTAAFVVEFIEFIY 571          
The following BLAST results are available for this feature:
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SCNN1G5.290e-824.79sodium channel epithelial 1 gamma subunit [Source:... [more]
SCNN1A1.925e-623.45sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A2.434e-623.81sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A2.808e-623.81sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1A4.552e-623.81sodium channel epithelial 1 alpha subunit [Source:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-85.961e-1024.08Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-86.327e-1027.96Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-88.130e-1027.96Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
unc-88.132e-1027.96Degenerin unc-8 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
del-46.649e-921.64DEgenerin Like [Source:UniProtKB/TrEMBL;Acc:P9183... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
foxe37.264e-1023.72forkhead box E3 [Source:Xenbase;Acc:XB-GENE-480592... [more]
cdh121.755e-924.15cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
copg22.593e-924.77coatomer protein complex subunit gamma 2 [Source:X... [more]
copg23.010e-925.23coatomer protein complex subunit gamma 2 [Source:X... [more]
cdh123.294e-824.06cadherin 12, type 2 (N-cadherin 2) [Source:Xenbase... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Scnn1g8.559e-1025.73sodium channel, nonvoltage-gated 1 gamma [Source:M... [more]
Scnn1a1.177e-620.81sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a1.210e-620.81sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a1.735e-620.81sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
Scnn1a1.735e-620.81sodium channel, nonvoltage-gated 1 alpha [Source:M... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q25011|FANA_CORAP1.467e-1219.12FMRFamide-activated amiloride-sensitive sodium cha... [more]
sp|H2QAR5|SCNNG_PANTR2.349e-1121.55Amiloride-sensitive sodium channel subunit gamma O... [more]
sp|H1AFJ5|SCNNA_NEOFS3.673e-1022.51Amiloride-sensitive sodium channel subunit alpha O... [more]
sp|O13263|SCNNH_XENLA1.595e-925.33Amiloride-sensitive sodium channel subunit gamma-2... [more]
sp|Q9WU39|SCNNG_MOUSE5.987e-925.73Amiloride-sensitive sodium channel subunit gamma O... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0R3T2012.611e-14440.50Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A4S2LIB59.567e-14139.15Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZXV44.778e-14040.00Uncharacterized protein OS=Opisthorchis viverrini ... [more]
H2KTS49.222e-14038.79FMRFamide-activated amiloride-sensitive sodium cha... [more]
A0A0R3SVH14.764e-13840.43Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
SCNN1A9.768e-925.00sodium channel epithelial 1 alpha subunit [Source:... [more]
SCNN1B6.011e-823.67sodium channel epithelial 1 beta subunit [Source:H... [more]
ASIC57.982e-721.08acid sensing ion channel subunit family member 5 [... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO421371.763e-822.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO308929.311e-721.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO343182.747e-621.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO376545.901e-626.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSORLT00000021936.24.586e-623.44acid-sensing ion channel 1C [Source:NCBI gene;Acc:... [more]
ENSORLT00000035361.17.503e-623.75acid-sensing ion channel 1C [Source:NCBI gene;Acc:... [more]
back to top
BLAST of FMRFamide-activated amiloride-sensitive sodium channel vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016913.10.000e+099.83SMESG000016913.1[more]
SMESG000062815.10.000e+047.54SMESG000062815.1[more]
SMESG000043119.11.217e-10534.44SMESG000043119.1[more]
SMESG000060702.18.188e-10235.78SMESG000060702.1[more]
SMESG000000150.11.508e-9833.33SMESG000000150.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031431 ID=SMED30031431|Name=FMRFamide-activated amiloride-sensitive sodium channel|organism=Schmidtea mediterranea sexual|type=transcript|length=1888bp
ATTTTCCTAAAGGATTTTTAGAAAATTATCTGCGAATTTCTTCGAGATGG
AGTAAACTAATTCTTTGATGCAAATCAAAATTTTTGATTACACGAAAACA
TTCCTAGCAAACACATCTATTCGAGGGTTTTCTAGAATTATTCGCACTGA
GTCAATTTTCATTAAATGGCTATGGACAGTTTACATTATAACAAATACGG
TGCTATTGTCAATATCAATCCACCGAGTACTCCTGGACTACTGGCAATAT
TCAGTAAACATTCAAACGTACACCAGATTTGATAATGGGACTGCGTTTCC
GGCTGTGACTTTCTGCAATCACCAACCCTTTTCATTGACGGCGTACAATT
TATGGAGCAGTGGTCAAGTGATGTCCCCAACCGAATTTAATAAGAAGCTA
CGGCATTTGTCTAGCAAATATCTAGATGAATTGGAAAAAACTCCAACAGT
CGAGAACATGATGAAGCCATTATTGTGGACAACAGTTATGGACCGAATGT
CAATCTATTATCAGTCATTAGAGCCGGAGGTTTCCGCACAACTTGGACAC
AACCAATCTATGTTTCATCATTGCATGTGGTGGTATGGGAAGCAAATGGC
ATTTGGTGAAAGTTGCAAAGACGACATGCTCGTAGTTAAAAGATTTTCGC
ATCCATCTTATTTCAATTGTTACACAGTCGAACCGATTAAACAAGTTGCA
ATGGATATCTCGAGAATTGGCGCTATTATTTGGCTTGGTCCGAATGAAGA
TATTGATATTCGTCATAAACAAGGGTTTTTGGTTGACATATTTGAACAAG
CATACGGCTTGAGGGTGGCAGTTCATGAGGCCGGCAGTTACCCAAACATC
GATCAAATGGGAAGACAAATTGAACCTGGTAGGTTGAACGAATTGAACTT
TCAACCGGTTTTGAATTTAAGAGTCAATTCCCCAACGAAGAAGTGTAACG
ACAATCCAACAGTTACATATCAAGATCTTGGCGTCGACTTTAATTATGAT
AAAGAGCTTTGCCTAAATTATGAAATCCAAAAGGTTGTCGTCGAAAAATG
TGGCTGTTTATATGGATATTACCCAAGATACTTTTTCCCAAACAAGACAC
ACAATTACTGTGGCCATCTAAATTTCACAAACGACAAAAGTATAATTGAC
AACCTAAATTGTTTAGGAAAGTACATGGACAGCAGTTCTGGTTTAAAAGC
AAATTTAGAAAAATCATGTTTATTGAGATGCAGAAACATAGATTATGACC
TTGCTGTCTCGGTTACAAAATGGCGGCCGACCGAGTGGCAGCTGTATTGG
TTAAAACATGTCAACCAACATTTTCAAAGATACGAAGACGTCCTGACAAA
ATACACAGATAAATCTACCACTGAAAAAGAAAAATCGACTTTAGAATTAC
AAATGAAAAGTCATTTAGAGTATTTTAAAAAGTTTTTAAACCAAGCCAAT
TTAAGCCGGCATAGTGATTCGGAAAATTCGCAGTCAATTTTTGGGGACCG
ATATTCGTTCGTTGTTGTAAAAAGGCGAGACAACAACACTTTTGTCAAAG
AAGAAAGATTCGTTTTGACATTTTCTGCGCTTATTAGTCGAATCGGAGGT
TTGTCATCTTTATATATCGGGTTGACATTTGCATTCTTTGCTGAAGTCAT
TGAATATTTTTACGTTTGTTTGTTTACTCGTTCAGATGATGATAATCAAA
AAGCGTCATCAACAACAGTGATTATTGTGAATGAGAACAGTCCAAAGAAA
AATGATATTCAAAATGTTTTATTGAAAGAACACCATTTGGGTACTCCGAC
AAATAATGTTCAAAGGTCATCAATTCAAACAAAGCTTTTAACCAGCTCAT
CAGACAGCTTAGAACAGCAACCTTAAATATTTTCATGG
back to top

protein sequence of SMED30031431-orf-1

>SMED30031431-orf-1 ID=SMED30031431-orf-1|Name=SMED30031431-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=603bp
MQIKIFDYTKTFLANTSIRGFSRIIRTESIFIKWLWTVYIITNTVLLSIS
IHRVLLDYWQYSVNIQTYTRFDNGTAFPAVTFCNHQPFSLTAYNLWSSGQ
VMSPTEFNKKLRHLSSKYLDELEKTPTVENMMKPLLWTTVMDRMSIYYQS
LEPEVSAQLGHNQSMFHHCMWWYGKQMAFGESCKDDMLVVKRFSHPSYFN
CYTVEPIKQVAMDISRIGAIIWLGPNEDIDIRHKQGFLVDIFEQAYGLRV
AVHEAGSYPNIDQMGRQIEPGRLNELNFQPVLNLRVNSPTKKCNDNPTVT
YQDLGVDFNYDKELCLNYEIQKVVVEKCGCLYGYYPRYFFPNKTHNYCGH
LNFTNDKSIIDNLNCLGKYMDSSSGLKANLEKSCLLRCRNIDYDLAVSVT
KWRPTEWQLYWLKHVNQHFQRYEDVLTKYTDKSTTEKEKSTLELQMKSHL
EYFKKFLNQANLSRHSDSENSQSIFGDRYSFVVVKRRDNNTFVKEERFVL
TFSALISRIGGLSSLYIGLTFAFFAEVIEYFYVCLFTRSDDDNQKASSTT
VIIVNENSPKKNDIQNVLLKEHHLGTPTNNVQRSSIQTKLLTSSSDSLEQ
QP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002028dorsal-ventral muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001873ENaC
Vocabulary: molecular function
TermDefinition
GO:0005272sodium channel activity
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001873Epithelial sodium channelPRINTSPR01078AMINACHANNELcoord: 189..205
score: 35.29
coord: 321..338
score: 36.22
coord: 73..89
score: 43.06
coord: 247..265
score: 35.79
coord: 384..404
score: 26.1
IPR001873Epithelial sodium channelPFAMPF00858ASCcoord: 12..530
e-value: 3.3E-54
score: 184.5
IPR001873Epithelial sodium channelPANTHERPTHR11690AMILORIDE-SENSITIVE SODIUM CHANNEL-RELATEDcoord: 8..539
NoneNo IPR availableTMHMMTMhelixcoord: 29..51
NoneNo IPR availableTMHMMTMhelixcoord: 514..536