SMED30031428

Overview
NameSMED30031428
Smed IDSMED30031428
Length (bp)1469
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30031428 (SMED30031428) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30031428 (SMED30031428) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30031428 (SMED30031428) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30031428 (SMED30031428) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031428

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30031428SMESG000037684.1 dd_Smed_v4_3552_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SMED30031428 vs. Ensembl Human
Match: COMMD7 (COMM domain containing 7 [Source:HGNC Symbol;Acc:HGNC:16223])

HSP 1 Score: 36.965 bits (84), Expect = 6.501e-7
Identity = 17/36 (47.22%), Postives = 24/36 (66.67%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNNN 1294
            L+ ++WK  VT+ SSE +K G+ F+QL L VK  N 
Sbjct:  133 LIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKGNQ 168          

HSP 2 Score: 36.5798 bits (83), Expect = 6.501e-7
Identity = 14/25 (56.00%), Postives = 21/25 (84.00%), Query Frame = 1
Query: 1348 ICLELTLPQFYNFLYEMEKAKIEMK 1422
            + +ELTLPQFY+FL+EME+ +  M+
Sbjct:  172 VYIELTLPQFYSFLHEMERVRTSME 196          
BLAST of SMED30031428 vs. Ensembl Human
Match: COMMD7 (COMM domain containing 7 [Source:HGNC Symbol;Acc:HGNC:16223])

HSP 1 Score: 36.965 bits (84), Expect = 6.767e-7
Identity = 17/36 (47.22%), Postives = 24/36 (66.67%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNNN 1294
            L+ ++WK  VT+ SSE +K G+ F+QL L VK  N 
Sbjct:  134 LIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKGNQ 169          

HSP 2 Score: 36.5798 bits (83), Expect = 6.767e-7
Identity = 14/25 (56.00%), Postives = 21/25 (84.00%), Query Frame = 1
Query: 1348 ICLELTLPQFYNFLYEMEKAKIEMK 1422
            + +ELTLPQFY+FL+EME+ +  M+
Sbjct:  173 VYIELTLPQFYSFLHEMERVRTSME 197          
BLAST of SMED30031428 vs. Ensembl Zebrafish
Match: commd7 (COMM domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-040801-96])

HSP 1 Score: 41.2022 bits (95), Expect = 1.152e-8
Identity = 17/24 (70.83%), Postives = 21/24 (87.50%), Query Frame = 1
Query: 1348 ICLELTLPQFYNFLYEMEKAKIEM 1419
            + +ELTLPQFYNFL+EME+AK  M
Sbjct:  173 VYMELTLPQFYNFLHEMERAKASM 196          

HSP 2 Score: 37.7354 bits (86), Expect = 1.152e-8
Identity = 15/35 (42.86%), Postives = 24/35 (68.57%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNN 1291
            L+ ++WK  VT  +SE+ K+GN F+QL L ++  N
Sbjct:  134 LVDMEWKFGVTVGTSEQQKTGNIFLQLKLVIRKGN 168          
BLAST of SMED30031428 vs. Ensembl Zebrafish
Match: commd7 (COMM domain containing 7 [Source:ZFIN;Acc:ZDB-GENE-040801-96])

HSP 1 Score: 41.2022 bits (95), Expect = 1.152e-8
Identity = 17/24 (70.83%), Postives = 21/24 (87.50%), Query Frame = 1
Query: 1348 ICLELTLPQFYNFLYEMEKAKIEM 1419
            + +ELTLPQFYNFL+EME+AK  M
Sbjct:  173 VYMELTLPQFYNFLHEMERAKASM 196          

HSP 2 Score: 37.7354 bits (86), Expect = 1.152e-8
Identity = 15/35 (42.86%), Postives = 24/35 (68.57%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNN 1291
            L+ ++WK  VT  +SE+ K+GN F+QL L ++  N
Sbjct:  134 LVDMEWKFGVTVGTSEQQKTGNIFLQLKLVIRKGN 168          
BLAST of SMED30031428 vs. Ensembl Mouse
Match: Commd7 (COMM domain containing 7 [Source:MGI Symbol;Acc:MGI:1914197])

HSP 1 Score: 36.5798 bits (83), Expect = 7.098e-6
Identity = 16/28 (57.14%), Postives = 22/28 (78.57%), Query Frame = 1
Query: 1354 LELTLPQFYNFLYEMEKAKIEMK*YKCL 1437
            +ELTLPQFY+FL+EME+ +  M   +CL
Sbjct:  104 MELTLPQFYSFLHEMERVRASM---ECL 128          

HSP 2 Score: 33.113 bits (74), Expect = 7.098e-6
Identity = 15/36 (41.67%), Postives = 23/36 (63.89%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNNN 1294
            L+ ++W+  VT+ SSE +K G+ F+QL L VK    
Sbjct:   63 LIDMEWRFGVTSGSSELEKVGSIFLQLKLVVKKGKQ 98          
BLAST of SMED30031428 vs. Ensembl Mouse
Match: Commd7 (COMM domain containing 7 [Source:MGI Symbol;Acc:MGI:1914197])

HSP 1 Score: 36.5798 bits (83), Expect = 7.200e-6
Identity = 16/28 (57.14%), Postives = 22/28 (78.57%), Query Frame = 1
Query: 1354 LELTLPQFYNFLYEMEKAKIEMK*YKCL 1437
            +ELTLPQFY+FL+EME+ +  M   +CL
Sbjct:  175 MELTLPQFYSFLHEMERVRASM---ECL 199          

HSP 2 Score: 33.113 bits (74), Expect = 7.200e-6
Identity = 15/36 (41.67%), Postives = 23/36 (63.89%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNNN 1294
            L+ ++W+  VT+ SSE +K G+ F+QL L VK    
Sbjct:  134 LIDMEWRFGVTSGSSELEKVGSIFLQLKLVVKKGKQ 169          
BLAST of SMED30031428 vs. UniProt/SwissProt
Match: sp|Q86VX2|COMD7_HUMAN (COMM domain-containing protein 7 OS=Homo sapiens OX=9606 GN=COMMD7 PE=1 SV=2)

HSP 1 Score: 36.965 bits (84), Expect = 2.963e-6
Identity = 17/36 (47.22%), Postives = 24/36 (66.67%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNNN 1294
            L+ ++WK  VT+ SSE +K G+ F+QL L VK  N 
Sbjct:  134 LIDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKGNQ 169          

HSP 2 Score: 36.5798 bits (83), Expect = 2.963e-6
Identity = 14/25 (56.00%), Postives = 21/25 (84.00%), Query Frame = 1
Query: 1348 ICLELTLPQFYNFLYEMEKAKIEMK 1422
            + +ELTLPQFY+FL+EME+ +  M+
Sbjct:  173 VYIELTLPQFYSFLHEMERVRTSME 197          
BLAST of SMED30031428 vs. UniProt/SwissProt
Match: sp|Q3MHX1|COMD7_BOVIN (COMM domain-containing protein 7 OS=Bos taurus OX=9913 GN=COMMD7 PE=2 SV=1)

HSP 1 Score: 36.965 bits (84), Expect = 3.345e-6
Identity = 14/25 (56.00%), Postives = 21/25 (84.00%), Query Frame = 1
Query: 1348 ICLELTLPQFYNFLYEMEKAKIEMK 1422
            + +ELTLPQFY+FL+EME+ +  M+
Sbjct:  173 VYIELTLPQFYSFLHEMERVRTSME 197          

HSP 2 Score: 36.5798 bits (83), Expect = 3.345e-6
Identity = 17/36 (47.22%), Postives = 24/36 (66.67%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNNN 1294
            L+ ++WK  VT+ SSE +K G+ F+QL L VK  N 
Sbjct:  134 LVDMEWKFGVTSGSSELEKVGSIFLQLKLVVKKGNQ 169          
BLAST of SMED30031428 vs. TrEMBL
Match: A0A2C9LZ17 (COMM domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106054134 PE=4 SV=1)

HSP 1 Score: 41.5874 bits (96), Expect = 3.318e-6
Identity = 19/36 (52.78%), Postives = 25/36 (69.44%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNNN 1294
            L+ ++WK  VTA+SSE DK GNTF+QL L +   N 
Sbjct:  135 LVDIEWKFGVTASSSELDKVGNTFLQLKLVINTGNG 170          

HSP 2 Score: 40.0466 bits (92), Expect = 3.318e-6
Identity = 17/25 (68.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query: 1348 ICLELTLPQFYNFLYEMEKAKIEMK 1422
            + LELTLPQFY+FL+EMEKAK  ++
Sbjct:  174 VFLELTLPQFYSFLHEMEKAKASLE 198          
BLAST of SMED30031428 vs. TrEMBL
Match: A0A210QSC4 (COMM domain-containing protein 7 OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT11720 PE=4 SV=1)

HSP 1 Score: 42.743 bits (99), Expect = 4.783e-6
Identity = 20/36 (55.56%), Postives = 24/36 (66.67%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNNN 1294
            LL ++WK  VTA SSE DK GNTF+QL L +   N 
Sbjct:  135 LLDMEWKFGVTAGSSEADKVGNTFLQLKLVINTGNG 170          

HSP 2 Score: 38.1206 bits (87), Expect = 4.783e-6
Identity = 16/22 (72.73%), Postives = 20/22 (90.91%), Query Frame = 1
Query: 1354 LELTLPQFYNFLYEMEKAKIEM 1419
            +ELTLPQFY+FL+EMEKAK  +
Sbjct:  176 MELTLPQFYSFLHEMEKAKASL 197          
BLAST of SMED30031428 vs. TrEMBL
Match: A0A0B6ZP10 (COMM domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF72921 PE=4 SV=1)

HSP 1 Score: 41.2022 bits (95), Expect = 5.353e-6
Identity = 19/36 (52.78%), Postives = 25/36 (69.44%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNNN 1294
            L+ ++WK  VTA+SSE DK GNTF+QL L +   N 
Sbjct:  137 LVDIEWKFGVTASSSELDKVGNTFLQLKLVINTGNG 172          

HSP 2 Score: 39.6614 bits (91), Expect = 5.353e-6
Identity = 16/25 (64.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query: 1348 ICLELTLPQFYNFLYEMEKAKIEMK 1422
            + LELTLPQFY+FL+EMEKA+  ++
Sbjct:  176 VFLELTLPQFYSFLHEMEKARASLE 200          
BLAST of SMED30031428 vs. TrEMBL
Match: A0A1S3JFR7 (COMM domain-containing protein 7-like OS=Lingula unguis OX=7574 GN=LOC106172876 PE=4 SV=1)

HSP 1 Score: 41.9726 bits (97), Expect = 5.523e-6
Identity = 23/43 (53.49%), Postives = 30/43 (69.77%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNNNKITSHFM 1315
            LL ++WK  VTAASSE ++ GNTF+QL L V N  NK  + +M
Sbjct:  139 LLDMEWKFGVTAASSELNQVGNTFIQLKL-VVNKGNKTENVYM 180          

HSP 2 Score: 38.5058 bits (88), Expect = 5.523e-6
Identity = 16/25 (64.00%), Postives = 22/25 (88.00%), Query Frame = 1
Query: 1348 ICLELTLPQFYNFLYEMEKAKIEMK 1422
            + +ELTLPQFY+FL+EMEKAK  ++
Sbjct:  178 VYMELTLPQFYSFLHEMEKAKASLE 202          
BLAST of SMED30031428 vs. Ensembl Cavefish
Match: commd7 (COMM domain containing 7 [Source:NCBI gene;Acc:103033306])

HSP 1 Score: 40.817 bits (94), Expect = 4.379e-8
Identity = 16/24 (66.67%), Postives = 21/24 (87.50%), Query Frame = 1
Query: 1348 ICLELTLPQFYNFLYEMEKAKIEM 1419
            + +ELTLPQFYNFL+EME+A+  M
Sbjct:  173 VFMELTLPQFYNFLHEMERARASM 196          

HSP 2 Score: 36.1946 bits (82), Expect = 4.379e-8
Identity = 16/36 (44.44%), Postives = 24/36 (66.67%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNNN 1294
            L+ ++WK  VT  +SE  K+GN F+QL L V+  N+
Sbjct:  134 LVDMEWKFGVTVGTSELQKAGNIFLQLKLVVRKGNS 169          
BLAST of SMED30031428 vs. Ensembl Nematostella
Match: EDO37428 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFX4])

HSP 1 Score: 38.5058 bits (88), Expect = 2.710e-6
Identity = 15/21 (71.43%), Postives = 20/21 (95.24%), Query Frame = 1
Query: 1348 ICLELTLPQFYNFLYEMEKAK 1410
            + +E+TLPQFY+FL+EMEKAK
Sbjct:  144 VFMEMTLPQFYSFLHEMEKAK 164          

HSP 2 Score: 30.8018 bits (68), Expect = 2.710e-6
Identity = 16/36 (44.44%), Postives = 23/36 (63.89%), Query Frame = 2
Query: 1172 FNIMVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKV 1279
            F +  LL ++WK  VTA+S++    G TF+QL L V
Sbjct:  100 FTVNQLLDMEWKFGVTASSNDMKVVGQTFLQLKLVV 135          
BLAST of SMED30031428 vs. Ensembl Medaka
Match: commd7 (COMM domain containing 7 [Source:NCBI gene;Acc:101158586])

HSP 1 Score: 38.5058 bits (88), Expect = 5.259e-6
Identity = 17/25 (68.00%), Postives = 21/25 (84.00%), Query Frame = 1
Query: 1348 ICLELTLPQFYNFLYEMEKAKIEMK 1422
            I +ELTLPQFY FL+EME+AK  M+
Sbjct:  171 IYVELTLPQFYKFLHEMERAKASME 195          

HSP 2 Score: 31.187 bits (69), Expect = 5.259e-6
Identity = 14/36 (38.89%), Postives = 22/36 (61.11%), Query Frame = 2
Query: 1187 LLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNNN 1294
            L+ ++WK  VT  +SE  K G+ F+QL L  +  N+
Sbjct:  132 LVDMEWKFGVTVGTSEIQKVGSIFLQLKLVTRKGNS 167          
BLAST of SMED30031428 vs. Planmine SMEST
Match: SMESG000037684.1 (SMESG000037684.1)

HSP 1 Score: 89.3521 bits (220), Expect = 4.337e-26
Identity = 43/45 (95.56%), Postives = 45/45 (100.00%), Query Frame = 2
Query: 1181 MVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNNNKITSHFM 1315
            MVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNN+NKITS+FM
Sbjct:    1 MVLLAVDWKLMVTAASSEEDKSGNTFVQLHLKVKNNDNKITSNFM 45          

HSP 2 Score: 48.521 bits (114), Expect = 4.337e-26
Identity = 22/23 (95.65%), Postives = 23/23 (100.00%), Query Frame = 1
Query: 1354 LELTLPQFYNFLYEMEKAKIEMK 1422
            +ELTLPQFYNFLYEMEKAKIEMK
Sbjct:   45 MELTLPQFYNFLYEMEKAKIEMK 67          
BLAST of SMED30031428 vs. Planmine SMEST
Match: SMESG000033763.1 (SMESG000033763.1)

HSP 1 Score: 58.9214 bits (141), Expect = 7.757e-16
Identity = 28/47 (59.57%), Postives = 37/47 (78.72%), Query Frame = -3
Query:  316 CEFDHEK*G*RILIYRLWTLSSSFANSVKVVDKLIELLLKNVYQFTF 456
            CEF +++   + LIYR W+LSS+FANSVK VDKL+ELL+KN Y  +F
Sbjct:  283 CEFKYKRNMVKRLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSF 329          

HSP 2 Score: 35.8094 bits (81), Expect = 7.757e-16
Identity = 16/21 (76.19%), Postives = 16/21 (76.19%), Query Frame = -2
Query:  458 YETGIYRKLTDTGFYTSPXXF 520
            YET IYRK TDTG YTSP  F
Sbjct:  262 YETEIYRKPTDTGLYTSPESF 282          

HSP 3 Score: 28.1054 bits (61), Expect = 7.757e-16
Identity = 21/54 (38.89%), Postives = 26/54 (48.15%), Query Frame = -1
Query:  519 KHIVYK*YLDDVFLIFFKSAFV-----FYEEFT*KI---CETERKLLIDFSEFL 656
            K  VYK Y+D++FL+F     V     F       I   CETERK  I F + L
Sbjct:  201 KPFVYKRYVDNIFLVFDNQKHVELFLHFMNSLHKNIVFTCETERKSSIAFLDLL 254          

HSP 4 Score: 42.743 bits (99), Expect = 6.705e-6
Identity = 20/27 (74.07%), Postives = 21/27 (77.78%), Query Frame = 1
Query:  943 CISVSEYC*SKGLTNISEHKRGCKSEI 1023
            C  V E+C  KGLTNISEH RGCKSEI
Sbjct:  410 CTRVLEHCRLKGLTNISEHNRGCKSEI 436          

HSP 5 Score: 26.1794 bits (56), Expect = 6.705e-6
Identity = 11/19 (57.89%), Postives = 12/19 (63.16%), Query Frame = 2
Query:  887 DLVYQCPCNECNTAYIRAT 943
            +LVYQ  CN CN  YI  T
Sbjct:  387 NLVYQFTCNGCNATYIGKT 405          
BLAST of SMED30031428 vs. Planmine SMEST
Match: SMESG000068262.1 (SMESG000068262.1)

HSP 1 Score: 56.9954 bits (136), Expect = 3.269e-14
Identity = 28/47 (59.57%), Postives = 36/47 (76.60%), Query Frame = -3
Query:  316 CEFDHEK*G*RILIYRLWTLSSSFANSVKVVDKLIELLLKNVYQFTF 456
            CEF +++   + LIYR W LSS+FANSVK VDKL+ELL+KN Y  +F
Sbjct:  213 CEFKYKRNMVKGLIYRSWALSSTFANSVKSVDKLVELLIKNGYSKSF 259          

HSP 2 Score: 35.039 bits (79), Expect = 3.269e-14
Identity = 16/22 (72.73%), Postives = 16/22 (72.73%), Query Frame = -2
Query:  458 SYETGIYRKLTDTGFYTSPXXF 523
             YET IYRK TDTG YTSP  F
Sbjct:  191 QYETEIYRKPTDTGLYTSPESF 212          

HSP 3 Score: 24.6386 bits (52), Expect = 3.269e-14
Identity = 11/16 (68.75%), Postives = 13/16 (81.25%), Query Frame = -1
Query:  609 KHIVYK*YLDDVFLIF 656
            K  VYK Y+DD+FLIF
Sbjct:  150 KPFVYKWYVDDIFLIF 165          
BLAST of SMED30031428 vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1)

HSP 1 Score: 59.3066 bits (142), Expect = 3.886e-14
Identity = 29/50 (58.00%), Postives = 39/50 (78.00%), Query Frame = -3
Query:  307 CEFDHEK*G*RILIYRLWTLSSSFANSVKVVDKLIELLLKNVYQFTF*LV 456
            CEF +++   + LIYR W+LSS+FANSVK VDKL+ELL+KN Y  +F L+
Sbjct: 1738 CEFRYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLL 1787          

HSP 2 Score: 37.7354 bits (86), Expect = 3.886e-14
Identity = 19/29 (65.52%), Postives = 19/29 (65.52%), Query Frame = -2
Query:  458 LISRN--SYETGIYRKLTDTGFYTSPXXF 538
            LI R    YET IYRK TDTG YTSP  F
Sbjct: 1709 LIQRKDKQYETEIYRKPTDTGLYTSPESF 1737          

HSP 3 Score: 42.743 bits (99), Expect = 1.952e-6
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = 1
Query:  943 CISVSEYC*SKGLTNISEHKRGCKSEI 1023
            C  V ++C  KGLTNISEH RGCKSEI
Sbjct: 1911 CTRVLDHCQLKGLTNISEHNRGCKSEI 1937          

HSP 4 Score: 27.7202 bits (60), Expect = 1.952e-6
Identity = 11/19 (57.89%), Postives = 11/19 (57.89%), Query Frame = 2
Query:  887 DLVYQCPCNECNTAYIRAT 943
            DLVY   CN CN  YI  T
Sbjct: 1888 DLVYHFTCNGCNATYIGET 1906          
BLAST of SMED30031428 vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.799e-14
Identity = 29/50 (58.00%), Postives = 39/50 (78.00%), Query Frame = -3
Query:  307 CEFDHEK*G*RILIYRLWTLSSSFANSVKVVDKLIELLLKNVYQFTF*LV 456
            CEF +++   + LIYR W+LSS+FANSVK VDKL+ELL+KN Y  +F L+
Sbjct: 2695 CEFRYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLL 2744          

HSP 2 Score: 37.3502 bits (85), Expect = 4.799e-14
Identity = 19/29 (65.52%), Postives = 19/29 (65.52%), Query Frame = -2
Query:  458 LISRN--SYETGIYRKLTDTGFYTSPXXF 538
            LI R    YET IYRK TDTG YTSP  F
Sbjct: 2666 LIQRKDKQYETEIYRKPTDTGLYTSPESF 2694          

HSP 3 Score: 42.3578 bits (98), Expect = 2.894e-6
Identity = 19/27 (70.37%), Postives = 21/27 (77.78%), Query Frame = 1
Query:  943 CISVSEYC*SKGLTNISEHKRGCKSEI 1023
            C  V ++C  KGLTNISEH RGCKSEI
Sbjct: 2868 CTRVLDHCQLKGLTNISEHNRGCKSEI 2894          

HSP 4 Score: 27.7202 bits (60), Expect = 2.894e-6
Identity = 11/19 (57.89%), Postives = 11/19 (57.89%), Query Frame = 2
Query:  887 DLVYQCPCNECNTAYIRAT 943
            DLVY   CN CN  YI  T
Sbjct: 2845 DLVYHFTCNGCNATYIGET 2863          
The following BLAST results are available for this feature:
BLAST of SMED30031428 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
COMMD76.501e-747.22COMM domain containing 7 [Source:HGNC Symbol;Acc:H... [more]
COMMD76.767e-747.22COMM domain containing 7 [Source:HGNC Symbol;Acc:H... [more]
back to top
BLAST of SMED30031428 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031428 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031428 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
commd71.152e-870.83COMM domain containing 7 [Source:ZFIN;Acc:ZDB-GENE... [more]
commd71.152e-870.83COMM domain containing 7 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of SMED30031428 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031428 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Commd77.098e-657.14COMM domain containing 7 [Source:MGI Symbol;Acc:MG... [more]
Commd77.200e-657.14COMM domain containing 7 [Source:MGI Symbol;Acc:MG... [more]
back to top
BLAST of SMED30031428 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q86VX2|COMD7_HUMAN2.963e-647.22COMM domain-containing protein 7 OS=Homo sapiens O... [more]
sp|Q3MHX1|COMD7_BOVIN3.345e-656.00COMM domain-containing protein 7 OS=Bos taurus OX=... [more]
back to top
BLAST of SMED30031428 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 4
Match NameE-valueIdentityDescription
A0A2C9LZ173.318e-652.78COMM domain-containing protein OS=Biomphalaria gla... [more]
A0A210QSC44.783e-655.56COMM domain-containing protein 7 OS=Mizuhopecten y... [more]
A0A0B6ZP105.353e-652.78COMM domain-containing protein (Fragment) OS=Arion... [more]
A0A1S3JFR75.523e-653.49COMM domain-containing protein 7-like OS=Lingula u... [more]
back to top
BLAST of SMED30031428 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
commd74.379e-866.67COMM domain containing 7 [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of SMED30031428 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031428 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30031428 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO374282.710e-671.43Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30031428 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
commd75.259e-668.00COMM domain containing 7 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of SMED30031428 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000037684.14.337e-2695.56SMESG000037684.1[more]
SMESG000033763.17.757e-1659.57SMESG000033763.1[more]
SMESG000068262.13.269e-1459.57SMESG000068262.1[more]
SMESG000050479.13.886e-1458.00SMESG000050479.1[more]
SMESG000050479.14.799e-1458.00SMESG000050479.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031428 ID=SMED30031428|Name=SMED30031428|organism=Schmidtea mediterranea sexual|type=transcript|length=1469bp
TTTCAATCTAATTTTAATTTTACCAATCTATAAATATTACAAAATTTAAT
AACAAAATTANTTAACTTCACATTTTANCCANACAATCCATTTGAAAACC
ACAAACCAATCCATACAACCTTAATTTAACGCCAAAATGTTTAAAGACTA
TCAAAAGACAAGTGTTCACAGCACGAATTTATCCAATGACTTTATAAACA
AAGCTTAAATATCACACAATCTCAATAATTATTAAAAAAAAAATTAAATT
CAGATTCAACTCATTGACCAATAATGTCTTCTGTCGAACATGTTCAAGGA
CTCGTGTACCAATTAAAATGTAAATTGATAAACATTCTTCAACAACAACT
CAATCAATTTATCAACAACTTTTACTGAATTTGCAAAACTAGAAGATAAA
GTCCATAAACGATAAATCAATATCCTTTAACCTTATTTCTCATGATCAAA
TTCACANAAANCTTTNNGGAGAAGTATAAAAACCAGTATCAGTTAGTTTC
CTATAAATCCCTGTCTCATAAGAATTCCGAGAAATCAATCAATAACTTTC
TCTCAGTTTCACATATTTTTTAAGTAAACTCTTCATAAAATACAAAAGCA
GATTTAAAAAATATAAGAAAGACATCATCTAAATATCATTTGTAAACAAT
GTGTTTCAATAGACCTATGTGGTNTGCTATGGAATGAAAACATTTCTGAA
CATCATATTTAGGATGGAAGAGCATCTGTGAACTTCTTGAGTTTGCTACT
TCAAAAGTCAATTTAATTTTCAACAATGATTGGCATCAATATTTTTGTCA
TATGTGGATGATATTTTTATTATCTTTGAAATACAGAGTAACGTGGCTCT
GTTTTNGCATTATATGGACANTTTAAGTGATATTTAGATCTCGTTTATCA
GTGTCCATGTAATGAGTGTAATACCGCATACATTAGAGCGACTGTATTTC
AGTCAGTGAATATTGTTGATCGAAGGGATTGACCAATATTAGTGAACACA
AAAGAGGCTGTAAAAGTGAAATANNTTGAATTTTAAATTATTCCATTAAA
TATTGTTATTTTGATACTTGAAATTTTATTTTATTCATATACCTTTTTTT
AATTTTTGAAATTATTTTTAAAACCTTTATTTGAATAGTAATTATACTCT
TGTATTTCACTTTTACTTAATTTTAATATCATGGTTCTATTAGCAGTTGA
TTGGAAATTAATGGTAACAGCCGCAAGCAGTGAAGAAGATAAATCTGGAA
ATACATTTGTCCAGCTTCATTTAAAAGTAAAAAACAATAATAACAAAATT
ACCAGCCATTTTATGGGTAATTTATGTTTTACAATTAAGTAAATATGATA
TGTTTAGAATTAACATTGCCTCAATTTTATAATTTCTTATATGAAATGGA
AAAAGCAAAGATTGAAATGAAATAATATAAATGTTTGATTAAATAAAATC
TTGATTAGCTTTCTTAAAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell