Homeobox protein Hox-D12

Overview
NameHomeobox protein Hox-D12
Smed IDSMED30031425
Length (bp)1004
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox protein Hox-D12 (SMED30031425) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox protein Hox-D12 (SMED30031425) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031425

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30031425SMESG000003389.1 SMED30031425smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
eyeSMED30031425SMESG000003389.1 SMED30031425smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
male primordial germ cellSMED30031425SMESG000003389.1 SMED30031425smed_20140614PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
testisSMED30031425SMESG000003389.1 Contig4966_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
early male germ cellSMED30031425SMESG000003389.1 Contig4966_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism asexual adult cDNA to DNA expression microarray evidence
testis primordiumSMED30031425SMESG000003389.1 Contig4966_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox protein Hox-D12 vs. Ensembl Human
Match: HOXD12 (homeobox D12 [Source:HGNC Symbol;Acc:HGNC:5135])

HSP 1 Score: 49.6766 bits (117), Expect = 2.759e-6
Identity = 22/51 (43.14%), Postives = 36/51 (70.59%), Query Frame = 1
Query:  340 SKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRL 492
            +K  +  LEN +  + FINR++R+E++  LNL  ++V+ WFQNRR K +R+
Sbjct:  210 TKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRV 260          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Human
Match: LHX5 (LIM homeobox 5 [Source:HGNC Symbol;Acc:HGNC:14216])

HSP 1 Score: 50.0618 bits (118), Expect = 3.070e-6
Identity = 22/72 (30.56%), Postives = 41/72 (56.94%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRK--YIRSGKYARKING 561
            ++ L+  +  +    R  RE++A+E  L +  ++ WFQNRR K+RR+ Q+    +R+  + RS +  R + G
Sbjct:  192 LETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGG 263          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Human
Match: HESX1 (HESX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:4877])

HSP 1 Score: 47.3654 bits (111), Expect = 7.323e-6
Identity = 19/58 (32.76%), Postives = 41/58 (70.69%), Query Frame = 1
Query:  337 LSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQF 510
             +++ +++LEN+++ + +     RE++A++LNL  ++++ WFQNRR K +R ++  QF
Sbjct:  115 FTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQF 172          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Human
Match: HESX1 (HESX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:4877])

HSP 1 Score: 47.3654 bits (111), Expect = 7.323e-6
Identity = 19/58 (32.76%), Postives = 41/58 (70.69%), Query Frame = 1
Query:  337 LSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQF 510
             +++ +++LEN+++ + +     RE++A++LNL  ++++ WFQNRR K +R ++  QF
Sbjct:  115 FTQNQIEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKLKRSHRESQF 172          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Human
Match: HOXC12 (homeobox C12 [Source:HGNC Symbol;Acc:HGNC:5124])

HSP 1 Score: 48.1358 bits (113), Expect = 9.240e-6
Identity = 23/51 (45.10%), Postives = 34/51 (66.67%), Query Frame = 1
Query:  340 SKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRL 492
            SK  +  LE  +  + FI R+RR E+++ LNL  ++V+ WFQNRR K +RL
Sbjct:  222 SKLQLAELEGEFLVNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRL 272          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Celegans
Match: vab-7 (Homeobox protein vab-7 [Source:UniProtKB/Swiss-Prot;Acc:Q93899])

HSP 1 Score: 50.8322 bits (120), Expect = 3.818e-7
Identity = 22/51 (43.14%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  337 LSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRR 489
             S+  +  LE  +    +++RK R E+A ELNLP   ++ WFQNRR KD+R
Sbjct:   75 FSREQIGRLEREFAKENYVSRKTRGELAAELNLPEGTIKVWFQNRRMKDKR 125          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Celegans
Match: ceh-14 (Homeobox protein ceh-14 [Source:UniProtKB/Swiss-Prot;Acc:P20271])

HSP 1 Score: 48.521 bits (114), Expect = 3.363e-6
Identity = 33/94 (35.11%), Postives = 47/94 (50.00%), Query Frame = 1
Query:  337 LSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQ----QFSSRKYIRSGKYARKINGCDDYYYYDQRPSDYG 606
            +S   ++ L+  YQTS+   R  RE++A E  L +  V+ WFQNRR K++RL +      + S+R    S      ING    Y Y   P D G
Sbjct:  187 ISAKSLETLKQAYQTSSKPARHVREQLASETGLDMRVVQVWFQNRRAKEKRLKKDAGRRWKSSNRAESDSNSPIESINGQSPNYLYLDHPMDDG 280          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Fly
Match: Lim1 (gene:FBgn0026411 transcript:FBtr0331732)

HSP 1 Score: 49.6766 bits (117), Expect = 1.738e-6
Identity = 31/119 (26.05%), Postives = 52/119 (43.70%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRKYIRSGKYARKI------NGCDD-----YYYYDQR-PSDYGLVEHVNAIPVNMPIIPESYMPV 672
            +++L+  +  +    R  RE++A+E  LP+  ++ WFQN+R K+RR+ Q+       +    +  R         G DD     Y+  D +    YG   H +  P   P  P   MP 
Sbjct:  101 LEVLKTAFNQTPKPTRHIREQLAKETGLPMRVIQVWFQNKRSKERRMKQITSMGRPPFFGGARKMRGFPMNLSPGGLDDGPGFPYFAADAKFEFGYGGPFHPHDGPY-FPGHPGGPMPF 218          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Fly
Match: eve (gene:FBgn0000606 transcript:FBtr0088390)

HSP 1 Score: 49.6766 bits (117), Expect = 1.829e-6
Identity = 20/43 (46.51%), Postives = 29/43 (67.44%), Query Frame = 1
Query:  361 LENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRR 489
            LE  +    +++R RR E+A +LNLP   ++ WFQNRR KD+R
Sbjct:   85 LEKEFYKENYVSRPRRCELAAQLNLPESTIKVWFQNRRMKDKR 127          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Fly
Match: ro (gene:FBgn0003267 transcript:FBtr0085091)

HSP 1 Score: 48.9062 bits (115), Expect = 3.056e-6
Identity = 21/48 (43.75%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  361 LENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQ 504
            LE  +  + +I+R RR E+AE L L   +++ WFQNRR KD+R+ + Q
Sbjct:  206 LEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQ 253          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Fly
Match: ro (gene:FBgn0003267 transcript:FBtr0085090)

HSP 1 Score: 48.9062 bits (115), Expect = 3.056e-6
Identity = 21/48 (43.75%), Postives = 32/48 (66.67%), Query Frame = 1
Query:  361 LENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQ 504
            LE  +  + +I+R RR E+AE L L   +++ WFQNRR KD+R+ + Q
Sbjct:  206 LEVEFHRNEYISRSRRFELAETLRLTETQIKIWFQNRRAKDKRIEKAQ 253          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Fly
Match: cad (gene:FBgn0000251 transcript:FBtr0335152)

HSP 1 Score: 48.9062 bits (115), Expect = 3.933e-6
Identity = 21/46 (45.65%), Postives = 32/46 (69.57%), Query Frame = 1
Query:  361 LENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQ 498
            LE  Y TS +I  +R+ E+A+ L+L   +V+ WFQNRR K+R+ N+
Sbjct:  306 LEKEYCTSRYITIRRKSELAQTLSLSERQVKIWFQNRRAKERKQNK 351          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Zebrafish
Match: cdx1a (caudal type homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-050510-1])

HSP 1 Score: 50.8322 bits (120), Expect = 6.205e-7
Identity = 27/57 (47.37%), Postives = 35/57 (61.40%), Query Frame = 1
Query:  361 LENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDR-----RLNQVQQFSS 516
            LE  +  S +I  +R+ E+A  LNL   +V+ WFQNRR K+R     RL QVQQ SS
Sbjct:  144 LEKEFHFSRYITIRRKAELAGTLNLSERQVKIWFQNRRAKERKMNKKRLQQVQQSSS 200          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Zebrafish
Match: hesx1 (HESX homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-990415-130])

HSP 1 Score: 46.2098 bits (108), Expect = 1.564e-6
Identity = 22/61 (36.07%), Postives = 41/61 (67.21%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRKYIRS 534
            + ILE+++Q +++     REE+A++L+L  ++++ WFQNRR K +R ++  QF   K + S
Sbjct:    3 IKILESVFQVNSYPGIDIREELAKKLHLDEDRIQIWFQNRRAKLKRSHRESQFLMVKNVLS 63          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Zebrafish
Match: eve1 (even-skipped-like1 [Source:ZFIN;Acc:ZDB-GENE-980526-69])

HSP 1 Score: 48.9062 bits (115), Expect = 2.434e-6
Identity = 21/43 (48.84%), Postives = 29/43 (67.44%), Query Frame = 1
Query:  361 LENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRR 489
            LE  Y   ++++R RR E+A  LNLP   ++ WFQNRR KD+R
Sbjct:   52 LEQEYCKESYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKR 94          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Zebrafish
Match: eve1 (even-skipped-like1 [Source:ZFIN;Acc:ZDB-GENE-980526-69])

HSP 1 Score: 48.9062 bits (115), Expect = 2.458e-6
Identity = 21/43 (48.84%), Postives = 29/43 (67.44%), Query Frame = 1
Query:  361 LENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRR 489
            LE  Y   ++++R RR E+A  LNLP   ++ WFQNRR KD+R
Sbjct:   51 LEQEYCKESYVSRPRRCELAAALNLPETTIKVWFQNRRMKDKR 93          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Zebrafish
Match: hoxd12a (homeobox D12a [Source:NCBI gene;Acc:100006598])

HSP 1 Score: 48.9062 bits (115), Expect = 2.953e-6
Identity = 21/44 (47.73%), Postives = 33/44 (75.00%), Query Frame = 1
Query:  361 LENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRL 492
            LEN +  + FINR++R+E+++ L L  ++V+ WFQNRR K +RL
Sbjct:  209 LENEFMMNEFINRQKRKELSDRLELSDQQVKIWFQNRRMKKKRL 252          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Xenopus
Match: klf2 (Kruppel-like factor 2 [Source:Xenbase;Acc:XB-GENE-485035])

HSP 1 Score: 50.8322 bits (120), Expect = 1.628e-6
Identity = 44/171 (25.73%), Postives = 76/171 (44.44%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRK--YIRSGKYARKING-CDDYYYYDQRP-SDYGLVEHVNAIPVNMPIIPESYMPVTPEKLDPVNVTFVDNSPPASGTMPYWPASNWNNEDVMDLNKDPTTNDPVENRSYLYSIMH 852
            ++ L+  +  +    R  RE++A+E  L +  ++ WFQNRR K+RR+ Q+    +R+  + RS +  R + G  D+       P S YG  +       N    P  + P + +   P + +++ NS P  G+ P  P           L    + + P EN+ Y   I H
Sbjct:  192 LETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESDILSSGPYSYYGDYQGDYYGSGNYDFFP--HGPPSSQTQSPADSSYLQNSGP--GSTPLGP-----------LESQLSGHHPSENQRYADMISH 347          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Xenopus
Match: ENSXETT00000008643.1 (mix-like endodermal regulator [Source:NCBI gene;Acc:100038097])

HSP 1 Score: 50.447 bits (119), Expect = 1.784e-6
Identity = 20/50 (40.00%), Postives = 36/50 (72.00%), Query Frame = 1
Query:  340 SKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRR 489
            S++ +D+LE  +QT+ + +  +RE +A+ + +P  +V+ WFQNRR K+RR
Sbjct:   97 SQNKLDVLEQFFQTNMYPDIHQRENLAKRIYIPESRVQVWFQNRRAKERR 146          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Xenopus
Match: limd2 (LIM domain containing 2 [Source:Xenbase;Acc:XB-GENE-986974])

HSP 1 Score: 50.447 bits (119), Expect = 2.217e-6
Identity = 20/46 (43.48%), Postives = 31/46 (67.39%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRR 489
            +DILE  +QT+ + +   REE+A  + +P  +++ WFQNRR K RR
Sbjct:  107 LDILEQFFQTNMYPDIHHREELARHIYIPESRIQVWFQNRRAKVRR 152          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Xenopus
Match: limd2 (LIM domain containing 2 [Source:Xenbase;Acc:XB-GENE-986974])

HSP 1 Score: 50.0618 bits (118), Expect = 3.108e-6
Identity = 24/71 (33.80%), Postives = 39/71 (54.93%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRKYIRSGKYARKINGC 564
            +DILE  +QT+ + +   REE+A  + +P  +++ WFQNRR K RR    Q   + K + +G +     G 
Sbjct:  180 LDILEQFFQTNMYPDIHHREELARHIYIPESRIQVWFQNRRAKVRR----QGAKATKPVLAGHHYSSTFGA 246          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Xenopus
Match: gfm2 (G elongation factor, mitochondrial 2 [Source:Xenbase;Acc:XB-GENE-1002407])

HSP 1 Score: 48.9062 bits (115), Expect = 6.384e-6
Identity = 36/140 (25.71%), Postives = 64/140 (45.71%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRK--YIRSGKYARKI-----------NGCDDYYYYDQRPSDYGLVEHVNAIPVNMPIIPESYMPVTPEKLDPVNVTFVDNSPPAS 732
            ++ L+  +  +    R  RE++A+E  L +  ++ WFQNRR K+RR+ Q+    +R+  + RS +  R +           NG    +Y D +   YG   + +  P           P + +   PV++ FV +S PA 
Sbjct:  188 LETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLVDRLEPGELIPNG-PFSFYGDYQSEYYGPGSNYDFFPQG---------PPSSQAQTPVDLPFVPSSGPAG 317          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Mouse
Match: Hoxd12 (homeobox D12 [Source:MGI Symbol;Acc:MGI:96204])

HSP 1 Score: 52.373 bits (124), Expect = 2.473e-7
Identity = 24/56 (42.86%), Postives = 39/56 (69.64%), Query Frame = 1
Query:  340 SKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQ 507
            +K  +  LEN +  + FINR++R+E++  LNL  ++V+ WFQNRR K +R+ Q +Q
Sbjct:  208 TKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVQREQ 263          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Mouse
Match: Lhx5 (LIM homeobox protein 5 [Source:MGI Symbol;Acc:MGI:107792])

HSP 1 Score: 52.373 bits (124), Expect = 4.291e-7
Identity = 29/95 (30.53%), Postives = 48/95 (50.53%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRK--YIRSGKYARKINGCDD---------YYYYDQRPSDY 603
            ++ L+  +  +    R  RE++A+E  L +  ++ WFQNRR K+RR+ Q+    +R+  + RS +  R + G  D         Y YY    SDY
Sbjct:  192 LETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDY 286          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Mouse
Match: Hesx1 (homeobox gene expressed in ES cells [Source:MGI Symbol;Acc:MGI:96071])

HSP 1 Score: 47.7506 bits (112), Expect = 4.323e-6
Identity = 20/58 (34.48%), Postives = 40/58 (68.97%), Query Frame = 1
Query:  337 LSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQF 510
             +++ V++LEN+++ + +     RE++A++LNL  ++++ WFQNRR K +R  +  QF
Sbjct:  115 FTQNQVEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKMKRSRRESQF 172          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Mouse
Match: Hesx1 (homeobox gene expressed in ES cells [Source:MGI Symbol;Acc:MGI:96071])

HSP 1 Score: 47.7506 bits (112), Expect = 4.323e-6
Identity = 20/58 (34.48%), Postives = 40/58 (68.97%), Query Frame = 1
Query:  337 LSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQF 510
             +++ V++LEN+++ + +     RE++A++LNL  ++++ WFQNRR K +R  +  QF
Sbjct:  115 FTQNQVEVLENVFRVNCYPGIDIREDLAQKLNLEEDRIQIWFQNRRAKMKRSRRESQF 172          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Mouse
Match: Lhx1 (LIM homeobox protein 1 [Source:MGI Symbol;Acc:MGI:99783])

HSP 1 Score: 48.521 bits (114), Expect = 5.365e-6
Identity = 34/134 (25.37%), Postives = 59/134 (44.03%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRK--YIRSGKYARKI-----------NGCDDYYYYDQRPSDY------------GLVEHVNAIPVNMPIIPESYMPVTP 678
            ++ L+  +  +    R  RE++A+E  L +  ++ WFQNRR K+RR+ Q+    +R+  + RS +  R +           NG   + +Y    S+Y            G        PV++P +P S    TP
Sbjct:  101 LETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLVDRLEPGELIPNG--PFSFYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPSGTP 232          
BLAST of Homeobox protein Hox-D12 vs. UniProt/SwissProt
Match: sp|P23812|HXD12_MOUSE (Homeobox protein Hox-D12 OS=Mus musculus OX=10090 GN=Hoxd12 PE=2 SV=2)

HSP 1 Score: 52.373 bits (124), Expect = 1.730e-6
Identity = 24/56 (42.86%), Postives = 39/56 (69.64%), Query Frame = 1
Query:  340 SKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQ 507
            +K  +  LEN +  + FINR++R+E++  LNL  ++V+ WFQNRR K +R+ Q +Q
Sbjct:  208 TKQQIAELENEFLVNEFINRQKRKELSNRLNLSDQQVKIWFQNRRMKKKRVVQREQ 263          
BLAST of Homeobox protein Hox-D12 vs. UniProt/SwissProt
Match: sp|Q9IA16|HXD12_HETFR (Homeobox protein Hox-D12 OS=Heterodontus francisci OX=7792 GN=HOXD12 PE=3 SV=1)

HSP 1 Score: 51.9878 bits (123), Expect = 2.171e-6
Identity = 23/51 (45.10%), Postives = 37/51 (72.55%), Query Frame = 1
Query:  340 SKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRL 492
            +K  +  LEN +  + FINR++R+E+++ LNL  ++V+ WFQNRR K +RL
Sbjct:  212 TKQQIAELENEFLANEFINRQKRKELSDRLNLSDQQVKIWFQNRRMKKKRL 262          
BLAST of Homeobox protein Hox-D12 vs. UniProt/SwissProt
Match: sp|P61376|LHX5_RAT (LIM/homeobox protein Lhx5 OS=Rattus norvegicus OX=10116 GN=Lhx5 PE=2 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 3.001e-6
Identity = 29/95 (30.53%), Postives = 48/95 (50.53%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRK--YIRSGKYARKINGCDD---------YYYYDQRPSDY 603
            ++ L+  +  +    R  RE++A+E  L +  ++ WFQNRR K+RR+ Q+    +R+  + RS +  R + G  D         Y YY    SDY
Sbjct:  192 LETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDY 286          
BLAST of Homeobox protein Hox-D12 vs. UniProt/SwissProt
Match: sp|P61375|LHX5_MOUSE (LIM/homeobox protein Lhx5 OS=Mus musculus OX=10090 GN=Lhx5 PE=2 SV=1)

HSP 1 Score: 52.373 bits (124), Expect = 3.001e-6
Identity = 29/95 (30.53%), Postives = 48/95 (50.53%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRK--YIRSGKYARKINGCDD---------YYYYDQRPSDY 603
            ++ L+  +  +    R  RE++A+E  L +  ++ WFQNRR K+RR+ Q+    +R+  + RS +  R + G  D         Y YY    SDY
Sbjct:  192 LETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRPLGGRLDESEMLGSTPYTYYGDYQSDY 286          
BLAST of Homeobox protein Hox-D12 vs. UniProt/SwissProt
Match: sp|P21711|MIX1_XENLA (Homeobox protein Mix.1 OS=Xenopus laevis OX=8355 GN=mix-a PE=2 SV=2)

HSP 1 Score: 51.9878 bits (123), Expect = 3.533e-6
Identity = 25/81 (30.86%), Postives = 44/81 (54.32%), Query Frame = 1
Query:  337 LSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRKYIRSGKYARKINGCDDYYY 579
             ++  +DILE  +QT+ + +   REE+A  + +P  +++ WFQNRR K RR    Q   + K I +G +    +G +   +
Sbjct:  103 FTQAQLDILEQFFQTNMYPDIHHREELARHIYIPESRIQVWFQNRRAKVRR----QGAKATKPILAGHHYSGTSGANRAMF 179          
BLAST of Homeobox protein Hox-D12 vs. TrEMBL
Match: A0A158RBF9 (Homeobox domain-containing protein OS=Thelazia callipaeda OX=103827 GN=TCLT_LOCUS4471 PE=4 SV=1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.062e-7
Identity = 37/90 (41.11%), Postives = 50/90 (55.56%), Query Frame = 1
Query:  283 KTETKLSFPN-PIIGDTNRL----SKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRKYIRSG 537
            +   KLS P  PII DTN +    + H +  LE  Y TS ++NR RR EIA  L L   +V+ WFQNRR K+++  + Q F +R     G
Sbjct:  124 RAAAKLSVPKRPIIEDTNAIRTNFTTHQLTELEKEYYTSKYLNRTRRAEIASILQLNETQVKIWFQNRRMKEKKRQKEQAFLARGTCGGG 213          
BLAST of Homeobox protein Hox-D12 vs. TrEMBL
Match: A0A151P5M4 (Homeobox protein XHOX-3-like OS=Alligator mississippiensis OX=8496 GN=Y1Q_0012109 PE=4 SV=1)

HSP 1 Score: 58.5362 bits (140), Expect = 7.016e-7
Identity = 36/102 (35.29%), Postives = 55/102 (53.92%), Query Frame = 1
Query:  184 NNSDIDESVKNLIQMSKEQIAKEKELSTSTKDPKTETKLSFPNPIIGDTNRLSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRR 489
            +NSD    VK    + K+ +A++  LSTS  D   + + +F           S+  + ILE  Y   ++++R RR E+A  LNLP   ++ WFQNRR KD+R
Sbjct:    5 DNSDPGSDVK----LGKKSLAQKLPLSTSVGDHIRQHRTTF-----------SQEQLAILEQQYSKESYLSRARRYELASALNLPESTIKVWFQNRRMKDKR 91          
BLAST of Homeobox protein Hox-D12 vs. TrEMBL
Match: A0A1I8CDY2 (Homeobox domain-containing protein OS=Rhabditophanes sp. KR3021 OX=114890 PE=4 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 8.812e-7
Identity = 35/86 (40.70%), Postives = 51/86 (59.30%), Query Frame = 1
Query:  265 TSTKDPKTETKLSFPNPIIGDTNRLSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRK 522
            T+TK P  + K    + +   TN  + H +  LE  Y TS ++NR RR EIA +LNL   +V+ WFQNRR K ++  + Q+F +RK
Sbjct:  161 TTTKAPTPKRKSLDQDSLTNRTN-FTTHQLTELEKEYHTSNYLNRGRRREIAGQLNLNETQVKIWFQNRRMKAKKRQREQEFLARK 245          
BLAST of Homeobox protein Hox-D12 vs. TrEMBL
Match: A0A1U7RNT2 (homeobox protein XHOX-3-like OS=Alligator sinensis OX=38654 GN=LOC102368279 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.016e-6
Identity = 36/102 (35.29%), Postives = 54/102 (52.94%), Query Frame = 1
Query:  184 NNSDIDESVKNLIQMSKEQIAKEKELSTSTKDPKTETKLSFPNPIIGDTNRLSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRR 489
            +NSD    VK    + K+ +A++  LSTS  D     + +F           S+  + ILE  Y   ++++R RR E+A  LNLP   ++ WFQNRR KD+R
Sbjct:    5 DNSDPGSDVK----LGKKSLAQKLPLSTSAGDHIRRHRTTF-----------SQEQLAILEQQYSKESYLSRARRYELANALNLPESTIKVWFQNRRMKDKR 91          
BLAST of Homeobox protein Hox-D12 vs. TrEMBL
Match: A0A158R517 (Homeobox domain-containing protein OS=Syphacia muris OX=451379 PE=4 SV=1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.478e-6
Identity = 36/90 (40.00%), Postives = 51/90 (56.67%), Query Frame = 1
Query:  283 KTETKLSFPN------PIIGDTNRLSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRKYIRS 534
            +T TK + P       P +  TN  S H +  LE  Y TS ++NR RR EIA  L+L   +V+ WFQNRR K+++  + Q+F +R  I S
Sbjct:   85 RTATKTTVPKRRVVDEPSVNRTN-FSTHQLTELEKEYYTSKYLNRTRRAEIAAILDLNETQVKIWFQNRRMKEKKRQKEQEFLARGMITS 173          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Cavefish
Match: HESX1 (HESX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:4877])

HSP 1 Score: 51.9878 bits (123), Expect = 6.571e-8
Identity = 24/62 (38.71%), Postives = 43/62 (69.35%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRKYIRSG 537
            ++ILE+++Q +++     REE+AE+LNL  ++++ WFQNRR K +R ++  QF   K + +G
Sbjct:   82 IEILESVFQVNSYPGIDLREELAEKLNLDEDRIQIWFQNRRAKLKRSHRESQFLMVKKVITG 143          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Cavefish
Match: hoxd12a (homeobox protein Hox-D12a-like [Source:NCBI gene;Acc:103047027])

HSP 1 Score: 51.6026 bits (122), Expect = 3.279e-7
Identity = 22/44 (50.00%), Postives = 34/44 (77.27%), Query Frame = 1
Query:  361 LENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRL 492
            LEN +  + FINR++R+E+++ LNL  ++V+ WFQNRR K +RL
Sbjct:  208 LENEFMINEFINRQKRKELSDRLNLSDQQVKIWFQNRRMKKKRL 251          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Cavefish
Match: eve1 (homeobox even-skipped homolog protein 1-like [Source:NCBI gene;Acc:103043644])

HSP 1 Score: 50.0618 bits (118), Expect = 1.002e-6
Identity = 21/43 (48.84%), Postives = 29/43 (67.44%), Query Frame = 1
Query:  361 LENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRR 489
            LE  Y   ++++R RR E+A  LNLP   ++ WFQNRR KD+R
Sbjct:   53 LEQEYGKESYVSRARRCELAAALNLPETTIKVWFQNRRMKDKR 95          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Cavefish
Match: eve1 (homeobox even-skipped homolog protein 1-like [Source:NCBI gene;Acc:103043644])

HSP 1 Score: 50.0618 bits (118), Expect = 1.044e-6
Identity = 21/43 (48.84%), Postives = 29/43 (67.44%), Query Frame = 1
Query:  361 LENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRR 489
            LE  Y   ++++R RR E+A  LNLP   ++ WFQNRR KD+R
Sbjct:   56 LEQEYGKESYVSRARRCELAAALNLPETTIKVWFQNRRMKDKR 98          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Cavefish
Match: lhx5 (LIM/homeobox protein Lhx5 [Source:NCBI gene;Acc:103047421])

HSP 1 Score: 50.0618 bits (118), Expect = 1.462e-6
Identity = 39/153 (25.49%), Postives = 67/153 (43.79%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRK--YIRSGKYARKIN---------GCDDYYYYDQRPSDYGLVEHVNAIPVNMPIIPESYMPVTPEKLDPVNVTFVDNSPPASGTMPYWPASNWNNED 777
            ++ L+  +  +    R  RE++A+E  L +  ++ WFQNRR K+RR+ Q+    +R+  + R  +  R +          G   Y YY +   DY       A  VN    P  + P + +   P    ++ +S   SGT+   P S  +  D
Sbjct:  159 LETLKAAFVATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRGPRRMRPLGGRLEDPDILGPGGYSYYGEYQGDY------YAPGVNYDFFP--HGPPSSQAQSPAEPPYLLSS--GSGTLDGGPGSAHHPTD 301          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009847.1 (pep scaffold:Pmarinus_7.0:GL481168:3356:14379:1 gene:ENSPMAG00000008904.1 transcript:ENSPMAT00000009847.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.2098 bits (108), Expect = 3.674e-6
Identity = 23/74 (31.08%), Postives = 40/74 (54.05%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRK---YIRSG-KYARKING 561
            ++ L   +  +   +R  RE++A+E  L +  ++ WFQNRR K+RR+ Q+     R+     R G + AR + G
Sbjct:   39 LETLRAAFAATPKPSRHVREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGGRRGHALFRGGARRARPLAG 112          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Nematostella
Match: OTXC (OtxC; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKM4])

HSP 1 Score: 48.9062 bits (115), Expect = 7.717e-7
Identity = 23/65 (35.38%), Postives = 43/65 (66.15%), Query Frame = 1
Query:  337 LSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRKYIR 531
             +K+ ++ILE ++  + + +   REE+A ++NLP  +V+ WF+NRR K R+L++ Q   S K ++
Sbjct:   48 FTKNQLEILEELFAKTRYPDIFMREEVAIKINLPESRVQVWFKNRRAKLRQLSKGQSKQSPKPVK 112          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Nematostella
Match: MOXB (MoxB; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SR28])

HSP 1 Score: 46.2098 bits (108), Expect = 8.982e-7
Identity = 23/52 (44.23%), Postives = 34/52 (65.38%), Query Frame = 1
Query:  337 LSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRL 492
             +KH +  LEN +Q + ++ R RR EIA  L+L   +V+ WFQNRR K +R+
Sbjct:   23 FTKHQIQELENEFQRNNYLTRLRRYEIAVSLDLTERQVKVWFQNRRMKWKRV 74          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Nematostella
Match: EDO38217 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDF9])

HSP 1 Score: 44.2838 bits (103), Expect = 1.466e-6
Identity = 21/51 (41.18%), Postives = 32/51 (62.75%), Query Frame = 1
Query:  337 LSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRR 489
             S   V+ LE ++    +++ K R EIAE LN+  ++V+ WFQNRR K +R
Sbjct:    8 FSADQVNQLERVFAAQQYVSAKERAEIAETLNMTDDQVKIWFQNRRMKRKR 58          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Nematostella
Match: EDO42196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S291])

HSP 1 Score: 44.2838 bits (103), Expect = 2.168e-6
Identity = 23/48 (47.92%), Postives = 31/48 (64.58%), Query Frame = 1
Query:  361 LENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQ 504
            LE  +  + +I R RR E+A  LNL   +V+ WFQNRR KD+RL + Q
Sbjct:   24 LELEFHQNEYITRSRRFELAACLNLTETQVKIWFQNRRAKDKRLEKAQ 71          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Nematostella
Match: EDO38249 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDF2])

HSP 1 Score: 43.1282 bits (100), Expect = 3.711e-6
Identity = 21/51 (41.18%), Postives = 31/51 (60.78%), Query Frame = 1
Query:  337 LSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRR 489
             S   V  LE ++    +++ K R EIAE LN+  ++V+ WFQNRR K +R
Sbjct:    7 FSADQVSQLERVFAARQYVSAKERAEIAETLNMTDDQVKIWFQNRRVKRKR 57          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Medaka
Match: hoxd12a (homeobox D12 [Source:NCBI gene;Acc:101162794])

HSP 1 Score: 50.0618 bits (118), Expect = 1.099e-6
Identity = 26/60 (43.33%), Postives = 43/60 (71.67%), Query Frame = 1
Query:  340 SKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQ-FSS 516
            SK  +  LEN +  + FINR++R+E++++L+L  ++V+ WFQNRR K +RL   +Q FS+
Sbjct:  195 SKPQLAELENEFLMNEFINRQKRKELSDKLDLSDQQVKIWFQNRRMKKKRLMMREQAFSA 254          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Medaka
Match: eve1 (homeobox protein XHOX-3 [Source:NCBI gene;Acc:101169040])

HSP 1 Score: 48.521 bits (114), Expect = 2.656e-6
Identity = 21/43 (48.84%), Postives = 29/43 (67.44%), Query Frame = 1
Query:  361 LENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRR 489
            LE  Y   ++++R RR E+A  LNLP   ++ WFQNRR KD+R
Sbjct:   51 LEQEYGRESYVSRPRRCELATALNLPETTIKVWFQNRRMKDKR 93          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Medaka
Match: hoxc12a (homeobox protein Hox-C12a [Source:NCBI gene;Acc:101173058])

HSP 1 Score: 48.521 bits (114), Expect = 3.555e-6
Identity = 24/56 (42.86%), Postives = 36/56 (64.29%), Query Frame = 1
Query:  340 SKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQ 507
            SK  +  LE  +  + FI R+RR E+++ LNL  ++V+ WFQNRR K +RL   +Q
Sbjct:  212 SKLQLAELEGEFMLNEFITRQRRRELSDRLNLSDQQVKIWFQNRRMKKKRLMLREQ 267          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Medaka
Match: lhx1a (LIM homeobox 1 [Source:NCBI gene;Acc:100049230])

HSP 1 Score: 48.9062 bits (115), Expect = 4.663e-6
Identity = 35/134 (26.12%), Postives = 59/134 (44.03%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRK--YIRSGKYARKI-----------NGCDDYYYYDQRPSDY------------GLVEHVNAIPVNMPIIPESYMPVTP 678
            ++ L+  +  +    R  RE++A+E  L +  ++ WFQNRR K+RR+ Q+    +R+  + RS +  R +           NG   + YY    S+Y            G        PV++P +P S    TP
Sbjct:  193 LETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRTLVDRLEPGELIPNG--PFSYYGDYQSEYYGPGGNYDFFPQGPPSSQAQTPVDLPFVPSSGPTGTP 324          
BLAST of Homeobox protein Hox-D12 vs. Ensembl Medaka
Match: lhx1b (LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:101155626])

HSP 1 Score: 48.521 bits (114), Expect = 5.487e-6
Identity = 36/152 (23.68%), Postives = 65/152 (42.76%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRKYI--RSGKYARKI------NGCDDYYYYDQRPSDY----GLVEHVNAIPVNMPIIPE--SYMPVTPEKLDPVNVTF----VDNSPPASGTMPYWP 753
            ++ L+  +  +    R  RE+++ E  L +  ++ WFQNRR K+RR+ Q+   S+R+++  RS +  R +           + YY   P +Y    G  E+    P +    P    ++P T     P+  T          P +G    +P
Sbjct:  189 LETLKAAFAATPKPTRHIREQLSRETGLNMRVIQVWFQNRRSKERRMKQLSALSARRHVFFRSPRRMRAMGERLEPGELGHFSYYADYPGEYYGPGGNYEYFQGPPSSQAQTPADLGFVPSTVPAGTPLGGTMDHHHHHTGHPCAGEAQCFP 340          
BLAST of Homeobox protein Hox-D12 vs. Planmine SMEST
Match: SMESG000003389.1 (SMESG000003389.1)

HSP 1 Score: 527.324 bits (1357), Expect = 0.000e+0
Identity = 259/260 (99.62%), Postives = 259/260 (99.62%), Query Frame = 1
Query:  130 PIRLKSNKKASYASNNPVNNSDIDESVKNLIQMSKEQIAKEKELSTSTKDPKTETKLSFPNPIIGDTNRLSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRKYIRSGKYARKINGCDDYYYYDQRPSDYGLVEHVNAIPVNMPIIPESYMPVTPEKLDPVNVTFVDNSPPASGTMPYWPASNWNNEDVMDLNKDPTTNDPVENRSYLYSIMHDNYSNKSYTILRDSLEALI 909
            PIRLKSNKKASYASNNPVNNSDIDESVKNLIQMSKEQIAKEKELSTSTKDPKTETKLSFPNPIIGDTNRLSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRKYIRSGKYARKINGCDDYYYYDQRPSDYGLVEHVNAIPVNMPIIPESYMPVTPEKLDPVNVTFVDNSPPA GTMPYWPASNWNNEDVMDLNKDPTTNDPVENRSYLYSIMHDNYSNKSYTILRDSLEALI
Sbjct:   12 PIRLKSNKKASYASNNPVNNSDIDESVKNLIQMSKEQIAKEKELSTSTKDPKTETKLSFPNPIIGDTNRLSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRKYIRSGKYARKINGCDDYYYYDQRPSDYGLVEHVNAIPVNMPIIPESYMPVTPEKLDPVNVTFVDNSPPAPGTMPYWPASNWNNEDVMDLNKDPTTNDPVENRSYLYSIMHDNYSNKSYTILRDSLEALI 271          
BLAST of Homeobox protein Hox-D12 vs. Planmine SMEST
Match: SMESG000055068.1 (SMESG000055068.1)

HSP 1 Score: 45.8246 bits (107), Expect = 7.734e-6
Identity = 21/55 (38.18%), Postives = 36/55 (65.45%), Query Frame = 1
Query:  337 LSKHVVDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQV 501
             +K  + ILE  + T ++I  + R+ +A+ LNL   +++ WFQNRR K+++LN V
Sbjct:  103 FNKSQLQILEKYFYTCSYIIGEERKRLAKSLNLSENQIKIWFQNRRTKEKKLNAV 157          
BLAST of Homeobox protein Hox-D12 vs. Planmine SMEST
Match: SMESG000016568.1 (SMESG000016568.1)

HSP 1 Score: 47.7506 bits (112), Expect = 7.844e-6
Identity = 20/69 (28.99%), Postives = 40/69 (57.97%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRK-YIRSGKYARKI 555
            +D L+  +  +    R  RE++A++  L +  ++ WFQNRR K+RR+ Q+    +R+ + R+ +  R +
Sbjct:  413 LDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGARRPFFRNARRMRSL 481          
BLAST of Homeobox protein Hox-D12 vs. Planmine SMEST
Match: SMESG000043039.1 (SMESG000043039.1)

HSP 1 Score: 47.7506 bits (112), Expect = 7.983e-6
Identity = 20/69 (28.99%), Postives = 40/69 (57.97%), Query Frame = 1
Query:  352 VDILENIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSSRK-YIRSGKYARKI 555
            +D L+  +  +    R  RE++A++  L +  ++ WFQNRR K+RR+ Q+    +R+ + R+ +  R +
Sbjct:  413 LDTLKAAFSATPKPTRHVREQLAQDTGLTMRVIQVWFQNRRSKERRMKQLSAMGARRPFFRNARRMRSL 481          
The following BLAST results are available for this feature:
BLAST of Homeobox protein Hox-D12 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HOXD122.759e-643.14homeobox D12 [Source:HGNC Symbol;Acc:HGNC:5135][more]
LHX53.070e-630.56LIM homeobox 5 [Source:HGNC Symbol;Acc:HGNC:14216][more]
HESX17.323e-632.76HESX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:4877][more]
HESX17.323e-632.76HESX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:4877][more]
HOXC129.240e-645.10homeobox C12 [Source:HGNC Symbol;Acc:HGNC:5124][more]
back to top
BLAST of Homeobox protein Hox-D12 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
vab-73.818e-743.14Homeobox protein vab-7 [Source:UniProtKB/Swiss-Pr... [more]
ceh-143.363e-635.11Homeobox protein ceh-14 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of Homeobox protein Hox-D12 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lim11.738e-626.05gene:FBgn0026411 transcript:FBtr0331732[more]
eve1.829e-646.51gene:FBgn0000606 transcript:FBtr0088390[more]
ro3.056e-643.75gene:FBgn0003267 transcript:FBtr0085091[more]
ro3.056e-643.75gene:FBgn0003267 transcript:FBtr0085090[more]
cad3.933e-645.65gene:FBgn0000251 transcript:FBtr0335152[more]
back to top
BLAST of Homeobox protein Hox-D12 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cdx1a6.205e-747.37caudal type homeobox 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
hesx11.564e-636.07HESX homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-990415-1... [more]
eve12.434e-648.84even-skipped-like1 [Source:ZFIN;Acc:ZDB-GENE-98052... [more]
eve12.458e-648.84even-skipped-like1 [Source:ZFIN;Acc:ZDB-GENE-98052... [more]
hoxd12a2.953e-647.73homeobox D12a [Source:NCBI gene;Acc:100006598][more]
back to top
BLAST of Homeobox protein Hox-D12 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
klf21.628e-625.73Kruppel-like factor 2 [Source:Xenbase;Acc:XB-GENE-... [more]
ENSXETT00000008643.11.784e-640.00mix-like endodermal regulator [Source:NCBI gene;Ac... [more]
limd22.217e-643.48LIM domain containing 2 [Source:Xenbase;Acc:XB-GEN... [more]
limd23.108e-633.80LIM domain containing 2 [Source:Xenbase;Acc:XB-GEN... [more]
gfm26.384e-625.71G elongation factor, mitochondrial 2 [Source:Xenba... [more]
back to top
BLAST of Homeobox protein Hox-D12 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hoxd122.473e-742.86homeobox D12 [Source:MGI Symbol;Acc:MGI:96204][more]
Lhx54.291e-730.53LIM homeobox protein 5 [Source:MGI Symbol;Acc:MGI:... [more]
Hesx14.323e-634.48homeobox gene expressed in ES cells [Source:MGI Sy... [more]
Hesx14.323e-634.48homeobox gene expressed in ES cells [Source:MGI Sy... [more]
Lhx15.365e-625.37LIM homeobox protein 1 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of Homeobox protein Hox-D12 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P23812|HXD12_MOUSE1.730e-642.86Homeobox protein Hox-D12 OS=Mus musculus OX=10090 ... [more]
sp|Q9IA16|HXD12_HETFR2.171e-645.10Homeobox protein Hox-D12 OS=Heterodontus francisci... [more]
sp|P61376|LHX5_RAT3.001e-630.53LIM/homeobox protein Lhx5 OS=Rattus norvegicus OX=... [more]
sp|P61375|LHX5_MOUSE3.001e-630.53LIM/homeobox protein Lhx5 OS=Mus musculus OX=10090... [more]
sp|P21711|MIX1_XENLA3.533e-630.86Homeobox protein Mix.1 OS=Xenopus laevis OX=8355 G... [more]
back to top
BLAST of Homeobox protein Hox-D12 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158RBF91.062e-741.11Homeobox domain-containing protein OS=Thelazia cal... [more]
A0A151P5M47.016e-735.29Homeobox protein XHOX-3-like OS=Alligator mississi... [more]
A0A1I8CDY28.812e-740.70Homeobox domain-containing protein OS=Rhabditophan... [more]
A0A1U7RNT21.016e-635.29homeobox protein XHOX-3-like OS=Alligator sinensis... [more]
A0A158R5171.478e-640.00Homeobox domain-containing protein OS=Syphacia mur... [more]
back to top
BLAST of Homeobox protein Hox-D12 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HESX16.571e-838.71HESX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:4877][more]
hoxd12a3.279e-750.00homeobox protein Hox-D12a-like [Source:NCBI gene;A... [more]
eve11.002e-648.84homeobox even-skipped homolog protein 1-like [Sour... [more]
eve11.044e-648.84homeobox even-skipped homolog protein 1-like [Sour... [more]
lhx51.462e-625.49LIM/homeobox protein Lhx5 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Homeobox protein Hox-D12 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000009847.13.674e-631.08pep scaffold:Pmarinus_7.0:GL481168:3356:14379:1 ge... [more]
back to top
BLAST of Homeobox protein Hox-D12 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Homeobox protein Hox-D12 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
OTXC7.717e-735.38OtxC; Predicted protein [Source:UniProtKB/TrEMBL;... [more]
MOXB8.982e-744.23MoxB; Predicted protein [Source:UniProtKB/TrEMBL;... [more]
EDO382171.466e-641.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421962.168e-647.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO382493.711e-641.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox protein Hox-D12 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxd12a1.099e-643.33homeobox D12 [Source:NCBI gene;Acc:101162794][more]
eve12.656e-648.84homeobox protein XHOX-3 [Source:NCBI gene;Acc:1011... [more]
hoxc12a3.555e-642.86homeobox protein Hox-C12a [Source:NCBI gene;Acc:10... [more]
lhx1a4.663e-626.12LIM homeobox 1 [Source:NCBI gene;Acc:100049230][more]
lhx1b5.487e-623.68LIM/homeobox protein Lhx1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Homeobox protein Hox-D12 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000003389.10.000e+099.62SMESG000003389.1[more]
SMESG000055068.17.734e-638.18SMESG000055068.1[more]
SMESG000016568.17.844e-628.99SMESG000016568.1[more]
SMESG000043039.17.983e-628.99SMESG000043039.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031425 ID=SMED30031425|Name=Homeobox protein Hox-D12|organism=Schmidtea mediterranea sexual|type=transcript|length=1004bp
GAATATTTAAATATTCAATATTTCCAATTATACTGATATCTCCATTTTAT
TAATTTTAATTAAATAATGAATTATATTTATGCAGATAATTATTATATGT
ATCCAGATTATTATGTTGGATATTACGACCCCATTCGATTAAAATCAAAC
AAAAAAGCCAGTTATGCCTCAAATAATCCGGTCAACAATAGCGACATTGA
TGAATCTGTCAAAAATTTGATACAGATGTCCAAAGAACAAATAGCAAAAG
AAAAAGAACTTTCCACATCAACGAAAGACCCAAAGACTGAAACTAAACTA
AGCTTTCCGAATCCAATTATTGGAGATACAAATCGGCTTTCGAAACATGT
TGTAGATATTTTGGAAAACATTTATCAAACTTCTACGTTTATAAATCGAA
AACGACGTGAAGAAATTGCTGAAGAATTAAATTTACCAATTGAAAAGGTT
CGGAATTGGTTTCAGAATCGTCGAGGAAAAGACAGGCGATTGAATCAAGT
TCAACAATTTTCAAGCAGAAAATACATTCGGTCAGGTAAGTATGCTAGAA
AGATAAACGGTTGCGATGATTATTATTACTATGATCAACGGCCATCAGAT
TATGGGCTAGTCGAGCATGTCAACGCGATTCCCGTAAATATGCCGATTAT
TCCGGAAAGTTATATGCCAGTAACTCCTGAAAAATTGGATCCAGTCAATG
TCACTTTCGTTGATAATTCACCACCCGCTTCTGGTACAATGCCTTATTGG
CCAGCATCTAACTGGAACAACGAGGATGTCATGGATTTAAACAAAGATCC
AACCACAAATGATCCAGTCGAAAACAGAAGCTACTTGTACTCAATCATGC
ATGACAATTATTCAAATAAATCCTATACAATATTAAGGGACAGCTTGGAA
GCTTTAATTTGATGTTAGATGTATATGAAAATAGTTGGTGTTTATGTTTA
TTAAATTATTATTAAAATTTATAATCAAATTATAGTTTCTTTTAACAAAA
AAAA
back to top

protein sequence of SMED30031425-orf-1

>SMED30031425-orf-1 ID=SMED30031425-orf-1|Name=SMED30031425-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=282bp
MNYIYADNYYMYPDYYVGYYDPIRLKSNKKASYASNNPVNNSDIDESVKN
LIQMSKEQIAKEKELSTSTKDPKTETKLSFPNPIIGDTNRLSKHVVDILE
NIYQTSTFINRKRREEIAEELNLPIEKVRNWFQNRRGKDRRLNQVQQFSS
RKYIRSGKYARKINGCDDYYYYDQRPSDYGLVEHVNAIPVNMPIIPESYM
PVTPEKLDPVNVTFVDNSPPASGTMPYWPASNWNNEDVMDLNKDPTTNDP
VENRSYLYSIMHDNYSNKSYTILRDSLEALI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000036eye
PLANA:0000208testis
PLANA:0000218male primordial germ cell
PLANA:0002030early male germ cell
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
GO:0000978RNA polymerase II core promoter proximal region sequence-specific DNA binding
GO:0001078transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding
GO:0003682chromatin binding
GO:0005515protein binding
GO:0008022protein C-terminus binding
GO:0008134transcription factor binding
GO:0047485protein N-terminus binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0006351transcription, DNA-templated
GO:0007275multicellular organism development
GO:0007420brain development
GO:0030916otic vesicle formation
GO:0043584nose development
GO:0045892negative regulation of transcription, DNA-templated
GO:0048853forebrain morphogenesis
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 83..146
e-value: 2.6E-14
score: 63.5
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 91..141
e-value: 1.7E-13
score: 50.2
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 90..142
score: 14.544
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 90..141
e-value: 1.04643E-15
score: 68.0388
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 89..142
e-value: 9.0E-15
score: 56.2
NoneNo IPR availablePANTHERPTHR24332FAMILY NOT NAMEDcoord: 90..144
NoneNo IPR availablePANTHERPTHR24332:SF9HOMEOTIC PROTEIN CAUDALcoord: 90..144
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 117..140
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 90..148