TTF-type domain-containing protein

Overview
NameTTF-type domain-containing protein
Smed IDSMED30031395
Length (bp)2795
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TTF-type domain-containing protein (SMED30031395) t-SNE clustered cells

Violin plots show distribution of expression levels for TTF-type domain-containing protein (SMED30031395) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TTF-type domain-containing protein (SMED30031395) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TTF-type domain-containing protein (SMED30031395) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031395

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30031395SMESG000065691.1 SmedASXL_008812SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30031395SMESG000065691.1 dd_Smed_v4_8970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30031395SMESG000065691.1 dd_Smed_v4_8970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30031395SMESG000065691.1 dd_Smed_v4_8970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30031395SMESG000065691.1 dd_Smed_v4_8970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031395SMESG000065691.1 dd_Smed_v4_8970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 66.6254 bits (161), Expect = 1.079e-10
Identity = 91/453 (20.09%), Postives = 178/453 (39.29%), Query Frame = 1
Query:  574 PNDPYQLTQQKITAS--VISLQLKLGPMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSE--SWTKTGWDTWNNGSRDIKRHEESPQHRAAELAKVKAMSGFHSQHNSLFQVSANSEVIENRKMVKA--------VIDFIKLSASLQIEGEQL-----------SHSFTKIVQLVGQYDGSLGLAIDKLR----SMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVLSI--NVNDTLEEKIMRILRKVGLDPANMVTFCCHSPGSEIYLSQLGTVRGW-----PHNDDILAFLLEAGCAGCTRLSSC---------LGLVQQLTLFWSGSSSRDKYLCEFLERQPGCLTSTKLDEMLDLLVDRYA 1803
            P DP  +    I  S   + +  K+GP QP      +PK     S     F  +W+           RPWL YS   +  +C  C +F    K     +W   G +TW + +  +K H  +  H       + +M  ++       Q + ++  I+ + + +         +   I +S  L  +G+               +F ++V+ + QYD  + L +D ++    SM   +++ +S  +Q  +  ++   I  ++    K+ + ++++LD      +D     +++  VRY+      + +V +  L V ++       LE  ++ +L+  GLD  N+        G +   +  G  +G       HN+  L    +A C     + S            LV++L +F +GS+ R      FL+ Q       ++ E+  L   R+A
Sbjct:  160 PTDPAHMQTFNIDLSDRYVEMCEKVGPCQPV---MTFPKNAEGRS-----FQRSWY---------TDRPWLEYSPKNDAIYCFSCRIFLREEKFKNKTAWKTLGINTWRSATGKMKEHASTEAH-------MMSMVRWNIYSKKALQTAFDTSDIQGKAIRERERQRNREILTRLIDISLYLARQGQAFRGDDESSSSANQGNFIELVKTLAQYDSVMKLHLDAIQEKQASMKKPQVSLLSNRSQNDIIMSLGTFIRSKIQNEIKEAQIFSILLD----ETTDVSHKEQVSFVVRYV-----RDMEVKERFLQVCTLESTTGKELENVVISLLQDNGLDLKNI-----RGQGYDGAANMSGMYKGLQSRIRAHNEKALYVHCQAHCLNLVLVESAKSSIHFVTFFSLVEKLYVFCTGSTKRH---TAFLKCQQSLYPGQRVVELQKLSDTRWA 571          
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 6.344e-7
Identity = 67/325 (20.62%), Postives = 136/325 (41.85%), Query Frame = 1
Query:  811 CIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELAKVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIE--------GEQLSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDV------LSINVNDTLEEKIMRILRKVGLDPANMVTFCCHSPGSEIYLSQLGTVRGW-PHNDDILAFLLEAGCAGCTRLSSCLGLVQQLTLFWSGSSSRDKYLCEFLERQ 1740
            C Y +  G      E     G++ W N S  +  HEES  H+   L +++  +    + + LF    N E+   R ++K V+  +K  +S  +         G   + ++  +++ + ++D  L   I K  +      +++S +        ++ ++ E ++  AK+ + Y++ +D       D   + +LA  + Y+  D   + +  + + +V      L   V DTL+E  + IL   G    N         G +  + Q+  +  + P +   L  +  +    C    S   ++QQL  F+S SS+R + L   L+R+
Sbjct:   83 CTYLMYLGIGKLAHE-----GYNDWKNASVRLNEHEESKFHKDCYL-RMQNRAKISGRIDQLFLEKQNQEMEYWRNVLKRVVTAVKTLSSRGLPFRGTDEKFGSLTNGNYLMLLEAIAEHDPFLAEHIKKYGNTGTGSTSYLSKTVCFEFIDIVASSVLEVIINEAKQAKYYSISVD----STPDVSHTDQLAFIICYVKNDGIPKERFIKFIPNVGHKAENLFSAVMDTLKEYHIDILDCRGQSYDNASNMSGPYSGLQARIKQVNPLAVYIPCSAHSLNLVGTSAAESCREAVSFFCILQQLYHFFSASSTRWEMLISHLKRK 397          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Zmym5 (zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI:3041170])

HSP 1 Score: 52.373 bits (124), Expect = 2.762e-6
Identity = 25/72 (34.72%), Postives = 39/72 (54.17%), Query Frame = 1
Query:  718 FNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQH 933
            F+ T++ R L +G    RPWL YS   +  FC+YC LFG     ++   + G   W++ S  + +H+ES  H
Sbjct:  524 FSETYYTRILPNGEKGTRPWLLYSASKDSVFCLYCRLFGEGK--NQLRNENGCKDWHHLSHLLSKHDESEMH 593          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Zmym5 (zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI:3041170])

HSP 1 Score: 52.373 bits (124), Expect = 2.762e-6
Identity = 25/72 (34.72%), Postives = 39/72 (54.17%), Query Frame = 1
Query:  718 FNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQH 933
            F+ T++ R L +G    RPWL YS   +  FC+YC LFG     ++   + G   W++ S  + +H+ES  H
Sbjct:  524 FSETYYTRILPNGEKGTRPWLLYSASKDSVFCLYCRLFGEGK--NQLRNENGCKDWHHLSHLLSKHDESEMH 593          
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Match: Zmym5 (zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI:3041170])

HSP 1 Score: 52.373 bits (124), Expect = 2.762e-6
Identity = 25/72 (34.72%), Postives = 39/72 (54.17%), Query Frame = 1
Query:  718 FNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQH 933
            F+ T++ R L +G    RPWL YS   +  FC+YC LFG     ++   + G   W++ S  + +H+ES  H
Sbjct:  524 FSETYYTRILPNGEKGTRPWLLYSASKDSVFCLYCRLFGEGK--NQLRNENGCKDWHHLSHLLSKHDESEMH 593          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: J9LTH9 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 115.161 bits (287), Expect = 2.064e-22
Identity = 80/280 (28.57%), Postives = 144/280 (51.43%), Query Frame = 1
Query:  574 PNDPYQLTQQKITASVISLQLKLGPMQPSPAEY---QYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELAKVKAMSGFHSQHNSLFQV--SANSEVIENRKMVKAVIDFIKLSA--SLQIEG---EQLSH---SFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWV 1374
            PNDP  +      A ++ L  +LGP QP P+E    +YPKT    +  +  F+  ++ ++L D     R WLSYS  LNK FC+ C LFG            G + W+N  R+I +HE  P+H  +E++K    + + + H    ++    N +V+EN ++VK VID +  +A  ++ + G    +LS+   +F +++ L G+Y     L + K+ ++S   ++F+S  +Q +L   + E +  +++   K+ + + +I+D      + D SS    V+V
Sbjct:   15 PNDPAYIPDYVPHAQLL-LFTQLGPCQPLPSELIDNEYPKTTNTKTGKVRSFHNVYYYKQLKDQPPCKRSWLSYSPSLNKVFCVTCKLFGLPKAKKLLIASQGTNEWSNIKRNIDQHELLPEHLQSEMSK----ALYTNNHRIDLKMVHGTNKQVVENPEIVKVVIDALLYTARQNIALRGHNEHKLSNNRGNFLELINLTGKYHPVFNLHLQKINNVSKNRISFLSNVSQNKLLDIMKEYVRSKILEEVKQSQMFCIIIDT-----TTDLSSLEQVVFV 284          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: J9LJV2 (TTF-type domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 114.005 bits (284), Expect = 6.427e-22
Identity = 77/288 (26.74%), Postives = 145/288 (50.35%), Query Frame = 1
Query:  577 NDPYQLTQQK-ITASVISLQLKLGPMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSA--KVSESWTKTGWDTWNNGSRDIKRHEESPQHRAA----ELAKVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIEGEQ------LSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNAS 1401
            NDP  + + K +   +  L + +GP QP+  ++  P    P   +   F   W+ R L DG+   R WL+YS  L+K +C++C LFG +   K+++SWT+TG+ TW NG   I+ HE +P H  +    +L +  A      +H   FQV+ N +VI     +  ++ F+ L  +L   G +      +  +F  +V L+ +    L   I K++++   +++F+S   Q +L  AI+E I+ +++   +  R +++ +D       D+    +++  +RY+   N +
Sbjct:  149 NDPGIIVKMKNVGPEMKKLIINIGPCQPTKDDF--PAKTFPIDKNGRSFKDLWYFRLLTDGTKVLRDWLTYSVSLDKVYCLHCFLFGINLHDKLAKSWTQTGFSTWKNGIFAIQNHECAPDHILSSLKFKLRETNAPILPALEHTRKFQVTYNRQVILE---LIEIVHFLALH-NLAFRGHREQWTNTIRGNFKDLVILMAKNSTVLFEHISKIKNVGKHQISFLSWQRQNQLLEAIAENISTKIIYEVQTTRIFSISID----STFDESKREQVSFVIRYIDEANGA 426          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: J9KTC6 (TTF-type domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 113.62 bits (283), Expect = 8.987e-22
Identity = 96/339 (28.32%), Postives = 157/339 (46.31%), Query Frame = 1
Query:  421 SSQVSGENVSNSKNETMFSEISKIEMNSSTNNIVKSLLGQPLKSELLHHVEPNDPYQLTQQKITASVISLQLKLGPMQPSPAEYQYPKTHRPTSDSLLC--FNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFG--NSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELAKVKAMSGFHSQHNSL-----FQVSANSEVIENRKMVKAVIDFI------KLSASLQIEG--EQLSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLT 1386
            S+Q S  ++S   NE     + ++ +++S +N++ S +        L     NDP      K+T   I+L ++LGP QP   +   P+ H P   +     FN  W+ R L DGS   R WLSYS  L+  FC+ C+LF   N  K   +WTK G+ TW NG ++I  HE S  H       V A     ++ NS+      + S  + V  NR++V  +ID         LS     EG  E+   +F  I+ L+     +L   I+ ++S      +F+S   Q +L ++ISE I   +    K+ R +++ +D       D     +++  +RY++
Sbjct:  243 STQASTHDISPGINE-----VDQVSVDNSFDNVLSSSVSAETSPGNLF---KNDPVHFINSKLTPEEINLIIQLGPCQPCSDDL--PQKHFPFDKTSRHGHFNEQWYSRLLPDGSRVIRDWLSYSPTLDTVFCLPCMLFTGHNKHKAVTTWTKVGYSTWQNGRQNIMLHEISNIH-------VNASITLKTKKNSMPIIPALESSRKTNVALNRQIVFELIDITLYLARHNLSFRGHREGWEEKNKGNFKDILLLMAPNSYALSSHINSIKSQGKHVCSFISWERQNQLISSISEFIGSTIRSDIKRSRMFSISID----STFDAARKEQVSFIIRYVS 560          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: J9KHG4 (TTF-type domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 111.309 bits (277), Expect = 1.443e-21
Identity = 90/307 (29.32%), Postives = 138/307 (44.95%), Query Frame = 1
Query:  568 VEPNDPYQLTQQK-ITASVISLQLKLGPMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFG-NSAKVS-ESWTKTGWDTWNNGSRDIKRHEESPQHRAAELAKVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSA----SLQIEGEQLSH-----SFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVLSINVN 1452
            ++ NDP    +   IT    +  LKLGP QP P     P    P  ++   F+  W+ R L+DGS   R WLSYS   NK FC++C+L+G N+  VS +SWT  G+ TW NG   I +HE S +H                       V+A  ++  NR+++  +ID I   A    S +   EQ S+     +F  ++ L+ +   SL   I KL+S   QEL+F+S   Q +L   I++ I+                   IQ + +D   SH+     R  T   +S +    ++L +    +N
Sbjct:   38 IKNNDPIHFARMNHITPEQKNFILKLGPCQPLPE--HVPGKSFPIDNNGRHFSHLWYNRFLSDGSKVLRDWLSYSISENKIFCLHCMLYGVNTHSVSAKSWTNIGFSTWINGVNRINKHELSSEH-----------------------VTATIKIATNRQIISELIDIILFLARHNLSFRGHNEQWSNPLSRENFKDLIILMSKNSVSLSEHITKLKSRGRQELSFISWERQNQLIECIAKDIS-----------------TTIQYQTTDYSKSHQPLALKRVCTKRWSSHSAALDTVLKMYKCIIN 302          
BLAST of TTF-type domain-containing protein vs. TrEMBL
Match: J9LKH0 (HTH CENPB-type domain-containing protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=2)

HSP 1 Score: 112.849 bits (281), Expect = 1.813e-21
Identity = 95/337 (28.19%), Postives = 165/337 (48.96%), Query Frame = 1
Query:  490 IEMNSSTNNIVKSLLGQPLKSELLHHVEPNDPYQLTQQKI-TASVISLQLKLGPMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELAKVK-------AMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIEGE----QLSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVL-------LAKKRRSYTL--ILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVL 1437
            ++ + S   IV S++   L  E  + +  NDP +  + K  T  + ++ LKLGP QP+  EY+      P + S   F+ +W+ RKL D +   R WL+YS  L+K  C+YCIL+   AK +++W K G++ W NG   I +HE    H  A L K+K        +     +H+   QVS N +V+  +++++  I   K + S +   E    +L  +F  I+ L+ Q+  +L + I  L+S + +E +F+S   Q  L  +++E +   + L       +A  R   TL   +D+I+   +  +S   LA   +    D      + +S +D+L
Sbjct:   82 VQPDISNTEIVTSMVQNKLFEE--NTMFENDPVRFIKIKSWTHELRNMVLKLGPCQPN--EYELENKSFPKNTSNRSFHSSWYSRKLIDNTYVNREWLTYSPKLDKICCLYCILY--CAKSNDAWIKNGFNYWKNGLMSIVKHEVCETHIMASL-KIKISINCLPILPSLTEEHHR--QVSFNRDVV--KQLIEITIFLAKHNLSFRGHNECWKNELKGNFKDILVLLAQHSPTLSVHISNLKSNARKEYSFISWERQNLLIESVAEYVLISIALSVSIVFTMAPVRSRLTLKNKIDIIKCYDAKKQSVRELATQFKV---DKTQIGTILKSRVDLL 404          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000042930.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:25471427:25473738:-1 gene:ENSAMXG00000037442.1 transcript:ENSAMXT00000042930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 5.709e-8
Identity = 98/387 (25.32%), Postives = 157/387 (40.57%), Query Frame = 1
Query:  856 SWTKTGWDTWNNGSRDIKRHEESPQHRAAELA------KVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIE--GEQLSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLA-VWVRYLTGDNASETKVTQSLLDVLSIN--VNDTLEEKIMRILRKVGLDPANMVTFCCHSPGSEIYLSQLGTVRG-----------------WPHNDDILAFLLEAGCAGCTRLSSCLGLVQQLTLFWSGSSSRDKYLCEFLERQPGCLTSTKLDEMLDLLVDRYAEVIDALAELRATTSLSPLEVWTADSLWRSLKAPETEEGIQLLR 1932
            SWT  G + W   S  IK+HE S  H AA +        +   +   S++ S  QV   ++V+     V   +    L+     E  GE  S +F  ++ L+ +YD  L   +DK        +N++S S Q  L   +S+ + + +V   K+   Y++I+D  Q     D+ S     V VR    DNA    + +S L   +I+      LE KI  +++  GL     +   C   G +   +  G   G                   HN   L  +L   C   T +     ++Q+L +F+S S  R + L   L+ +P          +  L   R+A   DAL  LR   +   L+  T  +L RS K+ E  E + LL+
Sbjct:   17 SWT-VGINDWRGLSAKIKKHESSRAHLAACVVFDTWKNDLTVDAQLDSEYKS--QVRFWTDVLMRITDVTLTLASCNLAFRGHREKVGELNSGNFLSVIDLLARYDPVLRELLDK-----KSNVNYLSPSIQNELIALLSQRVHDEIVSEIKEAEFYSVIMDTTQDLSKVDQLSQVFRYVTVRKDEADNAIAVDINESFLGFQNISDQTAQGLETKITELIQSNGL-----LLHKCRGQGYDGASTMSGIYSGVQKRILDKEPNAVYVHCAAHN---LNLVLNDACQHITEIKEYYDILQRLYVFFSQSIKRWELLENHLKSKPT---------LKRLCPTRWASRRDALYALRFRYA-DILQALTKITL-RSKKSDERTEAMGLLK 376          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000037907.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02002089.1:152797:155023:-1 gene:ENSAMXG00000037599.1 transcript:ENSAMXT00000037907.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 5.967e-8
Identity = 87/421 (20.67%), Postives = 182/421 (43.23%), Query Frame = 1
Query:  634 LKLGPMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRA-----AELA-KVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIEGEQL----SHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQEL--NFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVLSINVNDT----LEEKIMRILRKVGLDPANMVTFC---CHSPGSEIYLSQLGTVRGWPHNDDILAFLLEAGCAGCTRLSSCLGLVQQLTLFWSGSSSRDKYLCEFLERQPGCLTSTKLD---EMLDLLVDRYAEVIDALAEL 1830
            +K GP+Q    E+ +P+ +          N   +  K+ +G      WL YS   +  FC  C +F   +K + S   +G+ +W N    ++ HE+S  H A      ELA ++K  +   S    L  +         R+++  V +  + + +L+   E+L    + +F   ++L+ Q+D  +    + LR +  +E+  +++S + Q  L + + +   + +V   K  + +++I+D       D   + ++++ +R +  ++ S   +++  +   S  V DT    L   + + L+ + L+ A+    C    +  GS +   + G  +          F     C  C       G++Q+L   +S S  R   L   ++     L++T+ +   E +  L  +Y E+I+AL+ L
Sbjct:   30 IKRGPVQIK--EFDFPQNNDKIPRQFTVDN---YHMKMNNGEKINWNWLVYSLSSDSVFCFCCTVFERESKFALS--SSGFRSWINIHSHLRDHEKSKIHCANMQNLRELAERLKTGTAIDSACQELRALEVQHWKAVLRRILAIVCNLAERNQALRGHSEKLFEPHNGNFLGQIELMAQFDPVMS---EHLRRIDKKEIKDHYLSKTIQNELISLVGQKTKDAIVQKVKDAKYFSVIMDCT----PDTSHNEQMSLVLRIVNCESCSGASISEHFVGFFS--VQDTSGRGLCNTLTKELKNMKLNIAD----CRGQSYDNGSNMMGHKQGVQKSAGDKPKGTVFF----CVVCDLF---FGILQRLYNLFSSSVHRWSILQRHVKLTVKNLSTTRWECRIESVKALRHQYPEMIEALSAL 423          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000044961.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000032.1:419978:423709:1 gene:ENSAMXG00000036481.1 transcript:ENSAMXT00000044961.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.6842 bits (130), Expect = 3.998e-7
Identity = 50/237 (21.10%), Postives = 105/237 (44.30%), Query Frame = 1
Query:  718 FNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQH-----RAAELA-KVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIEGEQL----SHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQE--LNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGD 1392
            F    + R + +G    R WL YS   +  FC  C +FG   K   + +K  +  W N +  +K HE S  H        EL  +++  +    +  +L Q+         R+++  +    + + +L+    +L    + +F   V+L+ ++D  +    + +R + +QE  ++++S + Q  +   I   + E +V  A++ + Y++I+D       D     +L+V +R +  D
Sbjct:  107 FTKENYRRTMKNGEKILRSWLVYSMSTDSVFCFPCTVFG---KRDNALSKLWFHKWKNLTYHLKEHEYSKGHCDNMRNWHELQRRLQNKTTIDQRQQALMQIEIEHWKAVIRRVIAIICHLAERNQALRGTTSELYDPHNGNFLAQVELMAKFDPVMN---EHIRRIQNQEAKVHYLSGTIQNEIIALIGNKVLEEIVRRAQRAKYYSVIMDCT----PDISHKEQLSVVLRLVNCD 333          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000035531.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6285841:6288423:1 gene:ENSAMXG00000041958.1 transcript:ENSAMXT00000035531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 7.008e-7
Identity = 69/318 (21.70%), Postives = 127/318 (39.94%), Query Frame = 1
Query:  577 NDPYQLTQQKITASVISLQLKLG--PMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELAKVKAMSGFHSQHNSLF-QVSANSEVIEN-RKMVKAVIDFIKLSASLQIEGEQLSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVLSI--NVNDTLEEKIMRILRKVGLDPAN 1512
            NDP  L    IT    S+ +  G    Q   A+Y      R    +   F        L +G +  R WL YS      +C  C LF +      +    G+  W +  R I  HE S +HRA  LA      G  +  + +  Q+ A  +   +  K V AVI F+      ++ G   + +F  I++L+ ++D  L   + +        ++++S +        + +   + +V   K+ + +++I+D        D+ +       R++  D      V +  L    I  +  D+L E ++ ++  +GLD +N
Sbjct:  139 NDP-ALWPSTITDQARSILVSRGETAFQNRSAKYPASVRDRGIGGTSRSFTNALLSCSLPNGQTVTRQWLLYSPSTGCVYCFACKLFSS----KHNTFVHGFSDWKHSER-IGEHEGSVEHRACMLALYNRSRGTATIDSDIVKQIDAERQYWRDVLKRVVAVIQFLGERGLDELLGSAHNGNFLGIIELLSKFDPFLAEHLQRFGGKGKGSVSYLSSTVCEEFIHLMGQRTKQAIVNKIKESKYFSVIVDSTPDLAHVDQPT----FIFRFVNND----AHVVERFLAFEPIENHSGDSLAECVVAMVENLGLDLSN 442          
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000035789.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000101.1:2843018:2852765:1 gene:ENSAMXG00000037827.1 transcript:ENSAMXT00000035789.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 7.805e-7
Identity = 73/289 (25.26%), Postives = 122/289 (42.21%), Query Frame = 1
Query: 1054 IDFIKLSASLQIE----GEQLSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRL-AVWVRYLTGDNASETKVTQSLLDVLSIN--VNDTLEEKIMRILRKVGLDPANMVTFCCHSPGSEIYLSQLGTVRG-----------------WPHNDDILAFLLEAGCAGCTRLSSCLGLVQQLTLFWSGSSSRDKYLCEFLERQPG----CLT--STKLDEMLDLLVDRYAEVIDALAEL 1830
            IDF  +  S Q      GE  S +F  ++ L+ +YD  L   +DK        +N++S S Q  L   +S+ + + +V   K+   Y++I+D  Q     D+ S     V VR    DNA    + +S L   +I+      LE KI  +++  GL P +     C   G +   +  G   G                   HN   L  +L   C   T +     ++Q+L +F+S S  R + L   L+ +P     C T  +++ D +  L   RYA+++ AL ++
Sbjct:   42 IDFGFMQPSFQGHREKVGELNSGNFLSVIDLLARYDPVLRELLDK-----KSNVNYLSPSIQNELIALLSQRVHDEIVSEIKEAEFYSVIMDTTQDLSKVDQLSQVFRYVTVRKDEADNAIAVDINESFLGFQNISDQTAQGLETKITELIQSKGL-PLHK----CRGQGYDGASTMSGIYSGVQKRILDKEPNAVYVHCAAHN---LNLVLNDACQHITEIKEYYDILQRLYVFFSQSIKRWELLENHLKSKPTLKRLCPTRWASRRDALYALRF-RYADILQALTKI 316          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 61.6178 bits (148), Expect = 3.710e-9
Identity = 61/256 (23.83%), Postives = 113/256 (44.14%), Query Frame = 1
Query:  661 PAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELA------KVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSA----SLQIEGEQLSHS----FTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLT 1386
            P ++ +P   R  SD   C +  +F + L  G    R WL YSK  N  FC  C LF N    + + T +G   W + S  +  HE+SP+H     A      ++++      Q  +L +     E +  R ++  +I  ++  A    +L+   E L  S    F K V+L+ ++D  +   ++++   +    +++    Q  L   +S  I   +V   KK + +++ILD       D   + +L+V +R ++
Sbjct:  149 PPDFVFP---RNDSDGRSCHH-HYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLFSNK---NINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLE----EERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTL----DISHTEQLSVIIRVVS 389          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 61.6178 bits (148), Expect = 3.710e-9
Identity = 61/256 (23.83%), Postives = 113/256 (44.14%), Query Frame = 1
Query:  661 PAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELA------KVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSA----SLQIEGEQLSHS----FTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLT 1386
            P ++ +P   R  SD   C +  +F + L  G    R WL YSK  N  FC  C LF N    + + T +G   W + S  +  HE+SP+H     A      ++++      Q  +L +     E +  R ++  +I  ++  A    +L+   E L  S    F K V+L+ ++D  +   ++++   +    +++    Q  L   +S  I   +V   KK + +++ILD       D   + +L+V +R ++
Sbjct:  149 PPDFVFP---RNDSDGRSCHH-HYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLFSNK---NINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLE----EERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTL----DISHTEQLSVIIRVVS 389          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 61.6178 bits (148), Expect = 3.710e-9
Identity = 61/256 (23.83%), Postives = 113/256 (44.14%), Query Frame = 1
Query:  661 PAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELA------KVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSA----SLQIEGEQLSHS----FTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLT 1386
            P ++ +P   R  SD   C +  +F + L  G    R WL YSK  N  FC  C LF N    + + T +G   W + S  +  HE+SP+H     A      ++++      Q  +L +     E +  R ++  +I  ++  A    +L+   E L  S    F K V+L+ ++D  +   ++++   +    +++    Q  L   +S  I   +V   KK + +++ILD       D   + +L+V +R ++
Sbjct:  149 PPDFVFP---RNDSDGRSCHH-HYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLFSNK---NINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQEMALLE----EERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTL----DISHTEQLSVIIRVVS 389          
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027735.1 (pep primary_assembly:ASM223467v1:9:30712608:30715295:1 gene:ENSORLG00000030268.1 transcript:ENSORLT00000027735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 54.299 bits (129), Expect = 5.666e-7
Identity = 84/374 (22.46%), Postives = 154/374 (41.18%), Query Frame = 1
Query:  676 YPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWT-KTGWDTWNNGS-RD--IKRHEESPQHRAAELAKV---KAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQI--EGEQLSH-----SFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVLSINVNDTLEEKIMRILRKVGLDPANMVTFCCHSPGSEIYLSQLGTVRGWPHNDDILAFLLEAGCAGCTRL-----------SSC-LGLVQQLTLFWSGSSSRDKYL 1719
            +P+T++   D   CF+  W+             WL YS+  + AFC  C  FG  A      T + G+  W   + +D  +  H  S  H  A LA     K+ SG  S   SL     +  V ENR+ +K V + + L+A+  I   G + S      +F  I++L+ + +      I K +    +    +    Q  +   ++E +   +     +  ++++++D  +    D     +++  +RY    +  E  +       L+      L +KI+ IL+K GLD  N +    +  G+ +   +   V+    ++  LAF +    A C  L           ++C   L+Q+L +F SGS    ++L
Sbjct:  108 FPRTYQ--GDRRRCFSKDWY---------NAHKWLEYSQSKDSAFCYACRHFGLPASGESVLTSEEGFKNWKKATFKDGGLLGHARSEAHTTAMLAWAEYEKSTSGTASLSASL-DAEYSKLVKENREYIKVVGETLLLTATQNIAQRGHKESEVDSKGNFLAIMELLAKNN-----PIVKRKMAGQRNATCLGHDTQNEMIDCLAEMVRSSITGEVAESEAFSILVDETK----DMSKKEQMSFVIRYYYNGSVCECFLAFEAAQRLNAAA---LSQKIIEILQKHGLDYKNHLVGQAYD-GASVMSGKNTGVQARIKSEAPLAFYVHCN-AHCLNLVLVDSVKFIPEANCFFSLLQKLYVFVSGSYVHQRWL 455          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000065691.1 (SMESG000065691.1)

HSP 1 Score: 1835.46 bits (4753), Expect = 0.000e+0
Identity = 897/900 (99.67%), Postives = 899/900 (99.89%), Query Frame = 1
Query:   64 MSKTAMQRSYKFRCLDPLCSNITLIDSKWQQHLQKAHPQSDPNDVKYVKVEYRIGTNTPWQMMPLGTELWNNSFLVTNIDQSENGDHESNTNDESSPRNGQEGSYNRSVFLGDFNGDGESSQVSGENVSNSKNETMFSEISKIEMNSSTNNIVKSLLGQPLKSELLHHVEPNDPYQLTQQKITASVISLQLKLGPMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELAKVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIEGEQLSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVLSINVNDTLEEKIMRILRKVGLDPANMVTFCCHSPGSEIYLSQLGTVRGWPHNDDILAFLLEAGCAGCTRLSSCLGLVQQLTLFWSGSSSRDKYLCEFLERQPGCLTSTKLDEMLDLLVDRYAEVIDALAELRATTSLSPLEVWTADSLWRSLKAPETEEGIQLLRKAVGLLRPALSCQQLGKVHFLHQMRVRMQAETEQFETXXXXXXXXXXXXKVFRPDISNGRPCKSQEEYRLFMKNICRIISDSYSDVHLQLLSEIIHFSGSSLDDCSYNSSTINEQSISTVCQLAKVDPRSVLREMVDFQPIYKEHKAAVLDFASSTNSVVFPGYYTTNPKSTQTHLDPFLTPLKLVTEFTSFPSLLTVYKMLAVLPIFSKHHWQIQRHRVQNCLKSCQNLDDFNHCSLMLVSVEDQQDESVYLPVDMVIDKLAACSATLRKALSLPR 2763
            MSKTAMQRSYKFRCLDPLCSNITLIDSKWQQHLQKAHPQSDPNDVKYVKVEYRIGTNTPWQMMPLGTELWNNSFLVTNIDQSENGDHESNTNDESSPRNGQEGSYNRSVFLGDFNGDGESSQVSGENVSNSKNETMFSEISKIEMNSSTNNIVKSLLGQPLKSELLHHVEPNDPYQLTQQKITASVISLQLKLGPMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELAKVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIEGEQLSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVLSINVND LEEKIMRILRKVGLDPANMVTFCCHSPGSEIYLSQLGTVRGWPHNDDILAFLLEAGCAGCTRLSSCLGLVQQLTLFWSGSSSRDKYLCEFLERQPGCLTSTKLDEMLDLLVDRYAEVIDALAELRATTSLSPLEVWTADSLWRSLKAPETEEGIQLLRKAVGLLRPALSCQQLGKVHFLHQMRVRMQAETEQFETIIINPNNGSPPPK+FRPDISNGRPCKSQEEYRLFMKNICRIISDSYSDVHLQLLSEIIHFSGSSLDDCSYNSSTINEQSISTVCQLAKVDPRSVLREMVDFQPIYKEHKAAVLDFASSTNSVVFPGYYTTNPKSTQTHLDPFLTPLKLVTEFTSFPSLLTVYKMLAVLPIFSKHHWQIQRHRVQNCLKSCQNLDDFNHCSL+LVSVEDQQDESVYLPVDMVIDKLAACSATLRKALSLPR
Sbjct:    1 MSKTAMQRSYKFRCLDPLCSNITLIDSKWQQHLQKAHPQSDPNDVKYVKVEYRIGTNTPWQMMPLGTELWNNSFLVTNIDQSENGDHESNTNDESSPRNGQEGSYNRSVFLGDFNGDGESSQVSGENVSNSKNETMFSEISKIEMNSSTNNIVKSLLGQPLKSELLHHVEPNDPYQLTQQKITASVISLQLKLGPMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELAKVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIEGEQLSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVLSINVNDALEEKIMRILRKVGLDPANMVTFCCHSPGSEIYLSQLGTVRGWPHNDDILAFLLEAGCAGCTRLSSCLGLVQQLTLFWSGSSSRDKYLCEFLERQPGCLTSTKLDEMLDLLVDRYAEVIDALAELRATTSLSPLEVWTADSLWRSLKAPETEEGIQLLRKAVGLLRPALSCQQLGKVHFLHQMRVRMQAETEQFETIIINPNNGSPPPKIFRPDISNGRPCKSQEEYRLFMKNICRIISDSYSDVHLQLLSEIIHFSGSSLDDCSYNSSTINEQSISTVCQLAKVDPRSVLREMVDFQPIYKEHKAAVLDFASSTNSVVFPGYYTTNPKSTQTHLDPFLTPLKLVTEFTSFPSLLTVYKMLAVLPIFSKHHWQIQRHRVQNCLKSCQNLDDFNHCSLILVSVEDQQDESVYLPVDMVIDKLAACSATLRKALSLPR 900          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000065691.1 (SMESG000065691.1)

HSP 1 Score: 1570.83 bits (4066), Expect = 0.000e+0
Identity = 770/772 (99.74%), Postives = 771/772 (99.87%), Query Frame = 1
Query:   64 MSKTAMQRSYKFRCLDPLCSNITLIDSKWQQHLQKAHPQSDPNDVKYVKVEYRIGTNTPWQMMPLGTELWNNSFLVTNIDQSENGDHESNTNDESSPRNGQEGSYNRSVFLGDFNGDGESSQVSGENVSNSKNETMFSEISKIEMNSSTNNIVKSLLGQPLKSELLHHVEPNDPYQLTQQKITASVISLQLKLGPMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELAKVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIEGEQLSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVLSINVNDTLEEKIMRILRKVGLDPANMVTFCCHSPGSEIYLSQLGTVRGWPHNDDILAFLLEAGCAGCTRLSSCLGLVQQLTLFWSGSSSRDKYLCEFLERQPGCLTSTKLDEMLDLLVDRYAEVIDALAELRATTSLSPLEVWTADSLWRSLKAPETEEGIQLLRKAVGLLRPALSCQQLGKVHFLHQMRVRMQAETEQFETXXXXXXXXXXXXKVFRPDISNGRPCKSQEEYRLFMKNICRIISDSYSDVHLQLLSEIIHFSGSSLDDCSYNSSTINEQSISTVCQLAKVDPRSVLREMVDFQPIYKEHKAAV 2379
            MSKTAMQRSYKFRCLDPLCSNITLIDSKWQQHLQKAHPQSDPNDVKYVKVEYRIGTNTPWQMMPLGTELWNNSFLVTNIDQSENGDHESNTNDESSPRNGQEGSYNRSVFLGDFNGDGESSQVSGENVSNSKNETMFSEISKIEMNSSTNNIVKSLLGQPLKSELLHHVEPNDPYQLTQQKITASVISLQLKLGPMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELAKVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIEGEQLSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVLSINVND LEEKIMRILRKVGLDPANMVTFCCHSPGSEIYLSQLGTVRGWPHNDDILAFLLEAGCAGCTRLSSCLGLVQQLTLFWSGSSSRDKYLCEFLERQPGCLTSTKLDEMLDLLVDRYAEVIDALAELRATTSLSPLEVWTADSLWRSLKAPETEEGIQLLRKAVGLLRPALSCQQLGKVHFLHQMRVRMQAETEQFETIIINPNNGSPPPK+FRPDISNGRPCKSQEEYRLFMKNICRIISDSYSDVHLQLLSEIIHFSGSSLDDCSYNSSTINEQSISTVCQLAKVDPRSVLREMVDFQPIYKEHKAAV
Sbjct:    1 MSKTAMQRSYKFRCLDPLCSNITLIDSKWQQHLQKAHPQSDPNDVKYVKVEYRIGTNTPWQMMPLGTELWNNSFLVTNIDQSENGDHESNTNDESSPRNGQEGSYNRSVFLGDFNGDGESSQVSGENVSNSKNETMFSEISKIEMNSSTNNIVKSLLGQPLKSELLHHVEPNDPYQLTQQKITASVISLQLKLGPMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELAKVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIEGEQLSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVLSINVNDALEEKIMRILRKVGLDPANMVTFCCHSPGSEIYLSQLGTVRGWPHNDDILAFLLEAGCAGCTRLSSCLGLVQQLTLFWSGSSSRDKYLCEFLERQPGCLTSTKLDEMLDLLVDRYAEVIDALAELRATTSLSPLEVWTADSLWRSLKAPETEEGIQLLRKAVGLLRPALSCQQLGKVHFLHQMRVRMQAETEQFETIIINPNNGSPPPKIFRPDISNGRPCKSQEEYRLFMKNICRIISDSYSDVHLQLLSEIIHFSGSSLDDCSYNSSTINEQSISTVCQLAKVDPRSVLREMVDFQPIYKEHKAAV 772          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000070556.1 (SMESG000070556.1)

HSP 1 Score: 60.077 bits (144), Expect = 1.929e-9
Identity = 60/261 (22.99%), Postives = 112/261 (42.91%), Query Frame = 1
Query:  730 WFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTK--TGWDTWNNGSRDIKRHEESPQHRAA----ELAKVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIEGEQLSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASET-KVTQSLLDVLSINVND--TLEEKIMRIL 1485
            WF R+L +G    R W  YS   + A+C  C+LF  S     S      G++ W    + +  HE SP HRA+    + A+ + MSG             ++E+ E R   +          SL         +    ++L+ +YD  L   +D  R  + + ++++S   Q      ++  +  +L+   K+ + Y ++ D    +   ++SS      +RY+  D +++T  + +S L  + ++  D  TLE  I+  L
Sbjct:    5 WFTRRLVNGDEINRTWFLYSPLKSSAYCFCCLLFPKSINNQRSGLTLPDGFNKWRKPEK-MSAHENSPNHRASFTAWKEAERQIMSG----------KGIDAELQELRGHAE----------SLATNNGSNVGNVLATLKLLAEYDPLLSNHLDHAR-QNPESVSYLSPQTQNEFIILLASKVRNKLLNDIKRNKYYGMLFDSTHDQAHREQSSR----VIRYVDVDFSNKTVTIKKSFLGFIELHAKDVATLEHVIVDTL 239          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.357e-8
Identity = 66/309 (21.36%), Postives = 137/309 (44.34%), Query Frame = 1
Query:  568 VEPNDPYQLTQQKITASVISLQLKLGPMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQH--RAAELAKVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSAS--LQIEG------EQLSHSFTKIVQLVGQYDGSLGLAIDKLR---SMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVLSINVND 1455
            +E NDP       +T  V+ + ++ GP+Q   + Y       P ++    F+  +F RKL +G    R WL YS   +  FC  C LFG   K        G++ W + S ++ RHE++  H        K+K      +  +   Q   ++E     ++VK +I  ++  A   L   G      E+ + +F K ++++G++D ++   I +++   +  +   ++     Q  +   ++  I + ++   K+ + +++ILD     G  ++    + + +RY+   N       +  L+ L +N++D
Sbjct:  103 IELNDP-ACWPLALTDKVLDILIEKGPVQNIQSTY-------PLNEFGRSFSKVYFYRKLPNGEKFNREWLIYSPKNDATFCFCCKLFG---KQEIKLVNEGFNDWQHISDNLSRHEKTTLHIENCTCWKKLKLNLKRKTTIDKNMQRYYDAEKKRWCQIVKRMISVVQFLAGQCLAFRGSSGKLYEKNNGNFLKAIEMIGKFDDTMADHIKRVQEPNAPKNHMPHYQGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQ----ITMVIRYVYIKNY------EVELNYLELNISD 390          
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Match: SMESG000061124.1 (SMESG000061124.1)

HSP 1 Score: 59.3066 bits (142), Expect = 1.498e-8
Identity = 66/309 (21.36%), Postives = 137/309 (44.34%), Query Frame = 1
Query:  568 VEPNDPYQLTQQKITASVISLQLKLGPMQPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLNKAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQH--RAAELAKVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSAS--LQIEG------EQLSHSFTKIVQLVGQYDGSLGLAIDKLR---SMSDQELNFVSISNQRRLATAISETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNASETKVTQSLLDVLSINVND 1455
            +E NDP       +T  V+ + ++ GP+Q   + Y       P ++    F+  +F RKL +G    R WL YS   +  FC  C LFG   K        G++ W + S ++ RHE++  H        K+K      +  +   Q   ++E     ++VK +I  ++  A   L   G      E+ + +F K ++++G++D ++   I +++   +  +   ++     Q  +   ++  I + ++   K+ + +++ILD     G  ++    + + +RY+   N       +  L+ L +N++D
Sbjct:  103 IELNDP-ACWPLALTDKVLDILIEKGPVQNIQSTY-------PLNEFGRSFSKVYFYRKLPNGEKFNREWLIYSPKNDATFCFCCKLFG---KQEIKLVNEGFNDWQHISDNLSRHEKTTLHIENCTCWKKLKLNLKRKTTIDKNMQRYYDAEKKRWCQIVKRMISVVQFLAGQCLAFRGSSGKLYEKNNGNFLKAIEMIGKFDDTMADHIKRVQEPNAPKNHMPHYQGNRFQNEIIAILATQIQKYILTSIKEAKYFSVILDCTPDTGHVEQ----ITMVIRYVYIKNY------EVELNYLELNISD 390          
The following BLAST results are available for this feature:
BLAST of TTF-type domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CR762475.11.079e-1020.09pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSXETT00000043220.16.344e-720.62pep primary_assembly:Xenopus_tropicalis_v9.1:7:364... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Zmym52.762e-634.72zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI... [more]
Zmym52.762e-634.72zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI... [more]
Zmym52.762e-634.72zinc finger, MYM-type 5 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of TTF-type domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
J9LTH92.064e-2228.57Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
J9LJV26.427e-2226.74TTF-type domain-containing protein OS=Acyrthosipho... [more]
J9KTC68.987e-2228.32TTF-type domain-containing protein OS=Acyrthosipho... [more]
J9KHG41.443e-2129.32TTF-type domain-containing protein OS=Acyrthosipho... [more]
J9LKH01.813e-2128.19HTH CENPB-type domain-containing protein OS=Acyrth... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000042930.15.709e-825.32pep primary_assembly:Astyanax_mexicanus-2.0:12:254... [more]
ENSAMXT00000037907.15.967e-820.67pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000044961.13.998e-721.10pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000035531.17.008e-721.70pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000035789.17.805e-725.26pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TTF-type domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000028133.13.710e-923.83zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.13.710e-923.83zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.13.710e-923.83zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000027735.15.666e-722.46pep primary_assembly:ASM223467v1:9:30712608:307152... [more]
back to top
BLAST of TTF-type domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000065691.10.000e+099.67SMESG000065691.1[more]
SMESG000065691.10.000e+099.74SMESG000065691.1[more]
SMESG000070556.11.929e-922.99SMESG000070556.1[more]
SMESG000061124.11.357e-821.36SMESG000061124.1[more]
SMESG000061124.11.498e-821.36SMESG000061124.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031395 ID=SMED30031395|Name=TTF-type domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2795bp
CGATCTAATGACGATTGATATGCATATATTAATTATTAACAGTCTCACTT
GATGCTAGATCTTATGTCTAAAACTGCGATGCAGCGATCTTACAAATTCA
GATGCCTCGATCCGTTATGCTCGAACATAACTCTCATTGATTCCAAATGG
CAGCAGCATTTACAGAAAGCTCATCCGCAATCCGATCCGAATGATGTGAA
ATATGTGAAAGTTGAATATAGAATCGGAACTAACACGCCTTGGCAAATGA
TGCCTTTGGGTACCGAATTGTGGAATAATAGTTTTCTAGTGACGAATATC
GACCAGTCGGAAAACGGAGATCACGAAAGCAACACGAATGATGAATCCTC
TCCGAGAAATGGTCAAGAGGGATCATATAATCGCAGCGTGTTTCTGGGAG
ACTTCAATGGCGACGGAGAAAGCTCCCAAGTGAGTGGTGAAAATGTTTCC
AACTCGAAAAATGAAACAATGTTTTCAGAAATATCCAAAATTGAAATGAA
CTCTTCCACTAATAATATTGTCAAATCCTTACTTGGGCAACCTTTAAAAT
CCGAATTATTACATCACGTAGAACCAAACGATCCATATCAACTAACTCAA
CAGAAAATCACAGCTTCTGTTATTAGTCTTCAGCTTAAACTTGGGCCAAT
GCAGCCCTCTCCAGCTGAATATCAATACCCAAAAACACATAGACCAACAA
GTGATAGTCTACTTTGTTTCAATCCGACATGGTTTGAGAGAAAATTGGCT
GATGGATCAAGCCAGCCTCGTCCATGGTTATCTTATAGTAAATGCCTTAA
CAAAGCATTCTGTATATATTGCATTTTATTCGGAAACAGCGCCAAAGTTT
CCGAGTCATGGACCAAAACTGGATGGGATACTTGGAACAATGGTAGTCGT
GACATTAAACGTCACGAAGAATCTCCTCAACACAGAGCGGCCGAATTGGC
CAAAGTGAAAGCCATGTCTGGATTTCATAGTCAACATAACAGTTTATTCC
AGGTCAGTGCAAATTCAGAGGTTATTGAAAATCGAAAAATGGTAAAAGCC
GTAATAGATTTTATAAAACTTTCCGCCAGTTTGCAAATAGAGGGTGAACA
GTTGTCGCATAGTTTTACGAAAATTGTTCAGTTAGTCGGTCAATATGATG
GCAGCCTTGGACTAGCAATAGATAAGCTGAGATCAATGTCTGATCAGGAA
CTTAATTTTGTATCGATTTCAAATCAGCGTCGATTGGCAACGGCGATTAG
TGAAACAATAGCCGAGAGATTAGTTTTACTTGCAAAAAAGCGACGCAGCT
ATACTCTAATATTAGATGTAATTCAATCACGAGGAAGCGATGACAAAAGC
AGCCACAGGCTAGCGGTTTGGGTTAGATACCTTACGGGAGATAATGCAAG
TGAAACAAAAGTTACTCAAAGTTTGTTAGACGTTTTATCAATAAATGTAA
ACGACACATTAGAAGAAAAAATAATGCGAATTTTACGTAAAGTCGGTCTT
GATCCGGCCAACATGGTTACATTTTGTTGTCATTCTCCAGGTTCTGAAAT
ATATCTCAGTCAACTGGGAACTGTTCGTGGTTGGCCTCATAATGATGATA
TCTTAGCTTTTTTGTTAGAAGCTGGATGTGCAGGGTGCACCCGTTTGAGT
TCTTGCCTCGGTCTTGTTCAACAACTTACTTTATTTTGGTCAGGTTCAAG
TTCACGGGATAAATATTTATGTGAATTTCTTGAAAGACAACCAGGCTGTT
TAACATCAACAAAATTAGATGAGATGTTGGATCTCCTTGTTGATAGATAT
GCGGAGGTGATTGATGCTTTAGCTGAGTTACGCGCAACCACGTCATTATC
ACCTCTTGAAGTTTGGACAGCAGACAGTTTGTGGAGGAGTTTAAAAGCTC
CTGAGACAGAAGAAGGAATACAATTGTTGAGAAAAGCTGTTGGGTTGTTG
AGACCAGCATTGTCTTGTCAGCAATTGGGAAAAGTGCATTTTTTACACCA
GATGCGAGTTCGAATGCAAGCAGAAACAGAACAATTTGAAACCATAATAA
TAAATCCGAACAACGGATCTCCTCCACCAAAAGTATTTCGTCCTGATATT
AGTAATGGAAGACCCTGTAAATCCCAAGAAGAATATCGCTTATTTATGAA
AAACATTTGTCGAATAATTTCTGACAGTTACTCAGACGTGCATTTACAAC
TCCTTTCGGAAATAATTCACTTTTCAGGGAGTAGTCTTGATGACTGTTCG
TATAATTCCTCGACCATAAATGAACAATCAATCTCTACTGTTTGTCAATT
AGCAAAAGTAGATCCAAGATCTGTTTTAAGGGAAATGGTTGACTTCCAGC
CTATATATAAAGAGCACAAAGCTGCAGTATTGGATTTTGCATCATCAACA
AATTCTGTCGTATTTCCAGGTTACTATACAACTAATCCAAAATCCACTCA
AACACATCTTGATCCATTTCTCACACCTTTGAAATTGGTCACTGAATTCA
CTTCATTCCCATCATTGCTAACTGTCTACAAAATGTTAGCGGTGTTACCG
ATATTTTCCAAGCATCATTGGCAGATCCAAAGGCATCGAGTTCAAAACTG
TCTAAAATCTTGTCAGAATTTGGATGATTTTAATCATTGCAGTTTGATGT
TAGTATCAGTTGAAGACCAACAAGATGAGTCGGTCTACTTGCCGGTGGAT
ATGGTAATTGATAAGTTGGCTGCGTGTTCGGCAACTTTACGTAAAGCTTT
AAGTTTGCCTCGTTGACTAAATGAGGAAATTATTGTACAAATTCA
back to top

protein sequence of SMED30031395-orf-1

>SMED30031395-orf-1 ID=SMED30031395-orf-1|Name=SMED30031395-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=905bp
MLDLMSKTAMQRSYKFRCLDPLCSNITLIDSKWQQHLQKAHPQSDPNDVK
YVKVEYRIGTNTPWQMMPLGTELWNNSFLVTNIDQSENGDHESNTNDESS
PRNGQEGSYNRSVFLGDFNGDGESSQVSGENVSNSKNETMFSEISKIEMN
SSTNNIVKSLLGQPLKSELLHHVEPNDPYQLTQQKITASVISLQLKLGPM
QPSPAEYQYPKTHRPTSDSLLCFNPTWFERKLADGSSQPRPWLSYSKCLN
KAFCIYCILFGNSAKVSESWTKTGWDTWNNGSRDIKRHEESPQHRAAELA
KVKAMSGFHSQHNSLFQVSANSEVIENRKMVKAVIDFIKLSASLQIEGEQ
LSHSFTKIVQLVGQYDGSLGLAIDKLRSMSDQELNFVSISNQRRLATAIS
ETIAERLVLLAKKRRSYTLILDVIQSRGSDDKSSHRLAVWVRYLTGDNAS
ETKVTQSLLDVLSINVNDTLEEKIMRILRKVGLDPANMVTFCCHSPGSEI
YLSQLGTVRGWPHNDDILAFLLEAGCAGCTRLSSCLGLVQQLTLFWSGSS
SRDKYLCEFLERQPGCLTSTKLDEMLDLLVDRYAEVIDALAELRATTSLS
PLEVWTADSLWRSLKAPETEEGIQLLRKAVGLLRPALSCQQLGKVHFLHQ
MRVRMQAETEQFETIIINPNNGSPPPKVFRPDISNGRPCKSQEEYRLFMK
NICRIISDSYSDVHLQLLSEIIHFSGSSLDDCSYNSSTINEQSISTVCQL
AKVDPRSVLREMVDFQPIYKEHKAAVLDFASSTNSVVFPGYYTTNPKSTQ
THLDPFLTPLKLVTEFTSFPSLLTVYKMLAVLPIFSKHHWQIQRHRVQNC
LKSCQNLDDFNHCSLMLVSVEDQQDESVYLPVDMVIDKLAACSATLRKAL
SLPR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR006580Znf_TTF
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006580Zinc finger, TTF-typeSMARTSM005972118neu4coord: 228..315
e-value: 0.0088
score: 20.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 87..106
NoneNo IPR availablePANTHERPTHR45749:SF1AC-LIKE TRANSPOSASE-RELATEDcoord: 184..481
NoneNo IPR availablePANTHERPTHR45749FAMILY NOT NAMEDcoord: 184..481