Calnexin

Overview
NameCalnexin
Smed IDSMED30031389
Length (bp)2287
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calnexin (SMED30031389) t-SNE clustered cells

Violin plots show distribution of expression levels for Calnexin (SMED30031389) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calnexin (SMED30031389) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calnexin (SMED30031389) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031389

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X2 cellSMED30031389SMESG000016275.1 SmedASXL_003004SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
protonephridiaSMED30031389SMESG000016275.1 dd_Smed_v4_632_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031389SMESG000016275.1 dd_Smed_v4_632_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30031389SMESG000016275.1 DN313316ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
central nervous systemSMED30031389SMESG000016275.1 DN313316ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
ovarySMED30031389SMESG000016275.1 DN313316ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30031389SMESG000016275.1 DN313316ncbi_smed_estsPMID:16344473
Zayas et al., 2005
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30031389SMESG000016275.1 dd_Smed_v6_632_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30031389SMESG000016275.1 dd_Smed_v6_632_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30031389SMESG000016275.1 dd_Smed_v4_632_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calnexin vs. Ensembl Human
Match: CANX (calnexin [Source:HGNC Symbol;Acc:HGNC:1473])

HSP 1 Score: 486.493 bits (1251), Expect = 2.622e-163
Identity = 261/450 (58.00%), Postives = 332/450 (73.78%), Query Frame = 2
Query:  272 MYFTKPSDLAEI--LVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            +YF    D   +   ++S A KD   D IAKY+G W VE    S +  D  LVL S+A+H AISAKLN+PF F T   ++QYEV FQNG ECGGAYVKLLS +  LNL QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG YEEKH+K+  +DL  +FTDKKTHLYTL++N DN+FEI VDQ+++NSG+LL D  P VNP +EI+DP+D KP DWD+ PKI DPEAVKP DWD+ AP  I DE+A KPEGWL++EP  +PD  +EKP+DWD++MDGEWEAP+I NP C+ APGCG W+ P I NP+YKG W PPMIDNP Y+G+WK R+IPN D+FED  P++MTP  AIGLELWSM+ +I FDNFII  +++  D++A + W +KK A+  A+P   VV  + EA  ERPWLW+V IL + LP+ L++++CC         EY++
Sbjct:   69 VYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEP--GVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKK 516          
BLAST of Calnexin vs. Ensembl Human
Match: CANX (calnexin [Source:HGNC Symbol;Acc:HGNC:1473])

HSP 1 Score: 486.493 bits (1251), Expect = 2.622e-163
Identity = 261/450 (58.00%), Postives = 332/450 (73.78%), Query Frame = 2
Query:  272 MYFTKPSDLAEI--LVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            +YF    D   +   ++S A KD   D IAKY+G W VE    S +  D  LVL S+A+H AISAKLN+PF F T   ++QYEV FQNG ECGGAYVKLLS +  LNL QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG YEEKH+K+  +DL  +FTDKKTHLYTL++N DN+FEI VDQ+++NSG+LL D  P VNP +EI+DP+D KP DWD+ PKI DPEAVKP DWD+ AP  I DE+A KPEGWL++EP  +PD  +EKP+DWD++MDGEWEAP+I NP C+ APGCG W+ P I NP+YKG W PPMIDNP Y+G+WK R+IPN D+FED  P++MTP  AIGLELWSM+ +I FDNFII  +++  D++A + W +KK A+  A+P   VV  + EA  ERPWLW+V IL + LP+ L++++CC         EY++
Sbjct:   69 VYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEP--GVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKK 516          
BLAST of Calnexin vs. Ensembl Human
Match: CANX (calnexin [Source:HGNC Symbol;Acc:HGNC:1473])

HSP 1 Score: 486.493 bits (1251), Expect = 2.622e-163
Identity = 261/450 (58.00%), Postives = 332/450 (73.78%), Query Frame = 2
Query:  272 MYFTKPSDLAEI--LVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            +YF    D   +   ++S A KD   D IAKY+G W VE    S +  D  LVL S+A+H AISAKLN+PF F T   ++QYEV FQNG ECGGAYVKLLS +  LNL QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG YEEKH+K+  +DL  +FTDKKTHLYTL++N DN+FEI VDQ+++NSG+LL D  P VNP +EI+DP+D KP DWD+ PKI DPEAVKP DWD+ AP  I DE+A KPEGWL++EP  +PD  +EKP+DWD++MDGEWEAP+I NP C+ APGCG W+ P I NP+YKG W PPMIDNP Y+G+WK R+IPN D+FED  P++MTP  AIGLELWSM+ +I FDNFII  +++  D++A + W +KK A+  A+P   VV  + EA  ERPWLW+V IL + LP+ L++++CC         EY++
Sbjct:   69 VYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEP--GVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKK 516          
BLAST of Calnexin vs. Ensembl Human
Match: CANX (calnexin [Source:HGNC Symbol;Acc:HGNC:1473])

HSP 1 Score: 486.493 bits (1251), Expect = 2.622e-163
Identity = 261/450 (58.00%), Postives = 332/450 (73.78%), Query Frame = 2
Query:  272 MYFTKPSDLAEI--LVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            +YF    D   +   ++S A KD   D IAKY+G W VE    S +  D  LVL S+A+H AISAKLN+PF F T   ++QYEV FQNG ECGGAYVKLLS +  LNL QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG YEEKH+K+  +DL  +FTDKKTHLYTL++N DN+FEI VDQ+++NSG+LL D  P VNP +EI+DP+D KP DWD+ PKI DPEAVKP DWD+ AP  I DE+A KPEGWL++EP  +PD  +EKP+DWD++MDGEWEAP+I NP C+ APGCG W+ P I NP+YKG W PPMIDNP Y+G+WK R+IPN D+FED  P++MTP  AIGLELWSM+ +I FDNFII  +++  D++A + W +KK A+  A+P   VV  + EA  ERPWLW+V IL + LP+ L++++CC         EY++
Sbjct:   69 VYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEP--GVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKK 516          
BLAST of Calnexin vs. Ensembl Human
Match: CANX (calnexin [Source:HGNC Symbol;Acc:HGNC:1473])

HSP 1 Score: 486.493 bits (1251), Expect = 2.622e-163
Identity = 261/450 (58.00%), Postives = 332/450 (73.78%), Query Frame = 2
Query:  272 MYFTKPSDLAEI--LVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            +YF    D   +   ++S A KD   D IAKY+G W VE    S +  D  LVL S+A+H AISAKLN+PF F T   ++QYEV FQNG ECGGAYVKLLS +  LNL QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG YEEKH+K+  +DL  +FTDKKTHLYTL++N DN+FEI VDQ+++NSG+LL D  P VNP +EI+DP+D KP DWD+ PKI DPEAVKP DWD+ AP  I DE+A KPEGWL++EP  +PD  +EKP+DWD++MDGEWEAP+I NP C+ APGCG W+ P I NP+YKG W PPMIDNP Y+G+WK R+IPN D+FED  P++MTP  AIGLELWSM+ +I FDNFII  +++  D++A + W +KK A+  A+P   VV  + EA  ERPWLW+V IL + LP+ L++++CC         EY++
Sbjct:   69 VYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEP--GVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKK 516          
BLAST of Calnexin vs. Ensembl Celegans
Match: cnx-1 (Calnexin [Source:UniProtKB/Swiss-Prot;Acc:P34652])

HSP 1 Score: 371.318 bits (952), Expect = 8.430e-119
Identity = 189/409 (46.21%), Postives = 259/409 (63.33%), Query Frame = 2
Query:  236 FTKPKVPENY---FVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERR 1453
            F  PK+ +     F  YF   S +    + S A KD V  +IAKYNG WS+  P+   IE D  L++K+KARH AI+AKLN PF F  N FV+QY++KF+ GQECGG Y+KLLS+    +L  F DKT YTIMFGPD+CG   KVH IF++K+P  G   E H+ + ++    ++ D  THL+TLV+     + + VD   +  G+++ D  P++ PPK+I D  D+KP DWD+   I D  AVKP DWD++ P+ + DE A KP  W E E   I D +++KP+DWD++MDG WEAP IDNP CK   GCG WK+P IKNP YKG W  P I NP +KG W AR I N +YFE      + PI A+G+E+W+MS+ I FDN +I  +++ + + A +T+ +K+  E R
Sbjct:   48 FVAPKLSDKSTPNFFDYFPVGSKIGLTWIKSLAKKDDVDSDIAKYNGEWSIGAPTKVSIEGDLGLIVKTKARHHAIAAKLNTPFAFDANTFVVQYDIKFEEGQECGGGYLKLLSEGAEKDLANFQDKTAYTIMFGPDKCGATGKVHLIFRYKNPINGTISEYHANQPTTIGSTYWDDHNTHLFTLVVKPTGEYSVSVDGKSLYYGNMMSDVTPALTPPKQIFDETDLKPVDWDERENIEDESAVKPDDWDENEPQSVVDEAATKPYDWNEEENELIADPEAKKPQDWDEDMDGSWEAPLIDNPACKGLSGCGTWKAPTIKNPKYKGKWIRPKISNPAFKGKWTARLIDNPNYFEPKPFAGLAPITAVGIEMWTMSENILFDNILITSSEEDSSDVAKQTFYVKQKEEYR 456          
BLAST of Calnexin vs. Ensembl Celegans
Match: cnx-1 (Calnexin [Source:UniProtKB/Swiss-Prot;Acc:P34652])

HSP 1 Score: 255.373 bits (651), Expect = 5.890e-77
Identity = 124/277 (44.77%), Postives = 176/277 (63.54%), Query Frame = 2
Query:  623 MFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERR 1453
            MFGPD+CG   KVH IF++K+P  G   E H+ + ++    ++ D  THL+TLV+     + + VD   +  G+++ D  P++ PPK+I D  D+KP DWD+   I D  AVKP DWD++ P+ + DE A KP  W E E   I D +++KP+DWD++MDG WEAP IDNP CK   GCG WK+P IKNP YKG W  P I NP +KG W AR I N +YFE      + PI A+G+E+W+MS+ I FDN +I  +++ + + A +T+ +K+  E R
Sbjct:    1 MFGPDKCGATGKVHLIFRYKNPINGTISEYHANQPTTIGSTYWDDHNTHLFTLVVKPTGEYSVSVDGKSLYYGNMMSDVTPALTPPKQIFDETDLKPVDWDERENIEDESAVKPDDWDENEPQSVVDEAATKPYDWNEEENELIADPEAKKPQDWDEDMDGSWEAPLIDNPACKGLSGCGTWKAPTIKNPKYKGKWIRPKISNPAFKGKWTARLIDNPNYFEPKPFAGLAPITAVGIEMWTMSENILFDNILITSSEEDSSDVAKQTFYVKQKEEYR 277          
BLAST of Calnexin vs. Ensembl Celegans
Match: crt-1 (Calreticulin [Source:UniProtKB/Swiss-Prot;Acc:P27798])

HSP 1 Score: 192.2 bits (487), Expect = 4.793e-54
Identity = 126/327 (38.53%), Postives = 164/327 (50.15%), Query Frame = 2
Query:  410 DFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDN 1390
            D  +     A+  + +AK ++ F       VIQY VK + G +CGG YVK++     L    FH +T Y +MFGPD CG   +VH I  +K       +E   K          +D+ THLYTL++NSDNT+E+ +D     +GSL +D+              D+ PA      KI DP+A KP DWD+   EYI+D +  KPE W   +P  IPD  ++KP+DWDDEMDGEWE P IDNP                    YKG W P  I NP YKG W    I N +Y  D   Y     GAIG +LW +     FDN II D+
Sbjct:   58 DQGIQTSQDAKFYSRAAKFDKDFSNKGKTLVIQYTVKHEQGIDCGGGYVKVMRADADLG--DFHGETPYNVMFGPDICGPTRRVHVILNYKGENKLIKKEITCK----------SDELTHLYTLILNSDNTYEVKIDGESAQTGSLEEDW--------------DLLPA-----KKIKDPDAKKPEDWDER--EYIDDAEDAKPEDW--EKPEHIPDPDAKKPEDWDDEMDGEWEPPMIDNP-------------------EYKGEWKPKQIKNPAYKGKWIHPEIENPEYTPDDELYSYESWGAIGFDLWQVKSGTIFDNIIITDS 330          
BLAST of Calnexin vs. Ensembl Celegans
Match: crt-1 (Calreticulin [Source:UniProtKB/Swiss-Prot;Acc:P27798])

HSP 1 Score: 192.2 bits (487), Expect = 4.793e-54
Identity = 126/327 (38.53%), Postives = 164/327 (50.15%), Query Frame = 2
Query:  410 DFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDN 1390
            D  +     A+  + +AK ++ F       VIQY VK + G +CGG YVK++     L    FH +T Y +MFGPD CG   +VH I  +K       +E   K          +D+ THLYTL++NSDNT+E+ +D     +GSL +D+              D+ PA      KI DP+A KP DWD+   EYI+D +  KPE W   +P  IPD  ++KP+DWDDEMDGEWE P IDNP                    YKG W P  I NP YKG W    I N +Y  D   Y     GAIG +LW +     FDN II D+
Sbjct:   58 DQGIQTSQDAKFYSRAAKFDKDFSNKGKTLVIQYTVKHEQGIDCGGGYVKVMRADADLG--DFHGETPYNVMFGPDICGPTRRVHVILNYKGENKLIKKEITCK----------SDELTHLYTLILNSDNTYEVKIDGESAQTGSLEEDW--------------DLLPA-----KKIKDPDAKKPEDWDER--EYIDDAEDAKPEDW--EKPEHIPDPDAKKPEDWDDEMDGEWEPPMIDNP-------------------EYKGEWKPKQIKNPAYKGKWIHPEIENPEYTPDDELYSYESWGAIGFDLWQVKSGTIFDNIIITDS 330          
BLAST of Calnexin vs. Ensembl Fly
Match: Cnx99A (gene:FBgn0015622 transcript:FBtr0085438)

HSP 1 Score: 428.328 bits (1100), Expect = 6.023e-141
Identity = 219/409 (53.55%), Postives = 282/409 (68.95%), Query Frame = 2
Query:  224 QKLKFTKPKVPEN--YFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQ-FVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQ-FHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKK 1438
            +KL +  P +     +F  +F    +  +  V+S A KD +A+ I+KY+GIW+ E P   V  +D  LVLKSKA+HAAI+A L +PF+F +++  V+QYEV  Q GQECGG+Y+KLLS        + F+DKT YTIMFGPD+CGND K+HFIF+H +P  G   EKH  K  + L+  F DK  HLY LV+  DN+FEI VD  +IN GSLL DF+P VNPP EIDDP D KP  WD+  KI DP A KP DWD+ AP  + D  AV P GWLE+EP  I D  + KP+DWD E+DGEWEAP +DNP+C+ APGCG WK+P I NP+YKG W  PMI+NP Y+G W  R+IPN D+FED  P++MTPI A+GLELWSMS +I FDN II D+ + A +FAA ++ +K+
Sbjct:   58 EKLAYESPVIDAKKFHFADHFDDVEESRKRWVLSQAKKDDIAEEISKYDGIWNWESPQRIVWANDLGLVLKSKAKHAAIAAPLRKPFEFKSDKPLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPDKCGNDVKMHFIFRHVNPINGTITEKHCNKPKNRLEEPFKDKLPHLYQLVVRPDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKIPDPTAHKPEDWDEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWDAEIDGEWEAPLVDNPVCEKAPGCGKWKAPLIPNPNYKGKWRAPMIENPNYQGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDDVEVARDFAANSFDIKR 466          
BLAST of Calnexin vs. Ensembl Fly
Match: Cnx99A (gene:FBgn0015622 transcript:FBtr0085437)

HSP 1 Score: 428.328 bits (1100), Expect = 6.023e-141
Identity = 219/409 (53.55%), Postives = 282/409 (68.95%), Query Frame = 2
Query:  224 QKLKFTKPKVPEN--YFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQ-FVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQ-FHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKK 1438
            +KL +  P +     +F  +F    +  +  V+S A KD +A+ I+KY+GIW+ E P   V  +D  LVLKSKA+HAAI+A L +PF+F +++  V+QYEV  Q GQECGG+Y+KLLS        + F+DKT YTIMFGPD+CGND K+HFIF+H +P  G   EKH  K  + L+  F DK  HLY LV+  DN+FEI VD  +IN GSLL DF+P VNPP EIDDP D KP  WD+  KI DP A KP DWD+ AP  + D  AV P GWLE+EP  I D  + KP+DWD E+DGEWEAP +DNP+C+ APGCG WK+P I NP+YKG W  PMI+NP Y+G W  R+IPN D+FED  P++MTPI A+GLELWSMS +I FDN II D+ + A +FAA ++ +K+
Sbjct:   58 EKLAYESPVIDAKKFHFADHFDDVEESRKRWVLSQAKKDDIAEEISKYDGIWNWESPQRIVWANDLGLVLKSKAKHAAIAAPLRKPFEFKSDKPLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPDKCGNDVKMHFIFRHVNPINGTITEKHCNKPKNRLEEPFKDKLPHLYQLVVRPDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKIPDPTAHKPEDWDEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWDAEIDGEWEAPLVDNPVCEKAPGCGKWKAPLIPNPNYKGKWRAPMIENPNYQGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDDVEVARDFAANSFDIKR 466          
BLAST of Calnexin vs. Ensembl Fly
Match: Cnx99A (gene:FBgn0015622 transcript:FBtr0110909)

HSP 1 Score: 428.328 bits (1100), Expect = 6.023e-141
Identity = 219/409 (53.55%), Postives = 282/409 (68.95%), Query Frame = 2
Query:  224 QKLKFTKPKVPEN--YFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQ-FVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQ-FHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKK 1438
            +KL +  P +     +F  +F    +  +  V+S A KD +A+ I+KY+GIW+ E P   V  +D  LVLKSKA+HAAI+A L +PF+F +++  V+QYEV  Q GQECGG+Y+KLLS        + F+DKT YTIMFGPD+CGND K+HFIF+H +P  G   EKH  K  + L+  F DK  HLY LV+  DN+FEI VD  +IN GSLL DF+P VNPP EIDDP D KP  WD+  KI DP A KP DWD+ AP  + D  AV P GWLE+EP  I D  + KP+DWD E+DGEWEAP +DNP+C+ APGCG WK+P I NP+YKG W  PMI+NP Y+G W  R+IPN D+FED  P++MTPI A+GLELWSMS +I FDN II D+ + A +FAA ++ +K+
Sbjct:   58 EKLAYESPVIDAKKFHFADHFDDVEESRKRWVLSQAKKDDIAEEISKYDGIWNWESPQRIVWANDLGLVLKSKAKHAAIAAPLRKPFEFKSDKPLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPDKCGNDVKMHFIFRHVNPINGTITEKHCNKPKNRLEEPFKDKLPHLYQLVVRPDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKIPDPTAHKPEDWDEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWDAEIDGEWEAPLVDNPVCEKAPGCGKWKAPLIPNPNYKGKWRAPMIENPNYQGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDDVEVARDFAANSFDIKR 466          
BLAST of Calnexin vs. Ensembl Fly
Match: Cnx99A (gene:FBgn0015622 transcript:FBtr0334873)

HSP 1 Score: 426.402 bits (1095), Expect = 3.739e-140
Identity = 219/409 (53.55%), Postives = 282/409 (68.95%), Query Frame = 2
Query:  224 QKLKFTKPKVPEN--YFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQ-FVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQ-FHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKK 1438
            +KL +  P +     +F  +F    +  +  V+S A KD +A+ I+KY+GIW+ E P   V  +D  LVLKSKA+HAAI+A L +PF+F +++  V+QYEV  Q GQECGG+Y+KLLS        + F+DKT YTIMFGPD+CGND K+HFIF+H +P  G   EKH  K  + L+  F DK  HLY LV+  DN+FEI VD  +IN GSLL DF+P VNPP EIDDP D KP  WD+  KI DP A KP DWD+ AP  + D  AV P GWLE+EP  I D  + KP+DWD E+DGEWEAP +DNP+C+ APGCG WK+P I NP+YKG W  PMI+NP Y+G W  R+IPN D+FED  P++MTPI A+GLELWSMS +I FDN II D+ + A +FAA ++ +K+
Sbjct:   58 EKLAYESPVIDAKKFHFADHFDDVEESRKRWVLSQAKKDDIAEEISKYDGIWNWESPQRIVWANDLGLVLKSKAKHAAIAAPLRKPFEFKSDKPLVVQYEVTLQEGQECGGSYLKLLSAGKDTEQLKAFNDKTPYTIMFGPDKCGNDVKMHFIFRHVNPINGTITEKHCNKPKNRLEEPFKDKLPHLYQLVVRPDNSFEIRVDHKIINEGSLLTDFKPPVNPPAEIDDPNDHKPESWDEREKIPDPTAHKPEDWDEDAPPQLPDTDAVMPNGWLEDEPDMIFDPTATKPEDWDAEIDGEWEAPLVDNPVCEKAPGCGKWKAPLIPNPNYKGKWRAPMIENPNYQGKWAPRKIPNPDFFEDLKPFQMTPISAVGLELWSMSSDILFDNLIITDDVEVARDFAANSFDIKR 466          
BLAST of Calnexin vs. Ensembl Fly
Match: Cnx14D (gene:FBgn0264077 transcript:FBtr0074299)

HSP 1 Score: 412.92 bits (1060), Expect = 1.991e-134
Identity = 216/411 (52.55%), Postives = 279/411 (67.88%), Query Frame = 2
Query:  263 YFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQ-FVIQYEVKFQNGQECGGAYVXXXXXXX-XXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIR 1489
            YF  +F       +  V+S A K+ +AD IAKY+GIW+ E P      +D  LVLKSKA+HAAI+A   +PFDF +N+  V+QYE+  Q GQ+CGG+Y+KLLS       L +F+DKT YTIMFGPD+CGN+ K+HFIF+H +P  G   EKH KK ++ L   FTDK  HLY LV+  DN+FEI +D  +I  GSLL DF P VNPP EIDDP D KP  WD+  KI DP A KP DWD+ AP ++ D  AV P GWLE+EP  I D  + +P+DW+ E+DGEWEAP ++NP+CK APGCG WK+P I NP+YKG W+ PMI+NP  +G W  R+I N D+FED  P++MTPI A+GLELWSMS +I FDN II D+ + A +FAA ++ +K+    R      VV+  R
Sbjct:   58 YFADHFDDVEASRKRWVLSQAKKNDIADEIAKYDGIWNWESPQRIFWANDLGLVLKSKAKHAAIAAPFRQPFDFKSNKPLVVQYELTLQEGQDCGGSYLKLLSAGKGTEQLNRFNDKTPYTIMFGPDKCGNNLKMHFIFRHVNPLNGNITEKHCKKPNARLGVPFTDKLPHLYQLVVRPDNSFEIRLDHKIIKEGSLLTDFVPPVNPPAEIDDPNDHKPESWDERKKIPDPNAHKPEDWDEDAPPHLPDTDAVMPNGWLEDEPDMIFDPTAIEPEDWNSEIDGEWEAPLVENPVCKKAPGCGKWKAPLIPNPNYKGKWSAPMIENPNNQGKWAPRKIANPDFFEDLKPFQMTPINAVGLELWSMSSDILFDNLIITDDVELARDFAANSFDIKRLYIDRESFGNKVVELAR 468          
BLAST of Calnexin vs. Ensembl Zebrafish
Match: canx (calnexin [Source:ZFIN;Acc:ZDB-GENE-040426-2797])

HSP 1 Score: 485.337 bits (1248), Expect = 6.428e-163
Identity = 266/456 (58.33%), Postives = 340/456 (74.56%), Query Frame = 2
Query:  257 ENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCC---RSSGSDKSAEYER 1615
            E+YF   F K +   +  V+S A KDG+ ++IAKY+G W VE    S +  D  LVLKSKA+H AISA L RPF F T   ++QYEV FQ G +CGGAYVKLLS +  L+L++F DKT YTIMFGPD+CG D K+HFIF+HK+PKTG++EEKH+KK  SDL  ++TDKKTHLYTLV+N DNTFEI +DQT++NSGSLL D  P VNPP EI+DP D KP DWD+ PKI DP+AVKP DWD+ AP  I DE AVKP+GWL++EP  I D  + KP+DWD++MDGEWEAP+I NP+C+ APGCG W+ P I NP+YKG W  PMIDNP Y+GVWK R+IPN D+FED HP++MTP  A+GLELWSMS +I FDNF I  ++  A+ +A + W +KK AE  A+P   +V+ +  A  ERPWLWIV +L + LP++L++V+CC   +SS S  +AEY++
Sbjct:   76 EHYFAEAFDKGT--LQGWVLSQAKKDGIDEDIAKYDGKWEVEEMQDSKLPGDKGLVLKSKAKHHAISALLLRPFTFDTKPLIVQYEVNFQTGIDCGGAYVKLLSQTPDLDLEEFVDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGEFEEKHAKKPDSDLRSYYTDKKTHLYTLVLNPDNTFEILIDQTVVNSGSLLNDVTPPVNPPAEIEDPDDHKPEDWDERPKIQDPDAVKPEDWDEDAPAKIADEDAVKPDGWLDDEPEYISDPDAVKPEDWDEDMDGEWEAPQIPNPVCETAPGCGAWERPMIDNPNYKGKWKSPMIDNPNYQGVWKPRKIPNPDFFEDLHPFRMTPFSAVGLELWSMSSDIFFDNFFITSDRNVAERWANDGWGLKKAAEGAAEP--GLVNQMITAAEERPWLWIVYVLTVALPLVLIIVFCCTGKKSSASTPAAEYKK 527          
BLAST of Calnexin vs. Ensembl Zebrafish
Match: clgn (calmegin [Source:ZFIN;Acc:ZDB-GENE-060929-708])

HSP 1 Score: 445.662 bits (1145), Expect = 3.359e-147
Identity = 223/398 (56.03%), Postives = 287/398 (72.11%), Query Frame = 2
Query:  314 MSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSER 1507
            +S  MK+   ++IAKY+G W VE    + +  D  LVLKS+A+H AISA LN+PF F     ++QYEV FQ+G +CGGAY+KLLSDS  L L+QFHD+T Y+IMFGPD+CG D K+HFIF+HK+P  G  EEKH+K+   DL + +TDKKTHL+TLV+N DN++E F+DQ+ ++ GSLL D  P VNPPKEIDDPKD KP DWD+  KI DPEAVKP +WD+ A   + D  AVKP+GWL++EP  + D  +EKP DWD+EMDGEWEAP++ NP C  APGCG WK P + NP YKG W  P+IDNP Y+GVW  R+IPN D+FED HP++M P  A+GLELWSM+ +I FDNFII   K+ AD +AA++W +KK      +P   V+  +  A  ER
Sbjct:   86 VSKTMKEDADEDIAKYDGKWEVEPLKENTVPGDLGLVLKSRAKHHAISALLNKPFVFKDKPLIVQYEVNFQDGIDCGGAYIKLLSDSKDLELEQFHDRTPYSIMFGPDKCGEDYKLHFIFRHKNPLNGDVEEKHAKRPDVDLKKIYTDKKTHLFTLVLNPDNSYETFIDQSSVSRGSLLTDVVPPVNPPKEIDDPKDSKPEDWDERAKIPDPEAVKPEEWDEEALAKVPDPDAVKPDGWLDDEPEFVSDPTAEKPDDWDEEMDGEWEAPQVPNPACTSAPGCGEWKPPMVNNPKYKGKWKAPLIDNPNYQGVWSPRKIPNPDHFEDLHPFRMEPFRAVGLELWSMTSDIYFDNFIITTEKEVADRWAADSWGLKKLVASANEP--GVLSQLALAAEER 481          
BLAST of Calnexin vs. Ensembl Zebrafish
Match: calr (calreticulin [Source:ZFIN;Acc:ZDB-GENE-030131-4042])

HSP 1 Score: 206.453 bits (524), Expect = 7.157e-59
Identity = 134/351 (38.18%), Postives = 174/351 (49.57%), Query Frame = 2
Query:  404 EDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCG-NDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERR 1453
            E D  L     A   A+SA+    F+      VIQ+ VK +   +CGG Y+KL            H  + Y IMFGPD CG    KVH IF +K    GK    +      D      D+ +HLYTL++N DNT+E+ +D   + SGSL +D++    P K+I DP+  KP DWD+  KI DPE  KP +WD                     +P  IPD  ++KP DWD+EMDGEWE P +                    NP YKG W P  IDNP YKG W    I N +Y  D+  YK   IG IGL+LW +     FDNF+I ++ K A+E   ETW   KDAE++
Sbjct:   62 EKDKGLQTSQDAHFYAMSARFGD-FNNKDQPLVIQFSVKHEQNIDCGGGYIKLFPSDLNQE--DMHGDSTYNIMFGPDICGPGTKKVHVIFNYK----GKNHLINKDIRCKD------DEYSHLYTLIVNPDNTYEVKIDNKKVESGSLEEDWD--FLPSKKIKDPEAKKPEDWDEREKIDDPEDQKPEEWD---------------------KPENIPDPDAKKPDDWDEEMDGEWEPPMV-------------------TNPDYKGEWKPRQIDNPAYKGKWVHPEIDNPEYTADSEIYKYDSIGVIGLDLWQVKSGTIFDNFLITNDPKLAEEVGTETWGATKDAEKK 357          
BLAST of Calnexin vs. Ensembl Zebrafish
Match: calr3a (calreticulin 3a [Source:ZFIN;Acc:ZDB-GENE-000208-17])

HSP 1 Score: 203.756 bits (517), Expect = 8.326e-58
Identity = 131/351 (37.32%), Postives = 174/351 (49.57%), Query Frame = 2
Query:  404 EDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCG-NDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERR 1453
            E D  L     AR  A+S++ +  F       VIQ+ VK +   +CGG YVK+          + H ++QY IMFGPD CG +  KVH IF +K    G+           D      D+ THLYTL++  D T+E+ +D   + SGSL +D++    PPK+I DP+  KP DWDD  KI DPE  KP DWD                     +P  IPD  ++KP DWD++MDGEWE   I                    NP YKG W P  IDNP YKG W    I N +Y  D   YK   IG +GL+LW +     FDNF+I D+ + A++F  +TW   K  E++
Sbjct:   61 ELDKGLQTSQDARFYALSSRFDS-FSNEGKTLVIQFTVKHEQKIDCGGGYVKVFPAEMDQT--EMHGESQYYIMFGPDICGYSTKKVHVIFNYK----GQNHLIKKDIKCKD------DELTHLYTLILRPDQTYEVKIDNEKVESGSLEEDWD--FLPPKKIKDPEAKKPDDWDDRAKIDDPEDTKPEDWD---------------------KPENIPDPDAKKPDDWDEDMDGEWEPAMI-------------------PNPEYKGEWKPKQIDNPSYKGTWVHPEIDNPEYAADDAIYKFDSIGVLGLDLWQVKSGTIFDNFLITDDVEEAEKFGTDTWGATKGPEKK 356          
BLAST of Calnexin vs. Ensembl Zebrafish
Match: calr3b (calreticulin 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9907])

HSP 1 Score: 199.904 bits (507), Expect = 2.248e-56
Identity = 134/342 (39.18%), Postives = 168/342 (49.12%), Query Frame = 2
Query:  404 EDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCG-NDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETW 1426
            E D  L     AR  A S +   PF       VIQ+ VK +   +CGG YVK+            H  +QY IMFGPD CG +  KVH IF +K    G+           D      D+ THLYTL++N D T+E+ +D   + SGSL +D++    PPK                 KI DPEA KP DWDD A   I+DE   KPE W  ++P  IPD  ++KP+DWD++MDGEWE   I                    NP YKG W P  IDNP YKG W    I N ++  D   YK   IG +GL+LW +     FDNF I D+ K A+EF  ETW
Sbjct:   62 EKDKGLQTSQDARFYATSVRF-EPFSNEGKTLVIQFTVKHEQKIDCGGGYVKVFPADLNQA--DMHGDSQYYIMFGPDICGYSTKKVHVIFNYK----GQNHLIKKDIKCKD------DELTHLYTLILNPDQTYEVKIDNEKVESGSLEEDWD--FLPPK-----------------KIKDPEAKKPEDWDDRAK--IDDETDTKPEDW--DKPENIPDPDAKKPEDWDEDMDGEWEPAMI-------------------PNPEYKGEWKPKQIDNPNYKGAWVHPEIDNPEHVPDDQIYKFDNIGVLGLDLWQVKSGTIFDNFFISDDVKEAEEFGNETW 348          
BLAST of Calnexin vs. Ensembl Xenopus
Match: zfyve16 (zinc finger FYVE-type containing 16 [Source:Xenbase;Acc:XB-GENE-985796])

HSP 1 Score: 478.404 bits (1230), Expect = 1.064e-160
Identity = 261/468 (55.77%), Postives = 336/468 (71.79%), Query Frame = 2
Query:  218 PAQKLKFTKPKVP--ENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            PA K+ +  P VP  E YF   F K +   +  ++S A KD   + IAKY+G W V     + +  D  LVL S+A+H AI++K+ +PF F     ++QYEV FQNG ECGGAYVKLLS +     +QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG+YEEKH+K+  +DL  +FTDKKTHLYTLV+N DN+FEI VDQT++N G+LL D  P VNPP EI+DP+D KP DWD+ PKI DP+AVKP DWD+ AP  I DE AVKPEGWL++EP  IPD  +EKP+DWD++MDGEWEAP++ NP C+ APGCG W+ P I NPSYKG W PPMIDNP Y+G+WK R+IPN D+FED  P++MTP  A+GLELWSM+ +I FDNFI+   K  AD++A + W +KK A+  + P  SVV  +  A  ERPWLWIV IL + LP+ L++++CC        AE+++
Sbjct:   66 PAPKVTYKAP-VPTGEVYFSESFDKGT--LDGWILSKAKKDDTDEEIAKYDGKWEVLEMKDTKLPGDLGLVLMSRAKHHAIASKMKKPFVFDKKSLIVQYEVNFQNGIECGGAYVKLLSKTPEQKPEQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGEYEEKHAKRPDADLKSYFTDKKTHLYTLVLNPDNSFEILVDQTVVNRGNLLNDVNPPVNPPNEIEDPEDKKPEDWDERPKIPDPDAVKPDDWDEDAPAKIPDENAVKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQVANPKCESAPGCGVWQRPTIDNPSYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPFYAVGLELWSMTSDIFFDNFIVTSEKNVADDWANDGWGLKKAADGASAP--SVVGQMMAAAEERPWLWIVYILTVALPVFLVILFCCSGKKQPLDAEHKK 528          
BLAST of Calnexin vs. Ensembl Xenopus
Match: zfyve16 (zinc finger FYVE-type containing 16 [Source:Xenbase;Acc:XB-GENE-985796])

HSP 1 Score: 478.404 bits (1230), Expect = 2.913e-160
Identity = 261/468 (55.77%), Postives = 336/468 (71.79%), Query Frame = 2
Query:  218 PAQKLKFTKPKVP--ENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            PA K+ +  P VP  E YF   F K +   +  ++S A KD   + IAKY+G W V     + +  D  LVL S+A+H AI++K+ +PF F     ++QYEV FQNG ECGGAYVKLLS +     +QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG+YEEKH+K+  +DL  +FTDKKTHLYTLV+N DN+FEI VDQT++N G+LL D  P VNPP EI+DP+D KP DWD+ PKI DP+AVKP DWD+ AP  I DE AVKPEGWL++EP  IPD  +EKP+DWD++MDGEWEAP++ NP C+ APGCG W+ P I NPSYKG W PPMIDNP Y+G+WK R+IPN D+FED  P++MTP  A+GLELWSM+ +I FDNFI+   K  AD++A + W +KK A+  + P  SVV  +  A  ERPWLWIV IL + LP+ L++++CC        AE+++
Sbjct:   66 PAPKVTYKAP-VPTGEVYFSESFDKGT--LDGWILSKAKKDDTDEEIAKYDGKWEVLEMKDTKLPGDLGLVLMSRAKHHAIASKMKKPFVFDKKSLIVQYEVNFQNGIECGGAYVKLLSKTPEQKPEQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGEYEEKHAKRPDADLKSYFTDKKTHLYTLVLNPDNSFEILVDQTVVNRGNLLNDVNPPVNPPNEIEDPEDKKPEDWDERPKIPDPDAVKPDDWDEDAPAKIPDENAVKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQVANPKCESAPGCGVWQRPTIDNPSYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPFYAVGLELWSMTSDIFFDNFIVTSEKNVADDWANDGWGLKKAADGASAP--SVVGQMMAAAEERPWLWIVYILTVALPVFLVILFCCSGKKQPLDAEHKK 528          
BLAST of Calnexin vs. Ensembl Xenopus
Match: zfyve16 (zinc finger FYVE-type containing 16 [Source:Xenbase;Acc:XB-GENE-985796])

HSP 1 Score: 478.789 bits (1231), Expect = 3.417e-160
Identity = 261/468 (55.77%), Postives = 336/468 (71.79%), Query Frame = 2
Query:  218 PAQKLKFTKPKVP--ENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            PA K+ +  P VP  E YF   F K +   +  ++S A KD   + IAKY+G W V     + +  D  LVL S+A+H AI++K+ +PF F     ++QYEV FQNG ECGGAYVKLLS +     +QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG+YEEKH+K+  +DL  +FTDKKTHLYTLV+N DN+FEI VDQT++N G+LL D  P VNPP EI+DP+D KP DWD+ PKI DP+AVKP DWD+ AP  I DE AVKPEGWL++EP  IPD  +EKP+DWD++MDGEWEAP++ NP C+ APGCG W+ P I NPSYKG W PPMIDNP Y+G+WK R+IPN D+FED  P++MTP  A+GLELWSM+ +I FDNFI+   K  AD++A + W +KK A+  + P  SVV  +  A  ERPWLWIV IL + LP+ L++++CC        AE+++
Sbjct:   66 PAPKVTYKAP-VPTGEVYFSESFDKGT--LDGWILSKAKKDDTDEEIAKYDGKWEVLEMKDTKLPGDLGLVLMSRAKHHAIASKMKKPFVFDKKSLIVQYEVNFQNGIECGGAYVKLLSKTPEQKPEQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGEYEEKHAKRPDADLKSYFTDKKTHLYTLVLNPDNSFEILVDQTVVNRGNLLNDVNPPVNPPNEIEDPEDKKPEDWDERPKIPDPDAVKPDDWDEDAPAKIPDENAVKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQVANPKCESAPGCGVWQRPTIDNPSYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPFYAVGLELWSMTSDIFFDNFIVTSEKNVADDWANDGWGLKKAADGASAP--SVVGQMMAAAEERPWLWIVYILTVALPVFLVILFCCSGKKQPLDAEHKK 528          
BLAST of Calnexin vs. Ensembl Xenopus
Match: zfyve16 (zinc finger FYVE-type containing 16 [Source:Xenbase;Acc:XB-GENE-985796])

HSP 1 Score: 468.774 bits (1205), Expect = 2.696e-157
Identity = 239/412 (58.01%), Postives = 303/412 (73.54%), Query Frame = 2
Query:  218 PAQKLKFTKPKVP--ENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAE 1447
            PA K+ +  P VP  E YF   F K +   +  ++S A KD   + IAKY+G W V     + +  D  LVL S+A+H AI++K+ +PF F     ++QYEV FQNG ECGGAYVKLLS +     +QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG+YEEKH+K+  +DL  +FTDKKTHLYTLV+N DN+FEI VDQT++N G+LL D  P VNPP EI+DP+D KP DWD+ PKI DP+AVKP DWD+ AP  I DE AVKPEGWL++EP  IPD  +EKP+DWD++MDGEWEAP++ NP C+ APGCG W+ P I NPSYKG W PPMIDNP Y+G+WK R+IPN D+FED  P++MTP  A+GLELWSM+ +I FDNFI+   K  AD++A + W +KK A+
Sbjct:   66 PAPKVTYKAP-VPTGEVYFSESFDKGT--LDGWILSKAKKDDTDEEIAKYDGKWEVLEMKDTKLPGDLGLVLMSRAKHHAIASKMKKPFVFDKKSLIVQYEVNFQNGIECGGAYVKLLSKTPEQKPEQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGEYEEKHAKRPDADLKSYFTDKKTHLYTLVLNPDNSFEILVDQTVVNRGNLLNDVNPPVNPPNEIEDPEDKKPEDWDERPKIPDPDAVKPDDWDEDAPAKIPDENAVKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQVANPKCESAPGCGVWQRPTIDNPSYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPFYAVGLELWSMTSDIFFDNFIVTSEKNVADDWANDGWGLKKAAD 474          
BLAST of Calnexin vs. Ensembl Xenopus
Match: zfyve16 (zinc finger FYVE-type containing 16 [Source:Xenbase;Acc:XB-GENE-985796])

HSP 1 Score: 469.544 bits (1207), Expect = 3.265e-157
Identity = 239/412 (58.01%), Postives = 303/412 (73.54%), Query Frame = 2
Query:  218 PAQKLKFTKPKVP--ENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAE 1447
            PA K+ +  P VP  E YF   F K +   +  ++S A KD   + IAKY+G W V     + +  D  LVL S+A+H AI++K+ +PF F     ++QYEV FQNG ECGGAYVKLLS +     +QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG+YEEKH+K+  +DL  +FTDKKTHLYTLV+N DN+FEI VDQT++N G+LL D  P VNPP EI+DP+D KP DWD+ PKI DP+AVKP DWD+ AP  I DE AVKPEGWL++EP  IPD  +EKP+DWD++MDGEWEAP++ NP C+ APGCG W+ P I NPSYKG W PPMIDNP Y+G+WK R+IPN D+FED  P++MTP  A+GLELWSM+ +I FDNFI+   K  AD++A + W +KK A+
Sbjct:   66 PAPKVTYKAP-VPTGEVYFSESFDKGT--LDGWILSKAKKDDTDEEIAKYDGKWEVLEMKDTKLPGDLGLVLMSRAKHHAIASKMKKPFVFDKKSLIVQYEVNFQNGIECGGAYVKLLSKTPEQKPEQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGEYEEKHAKRPDADLKSYFTDKKTHLYTLVLNPDNSFEILVDQTVVNRGNLLNDVNPPVNPPNEIEDPEDKKPEDWDERPKIPDPDAVKPDDWDEDAPAKIPDENAVKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQVANPKCESAPGCGVWQRPTIDNPSYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPFYAVGLELWSMTSDIFFDNFIVTSEKNVADDWANDGWGLKKAAD 474          
BLAST of Calnexin vs. Ensembl Mouse
Match: Canx (calnexin [Source:MGI Symbol;Acc:MGI:88261])

HSP 1 Score: 489.574 bits (1259), Expect = 1.173e-164
Identity = 269/468 (57.48%), Postives = 343/468 (73.29%), Query Frame = 2
Query:  218 PAQKLKFTKPKVP--ENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            P+ K+ +  P VP  E YF   F + S    IL  S A KD   D IAKY+G W V+    + +  D  LVL S+A+H AISAKLN+PF F T   ++QYEV FQNG ECGGAYVKLLS +  L+L QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG YEEKH+K+  +DL  +FTDKKTHLYTL++N DN+FEI VDQ+++NSG+LL D  P VNP +EI+DP+D KP DWD+ PKIADP+AVKP DWD+ AP  I DE+A KPEGWL++EP  IPD  +EKP+DWD++MDGEWEAP+I NP C+ APGCG W+ P I NP+YKG W PPMIDNP Y+G+WK R+IPN D+FED  P+KMTP  AIGLELWSM+ +I FDNFII  +++  D++A + W +KK A+  A+P   VV  + EA  ERPWLW+V IL + LP+ L++++CC       + EY++
Sbjct:   55 PSPKVTYKAP-VPTGEVYFADSFDRGSLSGWIL--SKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEP--GVVLQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKK 517          
BLAST of Calnexin vs. Ensembl Mouse
Match: Canx (calnexin [Source:MGI Symbol;Acc:MGI:88261])

HSP 1 Score: 489.574 bits (1259), Expect = 1.173e-164
Identity = 269/468 (57.48%), Postives = 343/468 (73.29%), Query Frame = 2
Query:  218 PAQKLKFTKPKVP--ENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            P+ K+ +  P VP  E YF   F + S    IL  S A KD   D IAKY+G W V+    + +  D  LVL S+A+H AISAKLN+PF F T   ++QYEV FQNG ECGGAYVKLLS +  L+L QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG YEEKH+K+  +DL  +FTDKKTHLYTL++N DN+FEI VDQ+++NSG+LL D  P VNP +EI+DP+D KP DWD+ PKIADP+AVKP DWD+ AP  I DE+A KPEGWL++EP  IPD  +EKP+DWD++MDGEWEAP+I NP C+ APGCG W+ P I NP+YKG W PPMIDNP Y+G+WK R+IPN D+FED  P+KMTP  AIGLELWSM+ +I FDNFII  +++  D++A + W +KK A+  A+P   VV  + EA  ERPWLW+V IL + LP+ L++++CC       + EY++
Sbjct:   55 PSPKVTYKAP-VPTGEVYFADSFDRGSLSGWIL--SKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEP--GVVLQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKK 517          
BLAST of Calnexin vs. Ensembl Mouse
Match: Clgn (calmegin [Source:MGI Symbol;Acc:MGI:107472])

HSP 1 Score: 443.351 bits (1139), Expect = 1.709e-146
Identity = 237/475 (49.89%), Postives = 313/475 (65.89%), Query Frame = 2
Query:  107 INMKLVLFIFALVFMQNTFAEEKIDSAIEEED------ELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEIL--VMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSER 1507
            +  + V     L+F+  T   + +D  +E ED      E N+         K K P+    +YFT+  D   +   V+S A KD +   IA Y+G W +E    + +  D  LVLKSKA+H AI+A L +PF F+    ++QYEV FQ+G +CGGAY+KLL+D+  L L+ F+DKT YTIMFGPD+CG D K+H IF+HKHPKTG +EEKH+K    DL   FTD+KTHLYTLV+N D+TFE+ +DQ ++N G+LL D  P +NPP+EIDDP D KP +WDD  KI DP AV+P DWD++ P  IED  AVKP+GWL++EP  IP+ K+EKP+DW D+MDGEWEAP I NP C+   GCG WK P I NP YKGIW PPMI+NP Y+G+W  ++IPN DYFED HP+ +T   A+GLELWSM+ +I FDNFII   K+ AD++A + W +K       +P   V+  +  A  ER
Sbjct:    1 MRFQGVGLCLGLLFI--TVNADFMDDGVEVEDFSENSDESNIKDEPSSGTFKYKTPQPIGEVYFTETFDSGNLAGWVLSKAKKDDMDSEIAIYDGRWEIEELKENQVPGDRGLVLKSKAKHHAIAAVLEKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTGDLILENFYDKTSYTIMFGPDKCGEDYKLHLIFRHKHPKTGVFEEKHAKPPDVDLKEFFTDRKTHLYTLVMNPDDTFEVLIDQKVVNQGTLLDDVVPPINPPREIDDPSDKKPEEWDDRAKIPDPTAVRPEDWDENEPAQIEDSSAVKPDGWLDDEPKFIPNPKAEKPEDWSDDMDGEWEAPHIPNPACQ--IGCGEWKPPMIDNPKYKGIWRPPMINNPNYQGLWSPQKIPNPDYFEDDHPFLLTSFSALGLELWSMTPDIYFDNFIICSEKEVADQWATDGWELKIMVANANEP--GVLRQLVIAAEER 469          
BLAST of Calnexin vs. Ensembl Mouse
Match: Clgn (calmegin [Source:MGI Symbol;Acc:MGI:107472])

HSP 1 Score: 443.351 bits (1139), Expect = 1.709e-146
Identity = 237/475 (49.89%), Postives = 313/475 (65.89%), Query Frame = 2
Query:  107 INMKLVLFIFALVFMQNTFAEEKIDSAIEEED------ELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEIL--VMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSER 1507
            +  + V     L+F+  T   + +D  +E ED      E N+         K K P+    +YFT+  D   +   V+S A KD +   IA Y+G W +E    + +  D  LVLKSKA+H AI+A L +PF F+    ++QYEV FQ+G +CGGAY+KLL+D+  L L+ F+DKT YTIMFGPD+CG D K+H IF+HKHPKTG +EEKH+K    DL   FTD+KTHLYTLV+N D+TFE+ +DQ ++N G+LL D  P +NPP+EIDDP D KP +WDD  KI DP AV+P DWD++ P  IED  AVKP+GWL++EP  IP+ K+EKP+DW D+MDGEWEAP I NP C+   GCG WK P I NP YKGIW PPMI+NP Y+G+W  ++IPN DYFED HP+ +T   A+GLELWSM+ +I FDNFII   K+ AD++A + W +K       +P   V+  +  A  ER
Sbjct:    1 MRFQGVGLCLGLLFI--TVNADFMDDGVEVEDFSENSDESNIKDEPSSGTFKYKTPQPIGEVYFTETFDSGNLAGWVLSKAKKDDMDSEIAIYDGRWEIEELKENQVPGDRGLVLKSKAKHHAIAAVLEKPFIFADKPLIVQYEVNFQDGIDCGGAYIKLLADTGDLILENFYDKTSYTIMFGPDKCGEDYKLHLIFRHKHPKTGVFEEKHAKPPDVDLKEFFTDRKTHLYTLVMNPDDTFEVLIDQKVVNQGTLLDDVVPPINPPREIDDPSDKKPEEWDDRAKIPDPTAVRPEDWDENEPAQIEDSSAVKPDGWLDDEPKFIPNPKAEKPEDWSDDMDGEWEAPHIPNPACQ--IGCGEWKPPMIDNPKYKGIWRPPMINNPNYQGLWSPQKIPNPDYFEDDHPFLLTSFSALGLELWSMTPDIYFDNFIICSEKEVADQWATDGWELKIMVANANEP--GVLRQLVIAAEER 469          
BLAST of Calnexin vs. Ensembl Mouse
Match: Calr (calreticulin [Source:MGI Symbol;Acc:MGI:88252])

HSP 1 Score: 209.92 bits (533), Expect = 4.770e-60
Identity = 134/352 (38.07%), Postives = 176/352 (50.00%), Query Frame = 2
Query:  401 IEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCG-NDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERR 1453
            +E D  L     AR  A+SAK   PF       V+Q+ VK +   +CGG YVKL            H  ++Y IMFGPD CG    KVH IF +K               + D+ R   D+ THLYTL++  DNT+E+ +D + + SGSL  D++    PPK+I DP   KP DWD+  KI DP   KP DWD                     +P  IPD  ++KP+DWD+EMDGEWE P I                   +NP YKG W P  IDNP YKG W    I N +Y  DA+ Y       +GL+LW +     FDNF+I +++  A+EF  ETW + K AE++
Sbjct:   60 LEKDKGLQTSQDARFYALSAKF-EPFSNKGQTLVVQFTVKHEQNIDCGGGYVKLFPSGLDQK--DMHGDSEYNIMFGPDICGPGTKKVHVIFNYKGKNV---------LINKDI-RCKDDEFTHLYTLIVRPDNTYEVKIDNSQVESGSLEDDWD--FLPPKKIKDPDAAKPEDWDERAKIDDPTDSKPEDWD---------------------KPEHIPDPDAKKPEDWDEEMDGEWEPPVI-------------------QNPEYKGEWKPRQIDNPDYKGTWIHPEIDNPEYSPDANIYAYDSFAVLGLDLWQVKSGTIFDNFLITNDEAYAEEFGNETWGVTKAAEKQ 356          
BLAST of Calnexin vs. UniProt/SwissProt
Match: sp|P35565|CALX_RAT (Calnexin OS=Rattus norvegicus OX=10116 GN=Canx PE=1 SV=1)

HSP 1 Score: 489.574 bits (1259), Expect = 7.283e-164
Identity = 269/468 (57.48%), Postives = 343/468 (73.29%), Query Frame = 2
Query:  218 PAQKLKFTKPKVP--ENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            P+ K+ +  P VP  E YF   F + S    IL  S A KD   D IAKY+G W V+    + +  D  LVL S+A+H AISAKLN+PF F T   ++QYEV FQNG ECGGAYVKLLS +  LNL QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG YEEKH+K+  +DL  +FTDKKTHLYTL++N DN+FEI VDQ+++NSG+LL D  P VNP +EI+DP+D KP DWD+ PKIADP+AVKP DWD+ AP  I DE+A KPEGWL++EP  IPD  +EKP+DWD++MDGEWEAP+I NP C+ APGCG W+ P I NP+YKG W PPMIDNP Y+G+WK R+IPN D+FED  P++MTP  AIGLELWSM+ +I FDNFII  +++  D++A + W +KK A+  A+P   VV  + EA  ERPWLW+V IL + LP+ L++++CC       + EY++
Sbjct:   55 PSPKVTYKAP-VPTGEVYFADSFDRGSLSGWIL--SKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTSELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEP--GVVGQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKK 517          
BLAST of Calnexin vs. UniProt/SwissProt
Match: sp|P35564|CALX_MOUSE (Calnexin OS=Mus musculus OX=10090 GN=Canx PE=1 SV=1)

HSP 1 Score: 489.574 bits (1259), Expect = 8.202e-164
Identity = 269/468 (57.48%), Postives = 343/468 (73.29%), Query Frame = 2
Query:  218 PAQKLKFTKPKVP--ENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            P+ K+ +  P VP  E YF   F + S    IL  S A KD   D IAKY+G W V+    + +  D  LVL S+A+H AISAKLN+PF F T   ++QYEV FQNG ECGGAYVKLLS +  L+L QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG YEEKH+K+  +DL  +FTDKKTHLYTL++N DN+FEI VDQ+++NSG+LL D  P VNP +EI+DP+D KP DWD+ PKIADP+AVKP DWD+ AP  I DE+A KPEGWL++EP  IPD  +EKP+DWD++MDGEWEAP+I NP C+ APGCG W+ P I NP+YKG W PPMIDNP Y+G+WK R+IPN D+FED  P+KMTP  AIGLELWSM+ +I FDNFII  +++  D++A + W +KK A+  A+P   VV  + EA  ERPWLW+V IL + LP+ L++++CC       + EY++
Sbjct:   55 PSPKVTYKAP-VPTGEVYFADSFDRGSLSGWIL--SKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTAELSLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIADPDAVKPDDWDEDAPSKIPDEEATKPEGWLDDEPEYIPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIISGDRRVVDDWANDGWGLKKAADGAAEP--GVVLQMLEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQSNAMEYKK 517          
BLAST of Calnexin vs. UniProt/SwissProt
Match: sp|P27824|CALX_HUMAN (Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2)

HSP 1 Score: 486.493 bits (1251), Expect = 1.259e-162
Identity = 261/450 (58.00%), Postives = 332/450 (73.78%), Query Frame = 2
Query:  272 MYFTKPSDLAEI--LVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            +YF    D   +   ++S A KD   D IAKY+G W VE    S +  D  LVL S+A+H AISAKLN+PF F T   ++QYEV FQNG ECGGAYVKLLS +  LNL QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG YEEKH+K+  +DL  +FTDKKTHLYTL++N DN+FEI VDQ+++NSG+LL D  P VNP +EI+DP+D KP DWD+ PKI DPEAVKP DWD+ AP  I DE+A KPEGWL++EP  +PD  +EKP+DWD++MDGEWEAP+I NP C+ APGCG W+ P I NP+YKG W PPMIDNP Y+G+WK R+IPN D+FED  P++MTP  AIGLELWSM+ +I FDNFII  +++  D++A + W +KK A+  A+P   VV  + EA  ERPWLW+V IL + LP+ L++++CC         EY++
Sbjct:   69 VYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVEEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPRCESAPGCGVWQRPVIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEP--GVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQTSGMEYKK 516          
BLAST of Calnexin vs. UniProt/SwissProt
Match: sp|Q5R440|CALX_PONAB (Calnexin OS=Pongo abelii OX=9601 GN=CANX PE=2 SV=2)

HSP 1 Score: 485.723 bits (1249), Expect = 2.256e-162
Identity = 260/450 (57.78%), Postives = 333/450 (74.00%), Query Frame = 2
Query:  272 MYFTKPSDLAEI--LVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            +YF    D   +   ++S A KD   D IAKY+G W V+    S +  D  LVL S+A+H AISAKLN+PF F T   ++QYEV FQNG ECGGAYVKLLS +  LNL QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG YEEKH+K+  +DL  +FTDKKTHLYTL++N DN+FEI VDQ+++NSG+LL D  P VNP +EI+DP+D KP DWD+ PKI DPEAVKP DWD+ AP  I DE+A KPEGWL++EP  +PD  +EKP+DWD++MDGEWEAP+I NP C+ APGCG W+ P I NP+YKG W PPMIDNP Y+G+WK R+IPN D+FED  P++MTP  AIGLELWSM+ +I FDNFII  +++  D++A + W +KK A+  A+P   VV  + EA  ERPWLW+V IL + LP+ L++++CC       + EY++
Sbjct:   69 VYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKESKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGIYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSREIEDPEDRKPEDWDERPKIPDPEAVKPDDWDEDAPAKIPDEEATKPEGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPSYQGIWKPRKIPNPDFFEDLEPFRMTPFSAIGLELWSMTSDIFFDNFIICADRRIVDDWANDGWGLKKAADGAAEP--GVVGQMIEAAEERPWLWVVYILTVALPVFLVILFCCSGKKQTSAMEYKK 516          
BLAST of Calnexin vs. UniProt/SwissProt
Match: sp|P24643|CALX_CANLF (Calnexin OS=Canis lupus familiaris OX=9615 GN=CANX PE=1 SV=3)

HSP 1 Score: 481.485 bits (1238), Expect = 1.159e-160
Identity = 255/450 (56.67%), Postives = 332/450 (73.78%), Query Frame = 2
Query:  272 MYFTKPSDLAEI--LVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYER 1615
            +YF    D   +   ++S A KD   D IAKY+G W V+    + +  D  LVL S+A+H AISAKLN+PF F T   ++QYEV FQNG ECGGAYVKLLS +  LNL QFHDKT YTIMFGPD+CG D K+HFIF+HK+PKTG YEEKH+K+  +DL  +FTDKKTHLYTL++N DN+FEI VDQ+++NSG+LL D  P VNP +EI+DP+D KP DWD+ PKI DP+AVKP DW++ AP  I DE+A KP+GWL++EP  +PD  +EKP+DWD++MDGEWEAP+I NP C+ APGCG W+ P I NP+YKG W PPMIDNP Y+G+WK R+IPN D+FED  P+KMTP  AIGLELWSM+ +I FDNFI+  +++  D++A + W +KK A+  A+P   VV  + EA  ERPWLW+V +L + LP+ L++++CC         EY++
Sbjct:   70 VYFADSFDRGTLSGWILSKAKKDDTDDEIAKYDGKWEVDEMKETKLPGDKGLVLMSRAKHHAISAKLNKPFLFDTKPLIVQYEVNFQNGIECGGAYVKLLSKTPELNLDQFHDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGVYEEKHAKRPDADLKTYFTDKKTHLYTLILNPDNSFEILVDQSIVNSGNLLNDMTPPVNPSREIEDPEDQKPEDWDERPKIPDPDAVKPDDWNEDAPAKIPDEEATKPDGWLDDEPEYVPDPDAEKPEDWDEDMDGEWEAPQIANPKCESAPGCGVWQRPMIDNPNYKGKWKPPMIDNPNYQGIWKPRKIPNPDFFEDLEPFKMTPFSAIGLELWSMTSDIFFDNFIVCGDRRVVDDWANDGWGLKKAADGAAEP--GVVGQMIEAAEERPWLWVVYVLTVALPVFLVILFCCSGKKQSSPVEYKK 517          
BLAST of Calnexin vs. TrEMBL
Match: A0A1I8IM21 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 569.696 bits (1467), Expect = 0.000e+0
Identity = 294/461 (63.77%), Postives = 373/461 (80.91%), Query Frame = 2
Query:  212 VTPAQKLKFTKPKVPE-NYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFST--NQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNA-SVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRS 1582
              P  K  FT PKVP  +Y+  +FT PS+LAE LV+S + K+GV  +++KY+G WSVEVP +S I+ DFALVLKSKA+H A+SAKL +PF F     QFV+QYEVKFQNG +CGGAYVKLL+D   ++LK+F+DKT YTIMFGPD+CG D+K+HFI +HK+PK+GK EEKH+KK  +DLD +F DK+THLYTLV+NSDN+FE++VD++L+NSGSLL+D +P VNPPKEIDDP D KPADWD+  KI DP+AVKP DWD++ PE+IED +AV P+GWL +EPLT+PD K+EKPKDWD++MDG WE  ++DNP CK+APGCGPW  PK+KNP YKG W+ PMIDNP YKG+WK R IPN DYFED  P++  PIGAIG ELWSM+D + FDN +IVD K  AD+FA +TW +K++AER ADP A SVVDA+R+AT +RPW+W V+++VI LP +LL+VYCCR 
Sbjct:   52 TAPPAKPVFTPPKVPAGSYYAQFFTAPSNLAEQLVLSKSKKEGVDSDLSKYDGFWSVEVPESSAIDADFALVLKSKAKHHAVSAKLAKPFAFDQPGKQFVMQYEVKFQNGMDCGGAYVKLLTDGPGMDLKEFNDKTPYTIMFGPDKCGMDHKLHFILRHKNPKSGKIEEKHAKKPKADLDSYFNDKRTHLYTLVLNSDNSFEVYVDRSLVNSGSLLEDMQPPVNPPKEIDDPNDKKPADWDEREKIPDPKAVKPDDWDETQPEFIEDAEAVMPQGWLVDEPLTVPDPKAEKPKDWDEDMDGSWEPAQVDNPKCKEAPGCGPWTRPKVKNPKYKGKWSAPMIDNPAYKGIWKPRVIPNPDYFEDKEPWRFAPIGAIGFELWSMNDGVVFDNLLIVDRKSLADDFAEQTWTVKREAERLADPGAQSVVDAVRDATKDRPWIWAVLLMVIALPAVLLIVYCCRG 512          
BLAST of Calnexin vs. TrEMBL
Match: A0A267H5K1 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033895g1 PE=3 SV=1)

HSP 1 Score: 569.311 bits (1466), Expect = 0.000e+0
Identity = 294/461 (63.77%), Postives = 373/461 (80.91%), Query Frame = 2
Query:  212 VTPAQKLKFTKPKVPE-NYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFST--NQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNA-SVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRS 1582
              P  K  FT PKVP  +Y+  +FT PS+LAE LV+S + K+GV  +++KY+G WSVEVP +S I+ DFALVLKSKA+H A+SAKL +PF F     QFV+QYEVKFQNG +CGGAYVKLL+D   ++LK+F+DKT YTIMFGPD+CG D+K+HFI +HK+PK+GK EEKH+KK  +DLD +F DK+THLYTLV+NSDN+FE++VD++L+NSGSLL+D +P VNPPKEIDDP D KPADWD+  KI DP+AVKP DWD++ PE+IED +AV P+GWL +EPLT+PD K+EKPKDWD++MDG WE  ++DNP CK+APGCGPW  PK+KNP YKG W+ PMIDNP YKG+WK R IPN DYFED  P++  PIGAIG ELWSM+D + FDN +IVD K  AD+FA +TW +K++AER ADP A SVVDA+R+AT +RPW+W V+++VI LP +LL+VYCCR 
Sbjct:   55 TAPPAKPVFTPPKVPAGSYYAQFFTAPSNLAEQLVLSKSKKEGVDSDLSKYDGFWSVEVPESSAIDADFALVLKSKAKHHAVSAKLAKPFAFDQPGKQFVMQYEVKFQNGMDCGGAYVKLLTDGPGMDLKEFNDKTPYTIMFGPDKCGMDHKLHFILRHKNPKSGKIEEKHAKKPKADLDSYFNDKRTHLYTLVLNSDNSFEVYVDRSLVNSGSLLEDMQPPVNPPKEIDDPNDKKPADWDEREKIPDPKAVKPDDWDETQPEFIEDAEAVMPQGWLVDEPLTVPDPKAEKPKDWDEDMDGSWEPAQVDNPKCKEAPGCGPWTRPKVKNPKYKGKWSAPMIDNPAYKGIWKPRVIPNPDYFEDKEPWRFAPIGAIGFELWSMNDGVVFDNLLIVDRKSLADDFAEQTWTVKREAERLADPGAQSVVDAVRDATKDRPWIWAVLLMVIALPAVLLIVYCCRG 515          
BLAST of Calnexin vs. TrEMBL
Match: A0A267F7K2 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031555g1 PE=3 SV=1)

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 295/461 (63.99%), Postives = 372/461 (80.69%), Query Frame = 2
Query:  212 VTPAQKLKFTKPKVPEN-YFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFST--NQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNA-SVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRS 1582
              P  K  FT PKVP   Y+  +FT PS+LAE LV+S + K+GV  +++KY+G WSVEVP +S I+ DFALVLKSKA+H A+SAKL +PF F     QFV+QYEVKFQNG +CGGAYVKLL+D   ++LK+F+DKT YTIMFGPD+CG D+K+HFI +HK+PK+GK EEKH+KK  +DLD +F DK+THLYTLV+NSDN+FE++VD++L+NSGSLL+D +P VNPPKEIDDP D KPADWD+  KI DP+AVKP DWD++ PE+IED +AV P+GWL +EPLT+PD K+EKPKDWD++MDG WE  ++DNP CK+APGCGPW  PK+KNP YKG W+ PMIDNP YKG+WK R IPN DYFED  P++  PIGAIG ELWSM+D + FDN +IVD K  AD+FA +TW +K++AER ADP A SVVDA+R+AT +RPW+W V++LVI LP +LL+VYCCR 
Sbjct:   54 AAPPAKPVFTPPKVPAGAYYAQFFTAPSNLAEQLVLSKSKKEGVDSDLSKYDGFWSVEVPESSAIDADFALVLKSKAKHHAVSAKLAKPFAFDQPGKQFVMQYEVKFQNGMDCGGAYVKLLTDGPGMDLKEFNDKTPYTIMFGPDKCGMDHKLHFILRHKNPKSGKIEEKHAKKPKADLDSYFNDKRTHLYTLVLNSDNSFEVYVDRSLVNSGSLLEDMQPPVNPPKEIDDPNDKKPADWDEREKIPDPKAVKPDDWDETQPEFIEDAEAVMPQGWLVDEPLTVPDPKAEKPKDWDEDMDGSWEPAQVDNPKCKEAPGCGPWTRPKVKNPKYKGKWSAPMIDNPAYKGIWKPRVIPNPDYFEDKEPWRFAPIGAIGFELWSMNDGVVFDNLLIVDRKSLADDFAEQTWTVKREAERLADPGAQSVVDAVRDATKDRPWIWAVLLLVIALPAVLLIVYCCRG 514          
BLAST of Calnexin vs. TrEMBL
Match: A0A1I8GKN1 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 568.926 bits (1465), Expect = 0.000e+0
Identity = 295/461 (63.99%), Postives = 372/461 (80.69%), Query Frame = 2
Query:  212 VTPAQKLKFTKPKVPEN-YFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFST--NQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNA-SVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRS 1582
              P  K  FT PKVP   Y+  +FT PS+LAE LV+S + K+GV  +++KY+G WSVEVP +S I+ DFALVLKSKA+H A+SAKL +PF F     QFV+QYEVKFQNG +CGGAYVKLL+D   ++LK+F+DKT YTIMFGPD+CG D+K+HFI +HK+PK+GK EEKH+KK  +DLD +F DK+THLYTLV+NSDN+FE++VD++L+NSGSLL+D +P VNPPKEIDDP D KPADWD+  KI DP+AVKP DWD++ PE+IED +AV P+GWL +EPLT+PD K+EKPKDWD++MDG WE  ++DNP CK+APGCGPW  PK+KNP YKG W+ PMIDNP YKG+WK R IPN DYFED  P++  PIGAIG ELWSM+D + FDN +IVD K  AD+FA +TW +K++AER ADP A SVVDA+R+AT +RPW+W V++LVI LP +LL+VYCCR 
Sbjct:   52 AAPPAKPVFTPPKVPAGAYYAQFFTAPSNLAEQLVLSKSKKEGVDSDLSKYDGFWSVEVPESSAIDADFALVLKSKAKHHAVSAKLAKPFAFDQPGKQFVMQYEVKFQNGMDCGGAYVKLLTDGPGMDLKEFNDKTPYTIMFGPDKCGMDHKLHFILRHKNPKSGKIEEKHAKKPKADLDSYFNDKRTHLYTLVLNSDNSFEVYVDRSLVNSGSLLEDMQPPVNPPKEIDDPNDKKPADWDEREKIPDPKAVKPDDWDETQPEFIEDAEAVMPQGWLVDEPLTVPDPKAEKPKDWDEDMDGSWEPAQVDNPKCKEAPGCGPWTRPKVKNPKYKGKWSAPMIDNPAYKGIWKPRVIPNPDYFEDKEPWRFAPIGAIGFELWSMNDGVVFDNLLIVDRKSLADDFAEQTWTVKREAERLADPGAQSVVDAVRDATKDRPWIWAVLLLVIALPAVLLIVYCCRG 512          
BLAST of Calnexin vs. TrEMBL
Match: A0A0X3NKP9 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR159347 PE=3 SV=1)

HSP 1 Score: 542.347 bits (1396), Expect = 0.000e+0
Identity = 282/470 (60.00%), Postives = 356/470 (75.74%), Query Frame = 2
Query:  200 DELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNA-SVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAE 1606
            DE   +P + L F  P++P++  +  +    D  E  V+S A K+GV D IAKY+G+W +E+PS+S I+ D  L+LKSK +H AI+  L + F F+ N+FV+QYEV F  G  CGG YVKLLS S  L+L QFHDKT YTIMFGPD+CG D K+HFIF+H++PKTG  EEKH+K+SS  LD +F+DKKTHLYTLV+ SDN+FEI+VDQTL+NSG+LLKD  P VNPP EIDDP D KPADWDD  KI DP A KP DWD++APE+I DE AV PEGWLENEP  IPDE S+KP DWDD  DGEWEAP+I+NP CKDAPGCG W  P +KNP YKG W+PP+I NP YKG W  +RIPN D++ED  PYKMTPI A+GLELWS+SD+IAFDNF I  +KK AD+FAA+TW +K  AE  AD +A SVVDAI+E  SE+PW+  +++L +++P++L+ ++CCRSS  +  +E
Sbjct:   89 DEEASSPTKPL-FAPPRIPDDAVLAVYFDSGDDMEKFVLSKAKKEGVEDAIAKYDGLWDIEIPSSSAIDGDHYLILKSKNKHHAIATDLGKEFQFTGNEFVLQYEVNFLEGISCGGGYVKLLSASPNLDLTQFHDKTPYTIMFGPDKCGMDMKIHFIFRHRNPKTGVIEEKHAKQSSKSLDTYFSDKKTHLYTLVVRSDNSFEIYVDQTLVNSGNLLKDVNPPVNPPNEIDDPNDKKPADWDDRAKIPDPTAKKPDDWDETAPEFIIDEDAVMPEGWLENEPTLIPDESSKKPDDWDDATDGEWEAPKIENPACKDAPGCGKWSKPLVKNPKYKGKWSPPLISNPAYKGEWHPKRIPNPDFYEDKEPYKMTPIRALGLELWSLSDQIAFDNFYIGTSKKGADDFAAQTWALKHSAELAADTSAKSVVDAIKEVVSEKPWVVALVLLAVLVPLLLICIFCCRSSPEETPSE 557          
BLAST of Calnexin vs. Ensembl Cavefish
Match: canx (calnexin [Source:NCBI gene;Acc:103032947])

HSP 1 Score: 474.167 bits (1219), Expect = 1.403e-158
Identity = 266/493 (53.96%), Postives = 349/493 (70.79%), Query Frame = 2
Query:  149 MQNTFAEEKIDSAIEEEDELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEI--LVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCC--RSSGSDKSAEYER 1615
            + N   EE +D  +EEE++    PA     T  K PE     +F +  D   +   V+S A K+ + + IAKY+G W VE    + +  D  LVLKS+A+H AISA L RPF F T   ++QYEV FQ G +CGGAYVKLLS S  L+L +F DKT YTIMFGPD+CG D K+HFIF+HK+PKTG++EEKH+KK  SDL  ++TDKKTHLYTLV+N DN+FEI +DQT++NSG+LL D  P VNPP EI+DP D KP DWD+ PKI DP+AVKP DWD+ AP  I DE AVKP+GWL++EP  I D  + KP+DWD++MDGEWEAP++ NP C+ APGCG W+ P I NP+YKG W  PMIDNP Y+GVWK R+IPN D+FED HP++MTP  A+GLELWSMS +I FDNF I  ++  A+ +A E W +KK AE  A+P   +++ +  A  ERPWLW+V +L + LP++L++V+CC  +   +  +AEY++
Sbjct:   40 LGNLEDEELLDGGMEEEEKSAPAPASAPTVTY-KAPEPKGEHFFAESFDKGTLDGWVVSKAKKEDIDEEIAKYDGKWEVEELKDTKLPGDKGLVLKSRAKHHAISALLLRPFTFDTKPLIVQYEVNFQTGIDCGGAYVKLLSQSPDLDLDEFVDKTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGEFEEKHAKKPESDLRTYYTDKKTHLYTLVLNPDNSFEILIDQTVVNSGNLLTDMTPPVNPPAEIEDPDDHKPEDWDERPKIQDPDAVKPEDWDEDAPAKISDEDAVKPDGWLDDEPEYIGDPDAIKPEDWDEDMDGEWEAPQVPNPACESAPGCGKWERPTIDNPNYKGKWKAPMIDNPNYQGVWKPRKIPNPDFFEDLHPFRMTPFSAVGLELWSMSSDIFFDNFFITYDRNTAERWAEEGWGLKKAAEGAAEP--GLMNQMISAAEERPWLWVVYVLTVALPLVLVIVFCCTGKKKSAPSAAEYKK 529          
BLAST of Calnexin vs. Ensembl Cavefish
Match: clgn (calnexin [Source:NCBI gene;Acc:103035256])

HSP 1 Score: 439.113 bits (1128), Expect = 3.627e-145
Identity = 223/397 (56.17%), Postives = 290/397 (73.05%), Query Frame = 2
Query:  317 SDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSER 1507
            S  MK+   ++IAKY+G W VE    + +  D  LVLKS+A+H AIS+ L++P+ F     V+QYEV FQ+G +CGGAY+KLLSDS  L+L+QFHD+T Y+IMFGPD+CG D K+HFIF+HK+P    +EEKH+K++ +DL + ++DKKTHL+TLV+N DN++EIF+DQ+  + G+LL D  P VNPPKEIDDPKD KP DWD+  KI DPEAVKP DWD+ AP  I D  A+KP+GWL+ EP  +PD  + KP DWD+EMDGEWEAP++ NP C+ APGCG WKSP I NP YKG W  P+IDNP Y+GVW  R+I N DYFED  P+KMT + A+GLELWSM+ +I FDNFII  +K+ AD +AA++W +KK      +P   V   +  A  ER
Sbjct:   88 SKTMKEDADEDIAKYDGKWEVEALKENKVPGDLGLVLKSRAKHHAISSPLSKPYIFKDRPLVVQYEVNFQDGIDCGGAYIKLLSDSPDLDLEQFHDRTPYSIMFGPDKCGEDYKLHFIFRHKNPLNEDFEEKHAKRADADLRKVYSDKKTHLFTLVLNPDNSYEIFIDQSSASKGNLLTDVIPPVNPPKEIDDPKDTKPEDWDERAKIPDPEAVKPDDWDEEAPAMIPDPDALKPDGWLDEEPEFVPDPTATKPDDWDEEMDGEWEAPQVPNPACQTAPGCGEWKSPTINNPKYKGKWKAPLIDNPNYQGVWSPRKILNPDYFEDLEPFKMTAVRAVGLELWSMTSDIYFDNFIITADKEVADRWAADSWGLKKLVASANEPG--VFTQLTLAAEER 482          
BLAST of Calnexin vs. Ensembl Cavefish
Match: clgn (calnexin [Source:NCBI gene;Acc:103035256])

HSP 1 Score: 440.269 bits (1131), Expect = 5.356e-145
Identity = 223/397 (56.17%), Postives = 290/397 (73.05%), Query Frame = 2
Query:  317 SDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSER 1507
            S  MK+   ++IAKY+G W VE    + +  D  LVLKS+A+H AIS+ L++P+ F     V+QYEV FQ+G +CGGAY+KLLSDS  L+L+QFHD+T Y+IMFGPD+CG D K+HFIF+HK+P    +EEKH+K++ +DL + ++DKKTHL+TLV+N DN++EIF+DQ+  + G+LL D  P VNPPKEIDDPKD KP DWD+  KI DPEAVKP DWD+ AP  I D  A+KP+GWL+ EP  +PD  + KP DWD+EMDGEWEAP++ NP C+ APGCG WKSP I NP YKG W  P+IDNP Y+GVW  R+I N DYFED  P+KMT + A+GLELWSM+ +I FDNFII  +K+ AD +AA++W +KK      +P   V   +  A  ER
Sbjct:  101 SKTMKEDADEDIAKYDGKWEVEALKENKVPGDLGLVLKSRAKHHAISSPLSKPYIFKDRPLVVQYEVNFQDGIDCGGAYIKLLSDSPDLDLEQFHDRTPYSIMFGPDKCGEDYKLHFIFRHKNPLNEDFEEKHAKRADADLRKVYSDKKTHLFTLVLNPDNSYEIFIDQSSASKGNLLTDVIPPVNPPKEIDDPKDTKPEDWDERAKIPDPEAVKPDDWDEEAPAMIPDPDALKPDGWLDEEPEFVPDPTATKPDDWDEEMDGEWEAPQVPNPACQTAPGCGEWKSPTINNPKYKGKWKAPLIDNPNYQGVWSPRKILNPDYFEDLEPFKMTAVRAVGLELWSMTSDIYFDNFIITADKEVADRWAADSWGLKKLVASANEP--GVFTQLTLAAEER 495          
BLAST of Calnexin vs. Ensembl Cavefish
Match: clgn (calnexin [Source:NCBI gene;Acc:103035256])

HSP 1 Score: 439.113 bits (1128), Expect = 9.781e-145
Identity = 223/397 (56.17%), Postives = 290/397 (73.05%), Query Frame = 2
Query:  317 SDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSER 1507
            S  MK+   ++IAKY+G W VE    + +  D  LVLKS+A+H AIS+ L++P+ F     V+QYEV FQ+G +CGGAY+KLLSDS  L+L+QFHD+T Y+IMFGPD+CG D K+HFIF+HK+P    +EEKH+K++ +DL + ++DKKTHL+TLV+N DN++EIF+DQ+  + G+LL D  P VNPPKEIDDPKD KP DWD+  KI DPEAVKP DWD+ AP  I D  A+KP+GWL+ EP  +PD  + KP DWD+EMDGEWEAP++ NP C+ APGCG WKSP I NP YKG W  P+IDNP Y+GVW  R+I N DYFED  P+KMT + A+GLELWSM+ +I FDNFII  +K+ AD +AA++W +KK      +P   V   +  A  ER
Sbjct:   88 SKTMKEDADEDIAKYDGKWEVEALKENKVPGDLGLVLKSRAKHHAISSPLSKPYIFKDRPLVVQYEVNFQDGIDCGGAYIKLLSDSPDLDLEQFHDRTPYSIMFGPDKCGEDYKLHFIFRHKNPLNEDFEEKHAKRADADLRKVYSDKKTHLFTLVLNPDNSYEIFIDQSSASKGNLLTDVIPPVNPPKEIDDPKDTKPEDWDERAKIPDPEAVKPDDWDEEAPAMIPDPDALKPDGWLDEEPEFVPDPTATKPDDWDEEMDGEWEAPQVPNPACQTAPGCGEWKSPTINNPKYKGKWKAPLIDNPNYQGVWSPRKILNPDYFEDLEPFKMTAVRAVGLELWSMTSDIYFDNFIITADKEVADRWAADSWGLKKLVASANEP--GVFTQLTLAAEER 482          
BLAST of Calnexin vs. Ensembl Cavefish
Match: canx (calnexin [Source:NCBI gene;Acc:103032947])

HSP 1 Score: 422.935 bits (1086), Expect = 3.289e-139
Identity = 243/493 (49.29%), Postives = 318/493 (64.50%), Query Frame = 2
Query:  149 MQNTFAEEKIDSAIEEEDELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEI--LVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCC--RSSGSDKSAEYER 1615
            + N   EE +D  +EEE++    PA     T  K PE     +F +  D   +   V+S A K+ + + IAKY+G W VE    + +  D  LVLKS+A+H AISA L RPF F T   ++QYEV FQ G +CGGAYVKLLS S  L+L +F DKT YTIMFGPD+C                                     DKKTHLYTLV+N DN+FEI +DQT++NSG+LL D  P VNPP EI+DP D KP DWD+ PKI DP+AVKP DWD+ AP  I DE AVKP+GWL++EP  I D  + KP+DWD++MDGEWEAP++ NP C+ APGCG W+ P I NP+YKG W  PMIDNP Y+GVWK R+IPN D+FED HP++MTP  A+GLELWSMS +I FDNF I  ++  A+ +A E W +KK AE  A+P   +++ +  A  ERPWLW+V +L + LP++L++V+CC  +   +  +AEY++
Sbjct:   40 LGNLEDEELLDGGMEEEEKSAPAPASAPTVTY-KAPEPKGEHFFAESFDKGTLDGWVVSKAKKEDIDEEIAKYDGKWEVEELKDTKLPGDKGLVLKSRAKHHAISALLLRPFTFDTKPLIVQYEVNFQTGIDCGGAYVKLLSQSPDLDLDEFVDKTPYTIMFGPDKC-------------------------------------DKKTHLYTLVLNPDNSFEILIDQTVVNSGNLLTDMTPPVNPPAEIEDPDDHKPEDWDERPKIQDPDAVKPEDWDEDAPAKISDEDAVKPDGWLDDEPEYIGDPDAIKPEDWDEDMDGEWEAPQVPNPACESAPGCGKWERPTIDNPNYKGKWKAPMIDNPNYQGVWKPRKIPNPDFFEDLHPFRMTPFSAVGLELWSMSSDIFFDNFFITYDRNTAERWAEEGWGLKKAAEGAAEP--GLMNQMISAAEERPWLWVVYVLTVALPLVLVIVFCCTGKKKSAPSAAEYKK 492          
BLAST of Calnexin vs. Ensembl Sea Lamprey
Match: si:ch211-274f20.2 (si:ch211-274f20.2 [Source:ZFIN;Acc:ZDB-GENE-091204-91])

HSP 1 Score: 442.195 bits (1136), Expect = 2.125e-146
Identity = 229/430 (53.26%), Postives = 304/430 (70.70%), Query Frame = 2
Query:  221 AQKLKFTKPK-VPENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSER 1507
            A K+ +  P  + + YFV  F   S   +  V+S A K+   ++IAKY+G W VE      + DD  LVLK++A+H AI+  L RPF F     ++QYEV FQNG ECGGAYVKLLS +  L+L +F+DKT YTIMFGPD+CG D K+HFI +H++PKTG YEEKH+KKS  DL  ++TDKK HLY+LV++ DN +EI +DQT++ SGSLL+D  P VNP +EI+DP D KP DWD+  KI DP+A+KP DWD+ AP  I D  AVKPEGWL++EP    D ++ KP+DWD+EMDGEWEAP++ NP C+ APGCG WK+P + NP+YKG W P  IDNP Y+GVWK R+I N D+FED HP+++T   AIGLELWSM+ +I FDNFI+   +  AD++AA++W +K+ A    +P   +V  + +A  ER
Sbjct:  100 APKVVYKAPHPIGDTYFVDSFD--SGTLDNWVISKAKKEDTDEDIAKYDGKWLVEEQLDGKLPDDKGLVLKTRAKHHAIAGALTRPFHFIDKPLIVQYEVNFQNGIECGGAYVKLLSGNADLDLTKFYDKTPYTIMFGPDKCGEDYKLHFIMRHRNPKTGTYEEKHAKKSDVDLKPYYTDKKPHLYSLVLSPDNRYEILIDQTVVGSGSLLEDMTPPVNPAREIEDPDDSKPEDWDERAKIPDPDAIKPEDWDEDAPAQISDPDAVKPEGWLDDEPEYTADPEAVKPEDWDEEMDGEWEAPQVPNPTCEAAPGCGVWKAPMVSNPAYKGKWKPSNIDNPNYQGVWKPRKIANPDFFEDLHPFRLTAFNAIGLELWSMTSDILFDNFIVCSERAVADQWAADSWGLKRQAAAADEPG--IVMKLYQAAEER 525          
BLAST of Calnexin vs. Ensembl Sea Lamprey
Match: calr (calreticulin [Source:ZFIN;Acc:ZDB-GENE-030131-4042])

HSP 1 Score: 202.986 bits (515), Expect = 1.189e-58
Identity = 134/354 (37.85%), Postives = 179/354 (50.56%), Query Frame = 2
Query:  404 EDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCG-NDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKP---ADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERR 1453
            E D  L     AR  A+SA  +  F       VIQ+ VK +   +CGG Y+KL          + H  +QY IMFGPD CG    KVH IF +K    GK    +      D      D+ THLYTL++  D T+E+ +D   + SGSL +D++  + P K+I DP+  KP DW+D  KI DP  VKP    DW+                     +P  IPD  ++KP+DWDDEMDGEWE P ++NP                    YKG W P  IDNPKYKGVW    I N +Y  D++ Y    IG IGL+LW +     FD+F+I D++K A+    ETW + K+ E++
Sbjct:   62 EKDKGLQTSQDARFYALSAGFDS-FSNKDKTLVIQFTVKHEQNIDCGGGYIKLFPKDMNQE--EMHGDSQYFIMFGPDICGPGTKKVHVIFNYK----GKNHLINKDIRCKD------DEYTHLYTLIVRPDQTYEVKIDNKKVESGSLEEDWD--ILPAKKIKDPEAHKPEDWEDQSKIDDPTDVKPEPTKDWE---------------------KPEHIPDPDAKKPEDWDDEMDGEWEPPMVENP-------------------EYKGEWKPRQIDNPKYKGVWVHPEIDNPEYAPDSNIYLSENIGVIGLDLWQVKSGTIFDSFLITDDEKYAETIGEETWGVTKEGEKK 360          
BLAST of Calnexin vs. Ensembl Sea Lamprey
Match: calr3b (calreticulin 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9907])

HSP 1 Score: 192.971 bits (489), Expect = 1.476e-54
Identity = 128/353 (36.26%), Postives = 175/353 (49.58%), Query Frame = 2
Query:  404 EDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMF--GPDRCG-NDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERR 1453
            E D  L      R  AISA    PF       V+Q+ VK +   +CGG YVKL            H  ++Y +MF  GPD CG    KVH I  +K           +   + D+ R   D+ THLYTLV+  D T+E+ +D   + SGSL  D++  V PP+ ++DP  V+P DWD+ P I DP   K  D               + + W  ++P  IPD  ++KP DWDDEMDGEWE P +                   +NP +K  W P  I NP YKG W   +I N D+  D + Y    IG +GL+LW +     FDNF+I D+++ A+E A +TW + KDAER+
Sbjct:   60 ERDKGLQTTQDVRFYAISAAFP-PFSNKGRTLVLQFSVKHEQDIDCGGGYVKLFPAELDQQ--DMHGDSRYYLMFAEGPDICGPGTKKVHVIINYK---------GKNHLINKDI-RCRDDEFTHLYTLVLRPDQTYEVKIDGERVESGSLEDDWD--VLPPRRVEDPAAVRPDDWDERPSIDDPHDTKKPD---------------RGQDW--DQPEHIPDPDAKKPDDWDDEMDGEWEPPMV-------------------ENPDFKSEWKPKQISNPDYKGTWVHPKIDNPDFASDPNIYYFDNIGVLGLDLWQVKSGTIFDNFLITDDEQYAEEVAKKTWGLTKDAERK 361          
BLAST of Calnexin vs. Ensembl Yeast
Match: CNE1 (Calnexin; integral membrane ER chaperone involved in folding and quality control of glycoproteins; chaperone activity is inhibited by Mpd1p, with which Cne1p interacts; 24% identical to mammalian calnexin; Ca+ binding not yet shown in yeast [Source:SGD;Acc:S000000054])

HSP 1 Score: 171.4 bits (433), Expect = 1.740e-46
Identity = 120/361 (33.24%), Postives = 169/361 (46.81%), Query Frame = 2
Query:  410 DFALVLKSKARHAAISAKLNRPFDFS-TNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFH--DKTQYTIMFGPDRCGND-NKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVIN-SDNTFEIFVDQTLINSGSLLKD-----FEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKM-TPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRAD 1459
            D  + +++    A I   L  P + S T+  V+QYE+K  N   CGGA++KL+S    +   + +  D     ++FGPD C  + N V F        T  +E K        L +     ++HLYTL+I+ S  +F+I +D   +     ++D     FEP + PP  I D    KP DWDD  +I DPEAVK +D D+  P  I      +P  W  + P  I D  ++KP  W +   GEW  P I NP+C    GCG      I N  YKG      I NP Y G W    I N  Y+E+ HP ++   I  + LE WS S  +   N  +  N   A     +TWLM+  A R +D
Sbjct:   81 DKGIAVRTGNAAAMIGHLLETPINVSETDTLVVQYEIKLDNSLTCGGAFIKLMSGFMNVEALKHYAPDTEGVELVFGPDYCAPEINGVQFAINKVDKIT--HESKLRYLQEMPLSKLTDTSQSHLYTLIIDESAQSFQILIDGKTVMVREHIEDKKKVNFEPPITPPLMIPDVSVAKPHDWDDRIRIPDPEAVKLSDRDERDPLMIPHPDGTEPPEWNSSIPEYILDPNAQKPSWWKELEHGEWIPPMIKNPLCTAERGCGQQIPGLINNAKYKGPGELNEIINPNYMGEWHPPEIENPLYYEEQHPLRIENVISGVILEFWSGSPNMLISNIYVGKNVTEAQIIGNKTWLMRDRAFRGSD 439          
BLAST of Calnexin vs. Ensembl Nematostella
Match: EDO49786 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFV3])

HSP 1 Score: 402.519 bits (1033), Expect = 1.211e-133
Identity = 222/400 (55.50%), Postives = 281/400 (70.25%), Query Frame = 2
Query:  308 LVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSER 1507
            +V S A KDGV   IAK++G W+ E PS  + + D  LVLKS+ARH AI+A L++ FDF+   F++QYEVKFQ   ECGGAY+KLLSD      + F DKT YTIMFGPD+CG D K+HFIF+HK+PK G  EEKH+KK + + +  F  KKTHL+TLV+  DNTFE+F+DQ  +N GSLL+D  P VNPP EI+DP D +P DWD+  KI DP+A KP DWD+ AP  I D  A KPEGWL++EP  +PD    KP+DWDDE DGEWEAP+I NP C+   GCG WK P   NP YKG W+ P+IDNP YKG+WK R IPN  +FED  P+KMT I  +GLELWSM+ +I FDN I+ ++K  AD++A ++WL K   E      AS++  + EAT+ER
Sbjct:    1 MVKSQAKKDGVDIAIAKFDGEWAFEEPSAKLFKGDLGLVLKSRARHHAIAAHLDKKFDFTDKPFIVQYEVKFQQPMECGGAYLKLLSDGQGFKPESFGDKTPYTIMFGPDKCGEDRKLHFIFRHKNPKNGTIEEKHAKKPTGNYNSVFDGKKTHLFTLVVRPDNTFEVFIDQESVNKGSLLEDMTPPVNPPAEIEDPDDKRPEDWDEREKIPDPDAEKPDDWDEDAPVKIPDTNAKKPEGWLDDEPEYVPDPNGIKPEDWDDEEDGEWEAPQIANPKCEKV-GCGEWKPPMADNPEYKGKWSAPLIDNPNYKGIWKPRLIPNPHFFEDKEPFKMTSIVGVGLELWSMTSDILFDNVIVTNDKAVADKWAQDSWLKKNVKETYG---ASIISGLMEATNER 396          
BLAST of Calnexin vs. Ensembl Nematostella
Match: EDO48109 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RK57])

HSP 1 Score: 206.838 bits (525), Expect = 4.355e-60
Identity = 132/351 (37.61%), Postives = 172/351 (49.00%), Query Frame = 2
Query:  404 EDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCG-NDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERR 1453
            E D  +     A+   ISAK  +PF       VIQ+ VK +   +CGG Y K+            H  + Y IMFGPD CG    KVH IF +K           +  +  D+ R   D+ THLYTL++  DNT+E+ +D   + SG L KD++    PPK I DP+  KP DWDD   I DPE  KP DWD                     +P  IPD  ++KP+DWDDE+DGEWE P IDNP                    YKG W P  IDNP YKG W    I N +Y  D   Y    IGAIG +LW +     FDN ++ D+ + A++FA ET+   K+ E++
Sbjct:   31 EADKGIQTSEDAKFYGISAKFEKPFTNEGKTLVIQFSVKHEQNIDCGGGYAKVFPSDVDQK--NLHGDSPYLIMFGPDICGPGTKKVHVIFNYK---------GKNLLTKKDI-RCKDDEMTHLYTLIVRPDNTYEVKIDNEKVESGELEKDWD--FLPPKTIKDPEAKKPEDWDDKKMIDDPEDKKPEDWD---------------------KPQNIPDPDAKKPEDWDDEIDGEWEPPMIDNP-------------------EYKGEWKPKQIDNPNYKGEWVHPEIDNPEYKADDKLYMYKDIGAIGFDLWQVKSGTIFDNVLVTDSVEHAEQFAKETFDKTKEGEKK 327          
BLAST of Calnexin vs. Ensembl Medaka
Match: canx (calnexin [Source:NCBI gene;Acc:101165199])

HSP 1 Score: 462.225 bits (1188), Expect = 5.176e-154
Identity = 256/453 (56.51%), Postives = 330/453 (72.85%), Query Frame = 2
Query:  248 KVPENYFVMYFTKPSDLAEI--LVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKS 1600
            K PE     +F +  D   +   V+S A KD   + IAKY+G W+VE    S +  D  LVLKS+A+H AISA+L RPF F T   ++QYEV FQ+G +CGGAYVKLL+++  LNL QF D+T YTIMFGPD+CG D K+HFIF+HK+PKTG+YEEKH+KK  +DL  +FTDKKTHL++LV+N DN+FE+ VDQT++NSG+LLKD  P VNPP EI+DP+D KP DWD+ PKI DP+AVKP DWD+ AP  I D+ AVKP+GWL++EP  I D  + KP DWD++MDGEWEAP+I NP C+ APGCG WK P I NP++KG W  PMIDNP Y+G+WK R+IPN  +FED  P++MT   A+GLELWSM+ +I FDNF I +++  AD +AA+ W +KK AE  A+P  +    +  A  ERPWLWIV +L + LP++LL V+CC  SG  KS
Sbjct:   81 KAPEPVGEHFFAESFDRGTLDGWVLSKAKKDAADEEIAKYDGKWAVEEMKDSKLPGDKGLVLKSRAKHHAISARLLRPFTFDTKPLIVQYEVNFQSGIDCGGAYVKLLTETPELNLDQFVDRTPYTIMFGPDKCGEDYKLHFIFRHKNPKTGEYEEKHAKKPDADLRSYFTDKKTHLFSLVVNPDNSFEVLVDQTVVNSGNLLKDMTPPVNPPAEIEDPEDHKPEDWDERPKIQDPDAVKPEDWDEDAPAQIPDDNAVKPDGWLDDEPEYIGDPDAVKPDDWDEDMDGEWEAPQIPNPACESAPGCGEWKRPMIDNPNHKGKWKAPMIDNPNYQGIWKPRKIPNPAFFEDLEPFRMTAFSAVGLELWSMTSDIFFDNFFITNDRNTADRWAADGWGLKKAAEGAAEPGLAA--QMLTAAEERPWLWIVYVLTVGLPLVLLFVFCC--SGKKKS 529          
BLAST of Calnexin vs. Ensembl Medaka
Match: clgn (calnexin [Source:NCBI gene;Acc:101159642])

HSP 1 Score: 443.351 bits (1139), Expect = 3.899e-146
Identity = 223/398 (56.03%), Postives = 289/398 (72.61%), Query Frame = 2
Query:  314 MSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSER 1507
            +S  MK+   + IAKY+G W+VE    + +  D  LVLKS+A+H AI+A L +PF F     V+QYEV FQ+G +CGGAY+KLLSD+  LNL+QFHD+T YTIMFGPD+CG D K+HFIF+HK+P     EEKH+K++  DL + +TDKKTHLYTLV+N DN++E+F+DQ+ ++ GSLL+D  P VNPPKEIDDP D KP DWD+  KI DPEA KP DWD+ AP  +ED  AVKPEGWL++E   + D  +EKP+DWD+EMDGEWEAP+I NP C+ APGCG WK P I NP YKG W  P++DN  Y+GVWK R+I N DYFED  P++MTP  A+GLELWSM+ +I FDNFII   K+ AD +A+++W +KK      +P   ++  +  A  ER
Sbjct:  113 LSKTMKEDADEEIAKYDGKWAVEQLKENKVPGDLGLVLKSRAKHHAIAAPLVKPFVFQDEPLVVQYEVNFQDGIDCGGAYIKLLSDTGSLNLEQFHDRTPYTIMFGPDKCGEDYKLHFIFRHKNPLNKDMEEKHAKRADVDLKKFYTDKKTHLYTLVLNPDNSYEMFIDQSSVSRGSLLQDVVPPVNPPKEIDDPHDSKPDDWDERAKIPDPEAEKPDDWDEDAPAKVEDPDAVKPEGWLDDELEFVADPNAEKPEDWDEEMDGEWEAPQIPNPACETAPGCGEWKRPMINNPQYKGKWKAPLVDNSNYQGVWKPRKIQNPDYFEDLQPFRMTPFKALGLELWSMTSDIYFDNFIITSQKEVADRWASDSWGLKKLVASANEP--GILAQLTMAAEER 508          
BLAST of Calnexin vs. Ensembl Medaka
Match: clgn (calnexin [Source:NCBI gene;Acc:101159642])

HSP 1 Score: 442.965 bits (1138), Expect = 9.744e-145
Identity = 223/398 (56.03%), Postives = 289/398 (72.61%), Query Frame = 2
Query:  314 MSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSER 1507
            +S  MK+   + IAKY+G W+VE    + +  D  LVLKS+A+H AI+A L +PF F     V+QYEV FQ+G +CGGAY+KLLSD+  LNL+QFHD+T YTIMFGPD+CG D K+HFIF+HK+P     EEKH+K++  DL + +TDKKTHLYTLV+N DN++E+F+DQ+ ++ GSLL+D  P VNPPKEIDDP D KP DWD+  KI DPEA KP DWD+ AP  +ED  AVKPEGWL++E   + D  +EKP+DWD+EMDGEWEAP+I NP C+ APGCG WK P I NP YKG W  P++DN  Y+GVWK R+I N DYFED  P++MTP  A+GLELWSM+ +I FDNFII   K+ AD +A+++W +KK      +P   ++  +  A  ER
Sbjct:  113 LSKTMKEDADEEIAKYDGKWAVEQLKENKVPGDLGLVLKSRAKHHAIAAPLVKPFVFQDEPLVVQYEVNFQDGIDCGGAYIKLLSDTGSLNLEQFHDRTPYTIMFGPDKCGEDYKLHFIFRHKNPLNKDMEEKHAKRADVDLKKFYTDKKTHLYTLVLNPDNSYEMFIDQSSVSRGSLLQDVVPPVNPPKEIDDPHDSKPDDWDERAKIPDPEAEKPDDWDEDAPAKVEDPDAVKPEGWLDDELEFVADPNAEKPEDWDEEMDGEWEAPQIPNPACETAPGCGEWKRPMINNPQYKGKWKAPLVDNSNYQGVWKPRKIQNPDYFEDLQPFRMTPFKALGLELWSMTSDIYFDNFIITSQKEVADRWASDSWGLKKLVASANEP--GILAQLTMAAEER 508          
BLAST of Calnexin vs. Ensembl Medaka
Match: calr3b (calreticulin [Source:NCBI gene;Acc:101169735])

HSP 1 Score: 211.846 bits (538), Expect = 6.675e-61
Identity = 136/351 (38.75%), Postives = 176/351 (50.14%), Query Frame = 2
Query:  404 EDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCG-NDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERR 1453
            E D  L     AR  A SA+   PF       VIQ+ VK +   +CGG YVK+            H  + Y +MFGPD CG    KVH IF +K    GK      +    D      D+ THLYTL++N D T+++ +D   + SGSL +D++    PPK+I DP+  KP DWDD PKI DPE  KP DW+   PEYI                   PD  ++KP+DW ++MDGEWE P I                    NP YKG W P  IDNP YKG W    I N +Y  DA+ YK   IG +GL+LW +     FDNF+I D+ K A++   ETW   K+ E++
Sbjct:   60 EKDKGLQTSQDARFYAASARF-EPFSNEGKSLVIQFTVKHEQKIDCGGGYVKVFPSDLDQT--DMHGDSSYYVMFGPDICGYTTKKVHVIFNYK----GKNHLIKKEIKCKD------DEFTHLYTLILNPDQTYQVKIDNEKVESGSLEEDWD--FLPPKKIKDPEAKKPEDWDDRPKIDDPEDTKPEDWE--KPEYI-------------------PDPDAKKPEDWQEDMDGEWEPPMI-------------------SNPEYKGEWKPKQIDNPDYKGAWVHPEIDNPEYSPDANIYKFDSIGVLGLDLWQVKSGTVFDNFLITDDVKEAEDVGKETWGATKEPEQK 355          
BLAST of Calnexin vs. Ensembl Medaka
Match: ENSORLT00000003653.2 (calreticulin [Source:NCBI gene;Acc:101160304])

HSP 1 Score: 204.912 bits (520), Expect = 2.464e-58
Identity = 130/351 (37.04%), Postives = 175/351 (49.86%), Query Frame = 2
Query:  404 EDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCG-NDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERR 1453
            E D  +     AR  A+SA+   PF       VIQ+ VK +   +CGG YVK+       +    H  ++Y +MFGPD CG +  KVH IF +K    G+           D      D+ THLYTL++N D T+E+ +D   + SGSL  D++  + PPK+I DP   KP+DWDD   I DP   KP DWD                     +P TIPD  ++KP DWD++MDGEWE P I                    NP +KG W P  + NP YKG W    + N +Y  DA+ Y    IG +GL+LW +     FDNF+I D+ K A+E A ETW + K  E++
Sbjct:   60 EADKGVQTSQDARFYALSARF-PPFSNEGKTLVIQFTVKHEQKIDCGGGYVKVFPSDLDQS--DMHGDSKYYVMFGPDICGYSTKKVHVIFNYK----GQNHLIKKDIKCKD------DELTHLYTLILNPDQTYEVRIDNEKVESGSLEDDWD--MLPPKKIKDPDAKKPSDWDDRATIDDPSDTKPEDWD---------------------QPETIPDPDAKKPDDWDEDMDGEWEPPMI-------------------TNPEFKGEWKPKQMSNPNYKGAWVHPEVDNPEYAPDANMYLFDNIGVLGLDLWQVKSGTIFDNFLITDDIKEAEEVAKETWEVTKGPEKK 355          
BLAST of Calnexin vs. Planmine SMEST
Match: SMESG000016275.1 (SMESG000016275.1)

HSP 1 Score: 1019.22 bits (2634), Expect = 0.000e+0
Identity = 594/597 (99.50%), Postives = 596/597 (99.83%), Query Frame = 2
Query:  113 MKLVLFIFALVFMQNTFAEEKIDSAIEEEDELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYERLKREMHKKXXXXXXXXXXXXTKLASGDNTXXXXXXXXXXXMSNEGARGDEAISKSDLEXXXXXXXXXXXXXXXXXXXATNTPSEEKSTKRRRARKD 1903
            MKLVLFIFALVFMQNTFAEEKIDSAIEEEDELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKL+RPFDFSTNQFVIQYEVKFQNGQECGGAYVKLLSDSDLLNLKQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGKYEEKHSKKSSSDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAAD+FAAETWLMKKDAERRADPNASVVDAIREATSERPWLWIVIILVIVLPIILLVVYCCRSSGSDKSAEYERLKREMHKKDDDIVEEDDEEETKLASGDN QEEPAQEAAAEMSNEGARGDEAISKSDLESGSDNDSPSKDKSSSERDSATNTPSEEKSTKRRRARKD
Sbjct:    1 MKLVLFIFALVFMQNTFAEEKIDSAIEEEDELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLSRPFDFSTNQFVIQYEVKFQNGQECGGAYVKLLSDSDLLNLKQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGKYEEKHSKKSSSDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADDFAAETWLMKKDAERRADPNASVVDAIREATSERPWLWIVIILVIVLPIILLVVYCCRSSGSDKSAEYERLKREMHKKDDDIVEEDDEEETKLASGDNMQEEPAQEAAAEMSNEGARGDEAISKSDLESGSDNDSPSKDKSSSERDSATNTPSEEKSTKRRRARKD 597          
BLAST of Calnexin vs. Planmine SMEST
Match: SMESG000016275.1 (SMESG000016275.1)

HSP 1 Score: 994.186 bits (2569), Expect = 0.000e+0
Identity = 582/585 (99.49%), Postives = 584/585 (99.83%), Query Frame = 2
Query:  149 MQNTFAEEKIDSAIEEEDELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNASVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYERLKREMHKKXXXXXXXXXXXXTKLASGDNTXXXXXXXXXXXMSNEGARGDEAISKSDLEXXXXXXXXXXXXXXXXXXXATNTPSEEKSTKRRRARKD 1903
            MQNTFAEEKIDSAIEEEDELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKL+RPFDFSTNQFVIQYEVKFQNGQECGGAYVKLLSDSDLLNLKQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGKYEEKHSKKSSSDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAAD+FAAETWLMKKDAERRADPNASVVDAIREATSERPWLWIVIILVIVLPIILLVVYCCRSSGSDKSAEYERLKREMHKKDDDIVEEDDEEETKLASGDN QEEPAQEAAAEMSNEGARGDEAISKSDLESGSDNDSPSKDKSSSERDSATNTPSEEKSTKRRRARKD
Sbjct:    1 MQNTFAEEKIDSAIEEEDELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLSRPFDFSTNQFVIQYEVKFQNGQECGGAYVKLLSDSDLLNLKQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGKYEEKHSKKSSSDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADDFAAETWLMKKDAERRADPNASVVDAIREATSERPWLWIVIILVIVLPIILLVVYCCRSSGSDKSAEYERLKREMHKKDDDIVEEDDEEETKLASGDNMQEEPAQEAAAEMSNEGARGDEAISKSDLESGSDNDSPSKDKSSSERDSATNTPSEEKSTKRRRARKD 585          
BLAST of Calnexin vs. Planmine SMEST
Match: SMESG000016275.1 (SMESG000016275.1)

HSP 1 Score: 989.949 bits (2558), Expect = 0.000e+0
Identity = 582/586 (99.32%), Postives = 584/586 (99.66%), Query Frame = 2
Query:  149 MQNTFAEEKIDSAIEEEDELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADPNA-SVVDAIREATSERXXXXXXXXXXXXXXXXXXXXYCCRSSGSDKSAEYERLKREMHKKXXXXXXXXXXXXTKLASGDNTXXXXXXXXXXXMSNEGARGDEAISKSDLEXXXXXXXXXXXXXXXXXXXATNTPSEEKSTKRRRARKD 1903
            MQNTFAEEKIDSAIEEEDELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKL+RPFDFSTNQFVIQYEVKFQNGQECGGAYVKLLSDSDLLNLKQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGKYEEKHSKKSSSDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAAD+FAAETWLMKKDAERRADPNA SVVDAIREATSERPWLWIVIILVIVLPIILLVVYCCRSSGSDKSAEYERLKREMHKKDDDIVEEDDEEETKLASGDN QEEPAQEAAAEMSNEGARGDEAISKSDLESGSDNDSPSKDKSSSERDSATNTPSEEKSTKRRRARKD
Sbjct:    1 MQNTFAEEKIDSAIEEEDELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLSRPFDFSTNQFVIQYEVKFQNGQECGGAYVKLLSDSDLLNLKQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGKYEEKHSKKSSSDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADDFAAETWLMKKDAERRADPNAQSVVDAIREATSERPWLWIVIILVIVLPIILLVVYCCRSSGSDKSAEYERLKREMHKKDDDIVEEDDEEETKLASGDNMQEEPAQEAAAEMSNEGARGDEAISKSDLESGSDNDSPSKDKSSSERDSATNTPSEEKSTKRRRARKD 586          
BLAST of Calnexin vs. Planmine SMEST
Match: SMESG000054803.1 (SMESG000054803.1)

HSP 1 Score: 272.322 bits (695), Expect = 2.465e-83
Identity = 160/435 (36.78%), Postives = 234/435 (53.79%), Query Frame = 2
Query:  161 FAEEKIDSAIEEEDELNVTPAQKLKFTKPKVPENYFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYK-MTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADP 1462
            F+   ++ A+  +   N T       + P +  +Y ++ F   SDLA+    S  ++D   D I KY G WSVE  +++   +D++LV+KSK  ++  +  L                                         KQF + T YTIMFGPD+CG D ++ F+F++++PKT KYE++  K++     R   D  TH+ TL+I  +N+ +I+ D  LI  G+L+ DF PS+     I D  DVKP DWDD  KI+DP A KP+ WD++  E+  D  A KP+ WL+NEPL +  ++S KP +WD+ + G+W+ P + N  CK   GCG W  PKI+NP Y+G W PP+I NP Y+G WK + I N DY  +  PYK + P   +G+E+WS      FDNFII DN   A +FA  +W  K   + R  P
Sbjct:    7 FSLGILNFAVSVKKASNSTDFNHTYLSTPYLQNSYLLLMFNGSSDLAKHAEFS-KVRDSQEDCI-KYRGRWSVERANSTPFVNDYSLVMKSKNAYSCFNLNL-----------------------------------------KQFTNTTPYTIMFGPDKCGLDYEIKFLFEYQNPKTRKYEKRQFKQTEDKYPRFLGDNVTHVNTLMICENNSVQIYKDLRLIKEGNLMTDFTPSLGGEPHIVDITDVKPKDWDDRKKISDPNAKKPSYWDENELEFTPDLNAKKPKNWLDNEPLMVLSDES-KPYNWDENVKGKWQPPMVKNFKCK-MNGCGEWSPPKIRNPKYRGKWNPPLIHNPSYRGPWKPKMINNPDYISNLKPYKNLRPFNNLGIEVWSEKAGTIFDNFIITDNLTVARQFAMHSWWPKYKVDTRDMP 396          
BLAST of Calnexin vs. Planmine SMEST
Match: SMESG000077304.1 (SMESG000077304.1)

HSP 1 Score: 220.32 bits (560), Expect = 2.949e-64
Identity = 136/351 (38.75%), Postives = 183/351 (52.14%), Query Frame = 2
Query:  404 EDDFALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVXXXXXXXXXXXXQFHDKTQYTIMFGPDRCG-NDNKVHFIFQHKHPKTGXXXXXXXXXXXXDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFEPSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKAVKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCGPWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMTPIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERR 1453
            E D  +     A+   IS K ++ F     + VIQ++VK +   +CGG YVKL+  +   +  +FH +T Y IMFGPD CG +  KVH IF +K    G+           D      D+ TH+YTL++N DNT+E+ +D   + SGSL  D++     PK+I DP   KP DW+D  KI D    KP +WD                     +P TIPD K++KP+DWDDEMDGEWEAP+IDN                   P YKG W P  IDNPKYKG W    IPN DY  D + Y    IGAIG +LW +     FDN ++ D+   A ++A +TW +  D E++
Sbjct:   54 EKDKGIQTSQDAKFYGISKKFDKAFSNEGKKLVIQFQVKHEQTIDCGGGYVKLVGSNFEQD--KFHGETPYHIMFGPDICGLSTKKVHVIFNYK----GQNLLIKKDIKCKD------DEFTHVYTLIVNPDNTYEVLIDNEKVESGSLEDDWD--FLAPKKIKDPNAKKPEDWEDNEKIDDITDKKPEEWD---------------------KPKTIPDPKAKKPEDWDDEMDGEWEAPQIDN-------------------PEYKGEWKPKQIDNPKYKGPWVHPEIPNPDYKPDTNLYVYKDIGAIGFDLWQVKSGTIFDNILLTDDPAYAKKYAEQTWKVTADGEKK 350          
The following BLAST results are available for this feature:
BLAST of Calnexin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CANX2.622e-16358.00calnexin [Source:HGNC Symbol;Acc:HGNC:1473][more]
CANX2.622e-16358.00calnexin [Source:HGNC Symbol;Acc:HGNC:1473][more]
CANX2.622e-16358.00calnexin [Source:HGNC Symbol;Acc:HGNC:1473][more]
CANX2.622e-16358.00calnexin [Source:HGNC Symbol;Acc:HGNC:1473][more]
CANX2.622e-16358.00calnexin [Source:HGNC Symbol;Acc:HGNC:1473][more]
back to top
BLAST of Calnexin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cnx-18.430e-11946.21Calnexin [Source:UniProtKB/Swiss-Prot;Acc:P34652][more]
cnx-15.890e-7744.77Calnexin [Source:UniProtKB/Swiss-Prot;Acc:P34652][more]
crt-14.793e-5438.53Calreticulin [Source:UniProtKB/Swiss-Prot;Acc:P27... [more]
crt-14.793e-5438.53Calreticulin [Source:UniProtKB/Swiss-Prot;Acc:P27... [more]
back to top
BLAST of Calnexin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cnx99A6.023e-14153.55gene:FBgn0015622 transcript:FBtr0085438[more]
Cnx99A6.023e-14153.55gene:FBgn0015622 transcript:FBtr0085437[more]
Cnx99A6.023e-14153.55gene:FBgn0015622 transcript:FBtr0110909[more]
Cnx99A3.739e-14053.55gene:FBgn0015622 transcript:FBtr0334873[more]
Cnx14D1.991e-13452.55gene:FBgn0264077 transcript:FBtr0074299[more]
back to top
BLAST of Calnexin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
canx6.428e-16358.33calnexin [Source:ZFIN;Acc:ZDB-GENE-040426-2797][more]
clgn3.359e-14756.03calmegin [Source:ZFIN;Acc:ZDB-GENE-060929-708][more]
calr7.157e-5938.18calreticulin [Source:ZFIN;Acc:ZDB-GENE-030131-4042... [more]
calr3a8.326e-5837.32calreticulin 3a [Source:ZFIN;Acc:ZDB-GENE-000208-1... [more]
calr3b2.248e-5639.18calreticulin 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9... [more]
back to top
BLAST of Calnexin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zfyve161.064e-16055.77zinc finger FYVE-type containing 16 [Source:Xenbas... [more]
zfyve162.913e-16055.77zinc finger FYVE-type containing 16 [Source:Xenbas... [more]
zfyve163.417e-16055.77zinc finger FYVE-type containing 16 [Source:Xenbas... [more]
zfyve162.696e-15758.01zinc finger FYVE-type containing 16 [Source:Xenbas... [more]
zfyve163.265e-15758.01zinc finger FYVE-type containing 16 [Source:Xenbas... [more]
back to top
BLAST of Calnexin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Canx1.173e-16457.48calnexin [Source:MGI Symbol;Acc:MGI:88261][more]
Canx1.173e-16457.48calnexin [Source:MGI Symbol;Acc:MGI:88261][more]
Clgn1.709e-14649.89calmegin [Source:MGI Symbol;Acc:MGI:107472][more]
Clgn1.709e-14649.89calmegin [Source:MGI Symbol;Acc:MGI:107472][more]
Calr4.770e-6038.07calreticulin [Source:MGI Symbol;Acc:MGI:88252][more]
back to top
BLAST of Calnexin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P35565|CALX_RAT7.283e-16457.48Calnexin OS=Rattus norvegicus OX=10116 GN=Canx PE=... [more]
sp|P35564|CALX_MOUSE8.202e-16457.48Calnexin OS=Mus musculus OX=10090 GN=Canx PE=1 SV=... [more]
sp|P27824|CALX_HUMAN1.259e-16258.00Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2[more]
sp|Q5R440|CALX_PONAB2.256e-16257.78Calnexin OS=Pongo abelii OX=9601 GN=CANX PE=2 SV=2[more]
sp|P24643|CALX_CANLF1.159e-16056.67Calnexin OS=Canis lupus familiaris OX=9615 GN=CANX... [more]
back to top
BLAST of Calnexin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8IM210.000e+063.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267H5K10.000e+063.77Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267F7K20.000e+063.99Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A1I8GKN10.000e+063.99Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A0X3NKP90.000e+060.00Uncharacterized protein (Fragment) OS=Schistocepha... [more]
back to top
BLAST of Calnexin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
canx1.403e-15853.96calnexin [Source:NCBI gene;Acc:103032947][more]
clgn3.627e-14556.17calnexin [Source:NCBI gene;Acc:103035256][more]
clgn5.356e-14556.17calnexin [Source:NCBI gene;Acc:103035256][more]
clgn9.781e-14556.17calnexin [Source:NCBI gene;Acc:103035256][more]
canx3.289e-13949.29calnexin [Source:NCBI gene;Acc:103032947][more]
back to top
BLAST of Calnexin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:ch211-274f20.22.125e-14653.26si:ch211-274f20.2 [Source:ZFIN;Acc:ZDB-GENE-091204... [more]
calr1.189e-5837.85calreticulin [Source:ZFIN;Acc:ZDB-GENE-030131-4042... [more]
calr3b1.476e-5436.26calreticulin 3b [Source:ZFIN;Acc:ZDB-GENE-030131-9... [more]
back to top
BLAST of Calnexin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CNE11.740e-4633.24Calnexin; integral membrane ER chaperone involved ... [more]
back to top
BLAST of Calnexin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO497861.211e-13355.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO481094.355e-6037.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calnexin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
canx5.176e-15456.51calnexin [Source:NCBI gene;Acc:101165199][more]
clgn3.899e-14656.03calnexin [Source:NCBI gene;Acc:101159642][more]
clgn9.744e-14556.03calnexin [Source:NCBI gene;Acc:101159642][more]
calr3b6.675e-6138.75calreticulin [Source:NCBI gene;Acc:101169735][more]
ENSORLT00000003653.22.464e-5837.04calreticulin [Source:NCBI gene;Acc:101160304][more]
back to top
BLAST of Calnexin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016275.10.000e+099.50SMESG000016275.1[more]
SMESG000016275.10.000e+099.49SMESG000016275.1[more]
SMESG000016275.10.000e+099.32SMESG000016275.1[more]
SMESG000054803.12.465e-8336.78SMESG000054803.1[more]
SMESG000077304.12.949e-6438.75SMESG000077304.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031389 ID=SMED30031389|Name=Calnexin|organism=Schmidtea mediterranea sexual|type=transcript|length=2287bp
CGGTTTCGTAAACTTTAATCTTTGTTTAGATGCATAAAATTGTTAAAATT
TATATATTAACCAATAAAAAATTAGCACGATACCAACAAATTAGTTTACA
GTTATTATTAATATGAAATTAGTTCTTTTTATTTTTGCATTAGTTTTTAT
GCAAAATACTTTTGCAGAAGAAAAAATAGATTCTGCAATTGAAGAAGAAG
ATGAATTAAATGTCACACCAGCCCAAAAATTAAAGTTTACGAAACCGAAA
GTTCCAGAAAATTATTTTGTGATGTATTTTACAAAACCGAGTGATCTAGC
AGAAATATTAGTTATGTCTGATGCTATGAAAGATGGAGTAGCAGATAATA
TAGCAAAATACAACGGCATTTGGTCAGTTGAAGTTCCATCAACCAGTGTC
ATTGAAGATGATTTTGCATTAGTTTTAAAATCCAAAGCTCGTCATGCTGC
AATATCCGCTAAATTAAATCGACCATTTGATTTTTCAACGAATCAGTTTG
TTATACAATATGAAGTGAAATTTCAAAATGGCCAAGAATGCGGTGGTGCT
TATGTGAAATTGCTATCAGATAGTGATTTATTAAATTTGAAACAGTTCCA
CGACAAAACTCAGTATACGATTATGTTTGGTCCAGATAGATGTGGAAATG
ACAACAAAGTGCATTTTATTTTCCAACACAAGCATCCGAAAACCGGTAAA
TATGAAGAGAAACACTCCAAGAAGAGCAGCTCGGATTTGGATCGACATTT
CACAGACAAGAAAACGCATTTATATACATTAGTCATCAATTCCGATAACA
CATTCGAGATATTTGTCGATCAAACGCTCATCAACAGTGGCAGCTTGTTA
AAGGATTTCGAGCCATCTGTCAACCCGCCCAAAGAAATCGATGATCCAAA
GGATGTCAAGCCCGCCGACTGGGACGACACTCCTAAAATTGCGGATCCAG
AGGCCGTGAAGCCCGCCGATTGGGATGACAGTGCCCCAGAATATATCGAG
GATGAAAAGGCCGTCAAACCGGAAGGCTGGTTGGAAAATGAACCGTTGAC
TATTCCTGACGAGAAATCAGAGAAGCCAAAAGATTGGGACGACGAAATGG
ATGGAGAATGGGAAGCACCAAGAATCGATAATCCAATTTGTAAAGATGCT
CCCGGCTGTGGGCCATGGAAATCACCGAAAATCAAAAACCCCAGTTACAA
GGGAATCTGGACTCCTCCAATGATCGACAATCCCAAATATAAAGGAGTCT
GGAAAGCTCGCCGAATTCCAAATGCTGATTATTTCGAGGATGCTCATCCC
TACAAAATGACTCCAATCGGTGCAATCGGCCTTGAGCTGTGGTCAATGAG
TGACGAGATTGCCTTTGATAATTTCATCATTGTCGACAACAAAAAGGCAG
CTGATGAGTTTGCAGCAGAAACCTGGCTCATGAAAAAGGATGCAGAACGT
CGAGCCGATCCCAATGCGAGCGTTGTCGATGCGATCCGAGAGGCAACTTC
GGAACGTCCTTGGCTGTGGATCGTTATCATTCTAGTTATTGTGCTACCAA
TCATATTGTTGGTCGTCTACTGCTGTCGCAGCTCTGGAAGCGATAAATCG
GCTGAATACGAACGACTGAAACGGGAAATGCACAAGAAAGACGATGACAT
AGTCGAGGAGGACGACGAGGAAGAAACAAAGCTTGCATCTGGTGATAACA
CGCAAGAGGAACCCGCTCAGGAAGCAGCAGCCGAAATGAGCAATGAAGGT
GCTCGAGGGGATGAGGCTATATCAAAATCGGATTTAGAAAGTGGATCCGA
TAACGACTCTCCATCAAAGGACAAGAGCTCGTCAGAACGCGACAGTGCGA
CCAACACTCCATCAGAAGAGAAATCAACGAAGCGACGCAGAGCTAGAAAG
GATTAATGCGTAATGAATATTTGATCATTTTTAACCGTTTGATTCGCGTT
TTGGGCTGTTCAGTCTTAGATTGTTTGAATAAAAGTCTGATTTTGTATGT
TTTCATTCCGTTACTATTTGTATTGATATGATCTTACGGACTTGTACTAT
GTGCTTTTGGTGTCCTTCTGCTGCCTGGTAGTTCTCTGTGTGTGCGCGTG
CGTTGTCTGCGTTGCGTATGTGTTTGTTCTAATATTATTTGGTTGATATA
TAAAGATTTTTTCAAGCAATGTTATTGAAAACAAACGTTTTTACGCAATT
CCAATTTCTCTAGTTGTTATTTTATTATTTATATAAATATGCTGGTTGTT
TTAATTAATAATAAACATAGTGCTAATGTAAAAAAAA
back to top

protein sequence of SMED30031389-orf-1

>SMED30031389-orf-1 ID=SMED30031389-orf-1|Name=SMED30031389-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=598bp
MKLVLFIFALVFMQNTFAEEKIDSAIEEEDELNVTPAQKLKFTKPKVPEN
YFVMYFTKPSDLAEILVMSDAMKDGVADNIAKYNGIWSVEVPSTSVIEDD
FALVLKSKARHAAISAKLNRPFDFSTNQFVIQYEVKFQNGQECGGAYVKL
LSDSDLLNLKQFHDKTQYTIMFGPDRCGNDNKVHFIFQHKHPKTGKYEEK
HSKKSSSDLDRHFTDKKTHLYTLVINSDNTFEIFVDQTLINSGSLLKDFE
PSVNPPKEIDDPKDVKPADWDDTPKIADPEAVKPADWDDSAPEYIEDEKA
VKPEGWLENEPLTIPDEKSEKPKDWDDEMDGEWEAPRIDNPICKDAPGCG
PWKSPKIKNPSYKGIWTPPMIDNPKYKGVWKARRIPNADYFEDAHPYKMT
PIGAIGLELWSMSDEIAFDNFIIVDNKKAADEFAAETWLMKKDAERRADP
NASVVDAIREATSERPWLWIVIILVIVLPIILLVVYCCRSSGSDKSAEYE
RLKREMHKKDDDIVEEDDEEETKLASGDNTQEEPAQEAAAEMSNEGARGD
EAISKSDLESGSDNDSPSKDKSSSERDSATNTPSEEKSTKRRRARKD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000103central nervous system
PLANA:0000204ovary
PLANA:0000208testis
PLANA:0002111X2 cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001580Calret/calnex
IPR009033Calreticulin/calnexin_P_dom_sf
IPR013320ConA-like_dom_sf
IPR018124Calret/calnex_CS
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
GO:0051082unfolded protein binding
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0006457protein folding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 499..519
NoneNo IPR availableGENE3DG3DSA:2.60.120.200coord: 82..432
e-value: 4.6E-166
score: 554.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 252..272
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 548..591
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 508..597
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 304..325
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 253..272
NoneNo IPR availablePANTHERPTHR11073:SF11CALNEXINcoord: 36..571
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.845
NoneNo IPR availableTMHMMTMhelixcoord: 466..488
IPR001580Calreticulin/calnexinPRINTSPR00626CALRETICULINcoord: 266..279
score: 62.79
coord: 314..336
score: 67.34
coord: 357..376
score: 65.23
coord: 138..156
score: 48.96
coord: 404..424
score: 49.17
coord: 166..182
score: 63.47
IPR001580Calreticulin/calnexinPFAMPF00262Calreticulincoord: 53..423
e-value: 7.2E-156
score: 518.6
IPR001580Calreticulin/calnexinPANTHERPTHR11073CALRETICULIN AND CALNEXINcoord: 36..571
IPR009033Calreticulin/calnexin, P domain superfamilyGENE3DG3DSA:2.10.250.10coord: 252..397
e-value: 4.6E-166
score: 554.0
IPR009033Calreticulin/calnexin, P domain superfamilySUPERFAMILYSSF63887P-domain of calnexin/calreticulincoord: 253..392
IPR018124Calreticulin/calnexin, conserved sitePROSITEPS00803CALRETICULIN_1coord: 136..151
IPR018124Calreticulin/calnexin, conserved sitePROSITEPS00804CALRETICULIN_2coord: 170..178
IPR013320Concanavalin A-like lectin/glucanase domain superfamilySUPERFAMILYSSF49899Concanavalin A-like lectins/glucanasescoord: 51..262