Down syndrome critical region protein 3-like protein

Overview
NameDown syndrome critical region protein 3-like protein
Smed IDSMED30031383
Length (bp)1145
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Down syndrome critical region protein 3-like protein (SMED30031383) t-SNE clustered cells

Violin plots show distribution of expression levels for Down syndrome critical region protein 3-like protein (SMED30031383) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Down syndrome critical region protein 3-like protein (SMED30031383) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Down syndrome critical region protein 3-like protein (SMED30031383) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30031383

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30031383SMESG000008455.1 SMESG000008453.1 Contig960GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30031383SMESG000025294.1 Contig960GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
epidermisSMED30031383SMESG000025294.1 dd_Smed_v4_3520_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Human
Match: VPS26C (VPS26 endosomal protein sorting factor C [Source:HGNC Symbol;Acc:HGNC:3044])

HSP 1 Score: 282.722 bits (722), Expect = 3.165e-93
Identity = 137/300 (45.67%), Postives = 199/300 (66.33%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            L+I++++ +K Y   E++ G+V I SK    HQG++LT+ G VNL++S+K+ G F+A YNSVKPIQ+ + ++E+ KPGK PSG  EIPFE PL        G K L ETY GVF+ I Y L  D+KRSLL K      + +V       K    TP P  F +  + + NV     LP F + G ++S    + QP+TG ++VE  +  I+S+ELQLVRVETCGCAEG+++D+TEI+N+Q+ +GDV R L +P+Y++ PRLFTCP++ + NF ++FE+ +V+L   +HLITE+ PLK+ R
Sbjct:    5 LDIKIKRANKVYHAGEVLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQIINSTIEMVKPGKFPSGKTEIPFEFPLH-----LKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGK---FTPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQPLTGELVVESSEAAIRSVELQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLSVPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLLHPDHLITENFPLKLCR 296          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Human
Match: VPS26C (VPS26 endosomal protein sorting factor C [Source:HGNC Symbol;Acc:HGNC:3044])

HSP 1 Score: 254.218 bits (648), Expect = 2.125e-82
Identity = 128/300 (42.67%), Postives = 187/300 (62.33%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            L+I++++ +K Y   E++ G+V I SK    HQG++LT+ G VNL++S+K+ G F+A YNSVKPIQ+ + ++E+ KPGK PSG  EIPFE PL        G K L ETY GVF+ I                 Q Q                 TP P  F +  + + NV     LP F + G ++S    + QP+TG ++VE  +  I+S+ELQLVRVETCGCAEG+++D+TEI+N+Q+ +GDV R L +P+Y++ PRLFTCP++ + NF ++FE+ +V+L   +HLITE+ PLK+ R
Sbjct:    5 LDIKIKRANKVYHAGEVLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQIINSTIEMVKPGKFPSGKTEIPFEFPLH-----LKGNKVLYETYHGVFVNI-----------------QPQKGKF-------------TPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQPLTGELVVESSEAAIRSVELQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLSVPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLLHPDHLITENFPLKLCR 269          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Human
Match: VPS26C (VPS26 endosomal protein sorting factor C [Source:HGNC Symbol;Acc:HGNC:3044])

HSP 1 Score: 221.09 bits (562), Expect = 9.245e-70
Identity = 110/247 (44.53%), Postives = 159/247 (64.37%), Query Frame = 3
Query:  279 RFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            R + +Y++  PIQ+ + ++E+ KPGK PSG  EIPFE PL        G K L ETY GVF+ I Y L  D+KRSLL K      + +V       K    TP P  F +  + + NV     LP F + G ++S    + QP+TG ++VE  +  I+S+ELQLVRVETCGCAEG+++D+TEI+N+Q+ +GDV R L +P+Y++ PRLFTCP++ + NF ++FE+ +V+L   +HLITE+ PLK+ R
Sbjct:   11 RANKVYHA-GPIQIINSTIEMVKPGKFPSGKTEIPFEFPLH-----LKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGK---FTPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQPLTGELVVESSEAAIRSVELQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLSVPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLLHPDHLITENFPLKLCR 248          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Human
Match: VPS26C (VPS26 endosomal protein sorting factor C [Source:HGNC Symbol;Acc:HGNC:3044])

HSP 1 Score: 160.999 bits (406), Expect = 1.575e-47
Identity = 69/146 (47.26%), Postives = 105/146 (71.92%), Query Frame = 3
Query:  582 TPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            TP P  F +  + + NV     LP F + G ++S    + QP+TG ++VE  +  I+S+ELQLVRVETCGCAEG+++D+TEI+N+Q+ +GDV R L +P+Y++ PRLFTCP++ + NF ++FE+ +V+L   +HLITE+ PLK+ R
Sbjct:   26 TPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQPLTGELVVESSEAAIRSVELQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLSVPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLLHPDHLITENFPLKLCR 171          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Celegans
Match: vps-26 (Vacuolar protein sorting-associated protein 26 [Source:UniProtKB/Swiss-Prot;Acc:O01258])

HSP 1 Score: 51.9878 bits (123), Expect = 3.958e-7
Identity = 68/283 (24.03%), Postives = 113/283 (39.93%), Query Frame = 3
Query:  153 YVENEMIKGLVFIDSKQ---EFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSL--LLKSFQAQTDVLVQY--NDMGNKDEVATPK--PKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSV------YSINFIIDFELV 956
            Y + E + G V ++ K+   +F HQGI +   G + +         F +L            + EL++PG +     + PFE            +++  ETY G  + + YFL V V R L  L K        L  Y  ND   K EV        +F+ N KN  ++ +        +VG+I  L V +K               IK +E+ +++ E  G      K+S  +   ++ +G   R   IP+ L L      PS+      +S+ + ++  LV
Sbjct:   93 YYDGESVTGTVHVNLKKANHKFEHQGIRIEFIGQIEVYYDRGNQQDFISL------------TRELARPGDLTQNA-QFPFEF---------NNVEKPFETYMGTNVKLRYFLRVTVIRRLTDLTKELDLVVHALSSYPDNDKSIKMEVGIEDCLHIEFEYN-KNKYHLQD-------VIVGKIYFLLVRIK---------------IKYMEIAILKTEVVGSGPNTFKESETVAKFEIMDGAPVRGESIPIRLFLAGYDLAPSMRDVGKKFSVKYFLNLVLV 330          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Celegans
Match: vps-26 (Vacuolar protein sorting-associated protein 26 [Source:UniProtKB/Swiss-Prot;Acc:O01258])

HSP 1 Score: 51.2174 bits (121), Expect = 5.608e-7
Identity = 68/283 (24.03%), Postives = 113/283 (39.93%), Query Frame = 3
Query:  153 YVENEMIKGLVFIDSKQ---EFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSL--LLKSFQAQTDVLVQY--NDMGNKDEVATPK--PKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSV------YSINFIIDFELV 956
            Y + E + G V ++ K+   +F HQGI +   G + +         F +L            + EL++PG +     + PFE            +++  ETY G  + + YFL V V R L  L K        L  Y  ND   K EV        +F+ N KN  ++ +        +VG+I  L V +K               IK +E+ +++ E  G      K+S  +   ++ +G   R   IP+ L L      PS+      +S+ + ++  LV
Sbjct:   41 YYDGESVTGTVHVNLKKANHKFEHQGIRIEFIGQIEVYYDRGNQQDFISL------------TRELARPGDLTQNA-QFPFEF---------NNVEKPFETYMGTNVKLRYFLRVTVIRRLTDLTKELDLVVHALSSYPDNDKSIKMEVGIEDCLHIEFEYN-KNKYHLQD-------VIVGKIYFLLVRIK---------------IKYMEIAILKTEVVGSGPNTFKESETVAKFEIMDGAPVRGESIPIRLFLAGYDLAPSMRDVGKKFSVKYFLNLVLV 278          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Celegans
Match: vps-26 (Vacuolar protein sorting-associated protein 26 [Source:UniProtKB/Swiss-Prot;Acc:O01258])

HSP 1 Score: 51.2174 bits (121), Expect = 5.608e-7
Identity = 68/283 (24.03%), Postives = 113/283 (39.93%), Query Frame = 3
Query:  153 YVENEMIKGLVFIDSKQ---EFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSL--LLKSFQAQTDVLVQY--NDMGNKDEVATPK--PKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSV------YSINFIIDFELV 956
            Y + E + G V ++ K+   +F HQGI +   G + +         F +L            + EL++PG +     + PFE            +++  ETY G  + + YFL V V R L  L K        L  Y  ND   K EV        +F+ N KN  ++ +        +VG+I  L V +K               IK +E+ +++ E  G      K+S  +   ++ +G   R   IP+ L L      PS+      +S+ + ++  LV
Sbjct:   41 YYDGESVTGTVHVNLKKANHKFEHQGIRIEFIGQIEVYYDRGNQQDFISL------------TRELARPGDLTQNA-QFPFEF---------NNVEKPFETYMGTNVKLRYFLRVTVIRRLTDLTKELDLVVHALSSYPDNDKSIKMEVGIEDCLHIEFEYN-KNKYHLQD-------VIVGKIYFLLVRIK---------------IKYMEIAILKTEVVGSGPNTFKESETVAKFEIMDGAPVRGESIPIRLFLAGYDLAPSMRDVGKKFSVKYFLNLVLV 278          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Celegans
Match: vps-26 (Vacuolar protein sorting-associated protein 26 [Source:UniProtKB/Swiss-Prot;Acc:O01258])

HSP 1 Score: 51.2174 bits (121), Expect = 6.028e-7
Identity = 68/283 (24.03%), Postives = 113/283 (39.93%), Query Frame = 3
Query:  153 YVENEMIKGLVFIDSKQ---EFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSL--LLKSFQAQTDVLVQY--NDMGNKDEVATPK--PKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSV------YSINFIIDFELV 956
            Y + E + G V ++ K+   +F HQGI +   G +  E+           Y+          + EL++PG +     + PFE            +++  ETY G  + + YFL V V R L  L K        L  Y  ND   K EV        +F+ N KN  ++ +        +VG+I  L V +K               IK +E+ +++ E  G      K+S  +   ++ +G   R   IP+ L L      PS+      +S+ + ++  LV
Sbjct:   93 YYDGESVTGTVHVNLKKANHKFEHQGIRIEFIGQIVSEV----------YYDRGNQQDFISLTRELARPGDLTQNA-QFPFEF---------NNVEKPFETYMGTNVKLRYFLRVTVIRRLTDLTKELDLVVHALSSYPDNDKSIKMEVGIEDCLHIEFEYN-KNKYHLQD-------VIVGKIYFLLVRIK---------------IKYMEIAILKTEVVGSGPNTFKESETVAKFEIMDGAPVRGESIPIRLFLAGYDLAPSMRDVGKKFSVKYFLNLVLV 332          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Celegans
Match: vps-26 (Vacuolar protein sorting-associated protein 26 [Source:UniProtKB/Swiss-Prot;Acc:O01258])

HSP 1 Score: 50.8322 bits (120), Expect = 7.240e-7
Identity = 68/283 (24.03%), Postives = 113/283 (39.93%), Query Frame = 3
Query:  153 YVENEMIKGLVFIDSKQ---EFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSL--LLKSFQAQTDVLVQY--NDMGNKDEVATPK--PKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSV------YSINFIIDFELV 956
            Y + E + G V ++ K+   +F HQGI +   G +  E+           Y+          + EL++PG +     + PFE            +++  ETY G  + + YFL V V R L  L K        L  Y  ND   K EV        +F+ N KN  ++ +        +VG+I  L V +K               IK +E+ +++ E  G      K+S  +   ++ +G   R   IP+ L L      PS+      +S+ + ++  LV
Sbjct:   41 YYDGESVTGTVHVNLKKANHKFEHQGIRIEFIGQIVSEV----------YYDRGNQQDFISLTRELARPGDLTQNA-QFPFEF---------NNVEKPFETYMGTNVKLRYFLRVTVIRRLTDLTKELDLVVHALSSYPDNDKSIKMEVGIEDCLHIEFEYN-KNKYHLQD-------VIVGKIYFLLVRIK---------------IKYMEIAILKTEVVGSGPNTFKESETVAKFEIMDGAPVRGESIPIRLFLAGYDLAPSMRDVGKKFSVKYFLNLVLV 280          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Fly
Match: CG4074 (gene:FBgn0037017 transcript:FBtr0345811)

HSP 1 Score: 233.032 bits (593), Expect = 3.175e-74
Identity = 124/287 (43.21%), Postives = 184/287 (64.11%), Query Frame = 3
Query:  168 MIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQK---LPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            M+ G V     QE  H+GI L L G+VNL++S+KT G FDA YNSVKPI L   SLELS PGK+ +G  E  FE+PL  C       + L ETY GVFI ++Y LT  VKR+ L K+        VQY  +   ++     P  F ++  ++   A+ ++   +P F + G++D  E  +  PITG I V+H +  IKSIE+QLVRVETCGC EG+SKD+TEI+ +Q+ +G+V   LE+P++++LPRLFTCP++ + NF I+FEL ++++F +++ ++E+  + + R
Sbjct:    1 MLLGCVQFQCAQETKHEGIILYLEGIVNLQLSAKTVGLFDAFYNSVKPINLLQNSLELSAPGKLSAGRSEFHFELPL-VCKKEP---RILYETYHGVFINVNYQLTCTVKRNFLGKATTKIQQFCVQYKPVPLSEDSKKVVP--FSLSPDSLQKNASAKERLSMPRFLITGRLDRSEFCVTTPITGSITVQHTEAAIKSIEMQLVRVETCGCDEGYSKDATEIQTIQIADGNVLPKLELPIHMVLPRLFTCPTLLTKNFKIEFELNLIVVFKEDYTVSENFKIVLKR 281          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Fly
Match: CG4074 (gene:FBgn0037017 transcript:FBtr0078280)

HSP 1 Score: 233.032 bits (593), Expect = 3.175e-74
Identity = 124/287 (43.21%), Postives = 184/287 (64.11%), Query Frame = 3
Query:  168 MIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQK---LPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            M+ G V     QE  H+GI L L G+VNL++S+KT G FDA YNSVKPI L   SLELS PGK+ +G  E  FE+PL  C       + L ETY GVFI ++Y LT  VKR+ L K+        VQY  +   ++     P  F ++  ++   A+ ++   +P F + G++D  E  +  PITG I V+H +  IKSIE+QLVRVETCGC EG+SKD+TEI+ +Q+ +G+V   LE+P++++LPRLFTCP++ + NF I+FEL ++++F +++ ++E+  + + R
Sbjct:    1 MLLGCVQFQCAQETKHEGIILYLEGIVNLQLSAKTVGLFDAFYNSVKPINLLQNSLELSAPGKLSAGRSEFHFELPL-VCKKEP---RILYETYHGVFINVNYQLTCTVKRNFLGKATTKIQQFCVQYKPVPLSEDSKKVVP--FSLSPDSLQKNASAKERLSMPRFLITGRLDRSEFCVTTPITGSITVQHTEAAIKSIEMQLVRVETCGCDEGYSKDATEIQTIQIADGNVLPKLELPIHMVLPRLFTCPTLLTKNFKIEFELNLIVVFKEDYTVSENFKIVLKR 281          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Zebrafish
Match: vps26c (VPS26 endosomal protein sorting factor C [Source:ZFIN;Acc:ZDB-GENE-040801-6])

HSP 1 Score: 294.278 bits (752), Expect = 5.059e-98
Identity = 139/301 (46.18%), Postives = 207/301 (68.77%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITRF 1022
            L+IRL++ +K Y E E + GL+ + S+    HQG++L+L G+VNL++S+K+ G F+A YNSVKPIQL   ++E++KPGK+P+G  EIPFE PL++      G K+L ETY GVF+ I Y L  D++RSLL K      + +V       K +   P P  F +  + + N+     LP F + G +D+   S+ +P++G ++VE+ + PIKSIELQLVRVETCGCAEG+++D+TEI+N+Q+ EGDV   L IP+Y++ PRLFTCP++ + NF ++FE+ +VI+  D+HLITE+ PLK+ R 
Sbjct:    5 LDIRLKRANKVYHEGERLCGLLVVVSRDPLQHQGVSLSLEGLVNLQLSAKSVGVFEAFYNSVKPIQLVSSTMEVAKPGKVPAGRTEIPFEFPLQA-----KGNKQLYETYHGVFVNIQYTLRCDIRRSLLAKDLSKSCEFMVHCQPQKAKLQ---PNPVDFSITPETLQNIRERASLPRFLIRGHLDATCCSITRPLSGELVVENSEVPIKSIELQLVRVETCGCAEGYARDATEIQNIQIAEGDVCHGLSIPIYMVFPRLFTCPTLETTNFKVEFEVNIVIVLHDDHLITENFPLKLLRL 297          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Xenopus
Match: baiap2 (BAI1-associated protein 2 [Source:Xenbase;Acc:XB-GENE-955133])

HSP 1 Score: 287.73 bits (735), Expect = 6.626e-95
Identity = 141/302 (46.69%), Postives = 204/302 (67.55%), Query Frame = 3
Query:  117 ILEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITRF 1022
            +L+I++++ +K Y + E++ G+V + S+    HQGI LT+ G VNL++S+K+ G F+A YNSVKPIQ+   S+E+ KPGK+PSG  EIPFE PL +      G K L ETY GVF+ I Y L  D+KRSLL K      + ++  + +  K ++  P P  F +  + + NV     LP F + G +DS    + QP+TG ++VE  +  IKSIELQLVRVETCGCAEG+++D+TEI+N+Q+ EGDV R L IP+Y++ PRLFTCP++ + NF I+FE+ VV++  D+HLITE+ PL + R 
Sbjct:   25 VLDIKIKRANKVYRDGEILSGVVVVMSRDTVQHQGITLTMEGSVNLQLSAKSVGVFEAFYNSVKPIQIISSSMEMVKPGKLPSGKTEIPFEFPLNA-----KGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKSCEFII--HSLPQKAKLP-PTPVDFTITPETLQNVKERASLPRFLIRGHLDSTNCMITQPLTGELLVETSEVAIKSIELQLVRVETCGCAEGYARDATEIQNIQIAEGDVCRGLPIPIYMVFPRLFTCPTLETTNFKIEFEVNVVVILHDDHLITENFPLNLCRM 318          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Xenopus
Match: baiap2 (BAI1-associated protein 2 [Source:Xenbase;Acc:XB-GENE-955133])

HSP 1 Score: 267.7 bits (683), Expect = 8.231e-88
Identity = 133/272 (48.90%), Postives = 184/272 (67.65%), Query Frame = 3
Query:  204 EFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            +  HQGI LT+ G VNL++S+K+ G F+A YNSVKPIQ+   S+E+ KPGK+PSG  EIPFE PL +      G K L ETY GVF+ I Y L  D+KRSLL K      + ++  + +  K ++  P P  F +  + + NV     LP F + G +DS    + QP+TG ++VE  +  IKSIELQLVRVETCGCAEG+++D+TEI+N+Q+ EGDV R L IP+Y++ PRLFTCP++ + NF I+FE+ VV++  D+HLITE+ PL + R
Sbjct:    8 QIQHQGITLTMEGSVNLQLSAKSVGVFEAFYNSVKPIQIISSSMEMVKPGKLPSGKTEIPFEFPLNA-----KGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKSCEFII--HSLPQKAKLP-PTPVDFTITPETLQNVKERASLPRFLIRGHLDSTNCMITQPLTGELLVETSEVAIKSIELQLVRVETCGCAEGYARDATEIQNIQIAEGDVCRGLPIPIYMVFPRLFTCPTLETTNFKIEFEVNVVVILHDDHLITENFPLNLCR 271          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Xenopus
Match: baiap2 (BAI1-associated protein 2 [Source:Xenbase;Acc:XB-GENE-955133])

HSP 1 Score: 249.98 bits (637), Expect = 4.325e-81
Identity = 129/286 (45.10%), Postives = 177/286 (61.89%), Query Frame = 3
Query:  165 EMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITRF 1022
            E++ G+V + S+    HQGI LT+ G VNL++S+K+ G F+A YNSVKPIQ+   S+E+ KPGK+PSG  EIPFE PL +      G K L ETY GVF+                 + Q Q   L              P P  F +  + + NV     LP F + G +DS    + QP+TG ++VE  +  IKSIELQLVRVETCGCAEG+++D+TEI+N+Q+ EGDV R L IP+Y++ PRLFTCP++ + NF I+FE+ VV++  D+HLITE+ PL + R 
Sbjct:    1 EILSGVVVVMSRDTVQHQGITLTMEGSVNLQLSAKSVGVFEAFYNSVKPIQIISSSMEMVKPGKLPSGKTEIPFEFPLNA-----KGNKVLYETYHGVFV-----------------NIQPQKAKL-------------PPTPVDFTITPETLQNVKERASLPRFLIRGHLDSTNCMITQPLTGELLVETSEVAIKSIELQLVRVETCGCAEGYARDATEIQNIQIAEGDVCRGLPIPIYMVFPRLFTCPTLETTNFKIEFEVNVVVILHDDHLITENFPLNLCRM 251          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Mouse
Match: Vps26c (VPS26 endosomal protein sorting factor C [Source:MGI Symbol;Acc:MGI:1206040])

HSP 1 Score: 296.204 bits (757), Expect = 1.069e-98
Identity = 141/300 (47.00%), Postives = 203/300 (67.67%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            L+I++++ +K Y   EM+ G+V I SK    HQG++LT+ G VNL++S+K+ G F+A YNSVKPIQ+ + ++++ KPGKIPSG  E+PFE PL        G K L ETY GVF+ I Y L  D++RSLL K      + +V       K    TP P  F +  + + NV     LP F + G ++S   ++ QP+TG ++VEH D  I+SIELQLVRVETCGCAEG+++D+TEI+N+Q+ +GD+ RNL +PLY++ PRLFTCP++ + NF ++FE+ VV+L   +HLITE+ PLK+ R
Sbjct:    5 LDIKIKRANKVYHAGEMLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQIINSTIDVLKPGKIPSGKTEVPFEFPLL-----VKGSKVLYETYHGVFVNIQYTLRCDMRRSLLAKDLTKTCEFIVHSAPQKGK---LTPSPVDFTITPETLQNVKERASLPKFFIRGHLNSTNCAITQPLTGELVVEHSDAAIRSIELQLVRVETCGCAEGYARDATEIQNIQIADGDICRNLSVPLYMVFPRLFTCPTLETTNFKVEFEVNVVVLLHADHLITENFPLKLCR 296          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Mouse
Match: Vps26c (VPS26 endosomal protein sorting factor C [Source:MGI Symbol;Acc:MGI:1206040])

HSP 1 Score: 116.316 bits (290), Expect = 3.229e-31
Identity = 57/117 (48.72%), Postives = 81/117 (69.23%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIII 470
            L+I++++ +K Y   EM+ G+V I SK    HQG++LT+ G VNL++S+K+ G F+A YNSVKPIQ+ + ++++ KPGKIPSG  E+PFE PL        G K L ETY GVF+ I
Sbjct:    5 LDIKIKRANKVYHAGEMLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQIINSTIDVLKPGKIPSGKTEVPFEFPLL-----VKGSKVLYETYHGVFVNI 116          
BLAST of Down syndrome critical region protein 3-like protein vs. UniProt/SwissProt
Match: sp|O35075|VP26C_MOUSE (Vacuolar protein sorting-associated protein 26C OS=Mus musculus OX=10090 GN=Vps26c PE=1 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 7.479e-98
Identity = 141/300 (47.00%), Postives = 203/300 (67.67%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            L+I++++ +K Y   EM+ G+V I SK    HQG++LT+ G VNL++S+K+ G F+A YNSVKPIQ+ + ++++ KPGKIPSG  E+PFE PL        G K L ETY GVF+ I Y L  D++RSLL K      + +V       K    TP P  F +  + + NV     LP F + G ++S   ++ QP+TG ++VEH D  I+SIELQLVRVETCGCAEG+++D+TEI+N+Q+ +GD+ RNL +PLY++ PRLFTCP++ + NF ++FE+ VV+L   +HLITE+ PLK+ R
Sbjct:    5 LDIKIKRANKVYHAGEMLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQIINSTIDVLKPGKIPSGKTEVPFEFPLL-----VKGSKVLYETYHGVFVNIQYTLRCDMRRSLLAKDLTKTCEFIVHSAPQKGK---LTPSPVDFTITPETLQNVKERASLPKFFIRGHLNSTNCAITQPLTGELVVEHSDAAIRSIELQLVRVETCGCAEGYARDATEIQNIQIADGDICRNLSVPLYMVFPRLFTCPTLETTNFKVEFEVNVVVLLHADHLITENFPLKLCR 296          
BLAST of Down syndrome critical region protein 3-like protein vs. UniProt/SwissProt
Match: sp|O14972|VP26C_HUMAN (Vacuolar protein sorting-associated protein 26C OS=Homo sapiens OX=9606 GN=VPS26C PE=1 SV=1)

HSP 1 Score: 282.722 bits (722), Expect = 1.520e-92
Identity = 137/300 (45.67%), Postives = 199/300 (66.33%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            L+I++++ +K Y   E++ G+V I SK    HQG++LT+ G VNL++S+K+ G F+A YNSVKPIQ+ + ++E+ KPGK PSG  EIPFE PL        G K L ETY GVF+ I Y L  D+KRSLL K      + +V       K    TP P  F +  + + NV     LP F + G ++S    + QP+TG ++VE  +  I+S+ELQLVRVETCGCAEG+++D+TEI+N+Q+ +GDV R L +P+Y++ PRLFTCP++ + NF ++FE+ +V+L   +HLITE+ PLK+ R
Sbjct:    5 LDIKIKRANKVYHAGEVLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQIINSTIEMVKPGKFPSGKTEIPFEFPLH-----LKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGK---FTPSPVDFTITPETLQNVKERALLPKFLLRGHLNSTNCVITQPLTGELVVESSEAAIRSVELQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLSVPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLLHPDHLITENFPLKLCR 296          
BLAST of Down syndrome critical region protein 3-like protein vs. UniProt/SwissProt
Match: sp|Q5RF33|VP26C_PONAB (Vacuolar protein sorting-associated protein 26C OS=Pongo abelii OX=9601 GN=VPS26C PE=2 SV=1)

HSP 1 Score: 280.026 bits (715), Expect = 1.826e-91
Identity = 135/300 (45.00%), Postives = 198/300 (66.00%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            L+I++++ +K Y   E++ G+V I SK    HQG++LT+ G VNL++S+K+ G F+A YNSVKPIQ+ + ++E+ KPGK PSG  EIPFE PL        G K L ETY GVF+ I Y L  D+KRSLL K      + +V       K    +P P  F +  + + N      LP F + G ++S    + QP+TG ++VE  +  I+S+ELQLVRVETCGCAEG+++D+TEI+N+Q+ +GDV R L +P+Y++ PRLFTCP++ + NF ++FE+ +V+L   +HLITE+ PLK+ R
Sbjct:    5 LDIKIKRANKVYHAGEVLSGVVVISSKDSVQHQGVSLTMEGTVNLQLSAKSVGVFEAFYNSVKPIQIINSNIEMVKPGKFPSGKTEIPFEFPLH-----VKGNKVLYETYHGVFVNIQYTLRCDMKRSLLAKDLTKTCEFIVHSAPQKGK---FSPSPVHFTITPETLQNARERALLPKFLLRGHLNSTNCVITQPLTGELVVESSEAAIRSVELQLVRVETCGCAEGYARDATEIQNIQIADGDVCRGLSVPIYMVFPRLFTCPTLETTNFKVEFEVNIVVLLHPDHLITENFPLKLCR 296          
BLAST of Down syndrome critical region protein 3-like protein vs. UniProt/SwissProt
Match: sp|Q54DI8|VP26C_DICDI (Vacuolar protein sorting-associated protein 26C OS=Dictyostelium discoideum OX=44689 GN=vps26c PE=3 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 3.992e-74
Identity = 122/307 (39.74%), Postives = 191/307 (62.21%), Query Frame = 3
Query:  117 ILEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPG-KIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKK---FQMNSKNVSNVANPQK--LPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            +L+++L+KI K Y     + G V I+SK + SH G+ + + G V L++SSK+ G F+A YNS+KPI L H ++ ++  G K  +GI E+PFE  L+   +     ++L +TY GVF+ I Y +  DVKR +L K      + +V+     NK+ +    P+    F +   ++ N     K  +P F + G + S   ++ +   GH+I+E  D  IKS+ELQLVRVETCGCA+G++++ TEI+N+Q+ +GD++RN +IPLY++ PRLFTC S     F I+FE+ +VI+  D HLITE+ P+K+ R
Sbjct:    4 VLDLKLKKIDKIYRPGSKVSGNVVINSKDDMSHSGVTIVVEGTVQLQLSSKSVGLFEAFYNSLKPITLMHYTISVTNGGGKFQAGITELPFEFTLEPLPN-----QQLYDTYHGVFVNIQYSIKCDVKRGILSKDLSKTIEFIVEVPSQ-NKEVLMKSTPESLITFNITPDSLVNFKKISKADVPTFKISGGLVSAICNINEAFQGHMIIESADTVIKSVELQLVRVETCGCADGYAREVTEIQNIQIADGDIWRNFKIPLYMVFPRLFTCISTAGKTFKIEFEVNLVIMLEDGHLITENFPIKLIR 304          
BLAST of Down syndrome critical region protein 3-like protein vs. UniProt/SwissProt
Match: sp|O01258|VPS26_CAEEL (Vacuolar protein sorting-associated protein 26 OS=Caenorhabditis elegans OX=6239 GN=vps-26 PE=3 SV=2)

HSP 1 Score: 51.2174 bits (121), Expect = 7.134e-6
Identity = 68/283 (24.03%), Postives = 113/283 (39.93%), Query Frame = 3
Query:  153 YVENEMIKGLVFIDSKQ---EFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSL--LLKSFQAQTDVLVQY--NDMGNKDEVATPK--PKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSV------YSINFIIDFELV 956
            Y + E + G V ++ K+   +F HQGI +   G + +         F +L            + EL++PG +     + PFE            +++  ETY G  + + YFL V V R L  L K        L  Y  ND   K EV        +F+ N KN  ++ +        +VG+I  L V +K               IK +E+ +++ E  G      K+S  +   ++ +G   R   IP+ L L      PS+      +S+ + ++  LV
Sbjct:   41 YYDGESVTGTVHVNLKKANHKFEHQGIRIEFIGQIEVYYDRGNQQDFISL------------TRELARPGDLTQNA-QFPFEF---------NNVEKPFETYMGTNVKLRYFLRVTVIRRLTDLTKELDLVVHALSSYPDNDKSIKMEVGIEDCLHIEFEYN-KNKYHLQD-------VIVGKIYFLLVRIK---------------IKYMEIAILKTEVVGSGPNTFKESETVAKFEIMDGAPVRGESIPIRLFLAGYDLAPSMRDVGKKFSVKYFLNLVLV 278          
BLAST of Down syndrome critical region protein 3-like protein vs. TrEMBL
Match: A0A3S0ZLV3 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_011485 PE=4 SV=1)

HSP 1 Score: 326.25 bits (835), Expect = 4.721e-107
Identity = 157/301 (52.16%), Postives = 219/301 (72.76%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITRF 1022
            L+IRL+K++K Y E ++I G+V + SK E  HQGI L + GMVNL +S+K+ G F+A YNS+KPIQL + +L++ KPGK+PSG  EIPFE+PLK     T     L ETY GVF+ I Y + V++KRSLL K  Q QT+ +++Y    N++E A  KP  F +    ++NV   Q +P F V G IDS  + + +P+TG + VE C+ PIKSIE+QLVRVETCGCAEG++KD+TEI+N+Q+ EGDV R + IPLY++ PRLFTCPS+ + NF +DFE+ +V++FAD+HL+TE+ PL++TRF
Sbjct:   18 LDIRLKKVNKVYREGDVIAGVVVVQSKGELPHQGITLNMEGMVNLLLSTKSVGLFEAFYNSLKPIQLLNYNLDVIKPGKLPSGKTEIPFEVPLKPKPGKT-----LYETYHGVFVNIQYLIKVEMKRSLLNKDLQKQTEFIIEYK---NQEEKAKAKPVNFTITPDTLTNVKK-QNVPQFKVKGHIDSSCLQITKPLTGQLTVESCEAPIKSIEIQLVRVETCGCAEGYAKDATEIQNIQIAEGDVVRKMAIPLYMVFPRLFTCPSLSTNNFKVDFEINIVVVFADDHLVTENFPLRLTRF 309          
BLAST of Down syndrome critical region protein 3-like protein vs. TrEMBL
Match: K1QVL4 (Down syndrome critical region protein 3-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10024212 PE=4 SV=1)

HSP 1 Score: 325.094 bits (832), Expect = 1.141e-106
Identity = 153/302 (50.66%), Postives = 224/302 (74.17%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDS-KQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITRF 1022
            L+I+L+K +K Y E E++KG + +D+ K E +HQGI L + G VNL++S+K+ G F+A Y+S+KP+QL + SL+++KPGK+PSG  EIPFEIPLK+      G K L ETY GVF+ I Y L VD+KR LL K  Q   + +V+Y+D  +K E A PKP +F ++ + ++NV   Q +P F V G+++S  + + +P+ G ++VE CD  IKSIE+QLVRVETCGCAEG++KD+TEI+N+Q+ +GDV R + IP+++I PRLFTCP++ + NF +DFE+ +VI+F DNHL+TE+ P+K+TRF
Sbjct:    4 LDIKLKKANKVYREGELVKGAICVDAGKSEIAHQGITLVMEGSVNLQLSAKSVGLFEAFYSSLKPLQLINYSLDIAKPGKLPSGRTEIPFEIPLKA-----KGNKELYETYHGVFVNIQYSLKVDMKRPLLAKDLQKTCEFIVEYSDK-DKAEKAKPKPVQFTISPETLTNVKEKQNVPKFKVKGKLESAVLCITKPLKGELMVEQCDTQIKSIEIQLVRVETCGCAEGYAKDATEIQNIQIADGDVCRGISIPIFMIFPRLFTCPTLSTNNFKVDFEINIVIVFQDNHLVTENFPIKLTRF 299          
BLAST of Down syndrome critical region protein 3-like protein vs. TrEMBL
Match: A0A0B7B0H7 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF153354 PE=4 SV=1)

HSP 1 Score: 322.398 bits (825), Expect = 1.146e-105
Identity = 152/301 (50.50%), Postives = 221/301 (73.42%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITRF 1022
            L+IRL+K+SKTY E +++ G+V I SK E  HQGI L   GMVNL++S+K+ G F+A Y+S+KPIQL   +L+++KPGK+PSG  EIPFE+PL+         K L ETY GVF+ I Y + V++KRSLL K  Q QT+ +++Y    +++E A PK   F +  + ++NV   Q +P F V G +DS  + + +P+TG + VE C+ PIKSIE+QL+RVETCGCAEG++KD+TEI+N+Q+ +GDV RNL IP+Y++ PRLFTCPS+ + NF +DF++ +V++FAD+H +TE+ PL++TRF
Sbjct:    5 LDIRLKKVSKTYREGDVLAGVVVIQSKGELQHQGITLITEGMVNLQLSAKSVGAFEAFYSSLKPIQLLLYTLDVAKPGKLPSGKTEIPFEVPLRPKQG-----KALYETYHGVFVNIQYLVRVEMKRSLLNKDLQKQTEFIIEYK---SQEEKAVPKLINFTITPETLTNVKEKQNVPKFKVKGHLDSSCLQITKPLTGELTVELCEAPIKSIEVQLIRVETCGCAEGYAKDATEIQNIQIADGDVSRNLAIPIYMVFPRLFTCPSLSTNNFKVDFDINIVLVFADDHHVTENFPLRLTRF 297          
BLAST of Down syndrome critical region protein 3-like protein vs. TrEMBL
Match: W4XNG2 (Uncharacterized protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 315.464 bits (807), Expect = 6.905e-103
Identity = 147/302 (48.68%), Postives = 213/302 (70.53%), Query Frame = 3
Query:  117 ILEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITRF 1022
            +L++RL+K +K Y E E++ G++ I +K EF HQGI L   G VNL++SSK+ G F+A YNS+KPI L   +L  +KPGKIP+G  EIPFE+PLK+  + T     L ETY GVF+ + Y L    KRSLL K      + +++Y D   K E   PKP  F +  +++ NV +   LPNF + G++DS    +K P+TGH+I+E C+ PIKS+E+QLVRVETCGCAEG+++D+TEI+N+Q+GEG+V R L IP+Y++ PRLFTCP++ + NF ++FE+ +V++  D+HLITE+ P+ +TRF
Sbjct:    4 LLDLRLKKANKIYSEGEVLAGVIVIQTKTEFQHQGITLIAEGSVNLQLSSKSVGHFEAFYNSIKPIPLLSVTLNAAKPGKIPAGKTEIPFEVPLKAKLNKT-----LYETYHGVFVNVQYTLKAQAKRSLLAKDLVKTIEFIIEYKDQKVKAE---PKPVPFTVTPQSLQNVKDKTALPNFIIKGRLDSASCCIKNPLTGHVIIESCNAPIKSVEIQLVRVETCGCAEGYARDATEIQNIQIGEGNVCRGLTIPMYMVFPRLFTCPTLATSNFKVEFEINLVVVLLDDHLITENFPIILTRF 297          
BLAST of Down syndrome critical region protein 3-like protein vs. TrEMBL
Match: C3XQF0 (Uncharacterized protein OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_114826 PE=4 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 7.947e-103
Identity = 150/300 (50.00%), Postives = 216/300 (72.00%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            L+IRL+K++K Y E E++ G+V I SK +  HQG+NL++ G VNL++S+K+ G F+A YNS+KPIQL   ++EL KPGK+PSG  EIPFE+PLK    +    K L ETY GVF+ I Y L  +VKRSLL K    Q++++++Y D   K   A  KP  F +   ++ N+    ++P F V G++DS    + +P+TG ++VE  + PI+SIELQLVRVETCGCAEG+++D+TEI+N+Q+GEGDV R L +P+Y+I PRLFTCP++ + NF ++FE+ VVI+  ++HLITE+ PLK+TR
Sbjct:    3 LDIRLKKVNKIYYEGELVSGVVVIQSKGDMQHQGVNLSMEGSVNLQLSAKSVGVFEAFYNSLKPIQLVSYAVELVKPGKLPSGKTEIPFEVPLKPKGHN----KVLYETYHGVFVNIQYLLRAEVKRSLLNKDLTKQSEIILEYRDSKEK---AVAKPVPFTITPDSLQNIKEKSQIPRFVVKGKLDSSVCCLSRPLTGELVVESSESPIRSIELQLVRVETCGCAEGYARDATEIQNIQIGEGDVCRGLTLPIYMIFPRLFTCPTLITSNFKVEFEVNVVIVLQNDHLITENFPLKLTR 295          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Cavefish
Match: vps26c (VPS26 endosomal protein sorting factor C [Source:ZFIN;Acc:ZDB-GENE-040801-6])

HSP 1 Score: 292.738 bits (748), Expect = 1.921e-97
Identity = 145/301 (48.17%), Postives = 204/301 (67.77%), Query Frame = 3
Query:  117 ILEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            IL+IRL++ +K Y E E++ G+V I SK+   HQGI+LT+ G+VNL++SSK+ G F+A YNSVKPIQL + ++E++KPGK+P G  EIPFE PL+       G K L ETY GVF+ I Y L  D++R LL K      + +       +K     P P  F ++ + + NV     LP F V G +D+    + QP+TG ++VE  +  IKSIELQLVRVETCGCAEG+++D+TEI+N+Q+ EGDV   L IP+Y++ PRLFTCP++ + NF ++FE+ VVI+  D+HLITE+ PLK+ R
Sbjct:    4 ILDIRLKRANKVYHEAEVLAGVVVITSKEAVQHQGISLTMEGLVNLQLSSKSVGVFEAFYNSVKPIQLINSNIEVAKPGKVPGGKTEIPFEFPLQ-----VKGNKVLYETYHGVFVNIQYTLRCDMRRPLLAKDLSKTCEFIHVLQPQKSK---VQPSPVDFTISPETLQNVKERNSLPKFLVRGHLDATNCVITQPLTGELVVESSEVAIKSIELQLVRVETCGCAEGYARDATEIQNIQIAEGDVCHGLPIPIYMVFPRLFTCPTLETTNFNVEFEMNVVIVLHDDHLITENFPLKLCR 296          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Sea Lamprey
Match: vps26c (VPS26 endosomal protein sorting factor C [Source:ZFIN;Acc:ZDB-GENE-040801-6])

HSP 1 Score: 280.411 bits (716), Expect = 2.524e-93
Identity = 136/305 (44.59%), Postives = 203/305 (66.56%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPK-----KFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            ++I+L++ +K Y + E + GLV I  +    HQGI+L L G V L++SSK+ G F+A YNS KP+QL   S+E++KPGK+PSG  EIPF+  L++  SS    K L ETY GV++ I Y L  ++KRSLL K      + +V           A P+P      KF +   ++  +     LPNF + G +++    + +P+ G ++VEHCD P+KSI++QLVRVETCGCAEG+++D+TEI+NLQ+ EGDV R + IP++++ PRLFTCP++ + NF I+FE+ +VI+  D+HLITE+ PLK++R
Sbjct:    5 VDIKLKRANKVYHDGETVSGLVVIQGRDTIQHQGISLALEGTVTLQLSSKSVGVFEAFYNSAKPVQLVSSSVEVAKPGKLPSGRTEIPFQFCLRASGSS----KVLYETYHGVYVNIQYTLRCEMKRSLLNKDVHKTCEFIVHTP--------AQPEPTLDTIVKFAITPASLQKLKVKSSLPNFLIKGCLNTTNCEVTRPLCGELLVEHCDLPLKSIDVQLVRVETCGCAEGYARDATEIQNLQIAEGDVCRGVAIPIHMVFPRLFTCPTLQTTNFKIEFEVNIVIILQDDHLITENFPLKLSR 297          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Nematostella
Match: EDO39946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8I4])

HSP 1 Score: 261.151 bits (666), Expect = 6.606e-86
Identity = 133/275 (48.36%), Postives = 190/275 (69.09%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKI-PSGII--EIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINF 935
            L+IRL++++K + + +++KG++ + SK E SH G+ L + G VNL++S+K+ G  +A YNS+KPIQL + ++++ KPGK+ P  II  EIPFEIPLK       G + L ETY GVF+ I Y+L  ++KRSLL K  Q Q + +V+    G  D     KP  F +  +++ N+ +  K+P F V GQ+D+   S+ +PITG + V   D PI+SIELQLVRVETCGCAEG+SKD+TEI+N+Q+ EGDV R L IPLY+I PRLFTCP++ + NF
Sbjct:    4 LDIRLKRVNKIFQDGDLVKGVIVVQSKGELSHNGMTLFMEGSVNLQLSAKSVGVLEAFYNSLKPIQLVNYTVDILKPGKLYPLPIIRTEIPFEIPLKP-----KGTRPLYETYHGVFVNIQYYLRCEMKRSLLNKDLQCQAEFIVENKSQGKPDN----KPVLFTITPESLENIKDKPKVPKFLVKGQLDTAVCSILKPITGELTVIESDTPIRSIELQLVRVETCGCAEGYSKDATEIQNIQIAEGDVCRGLIIPLYMIFPRLFTCPTLATPNF 269          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Medaka
Match: vps26c (VPS26 endosomal protein sorting factor C [Source:NCBI gene;Acc:101169309])

HSP 1 Score: 291.582 bits (745), Expect = 6.240e-97
Identity = 141/300 (47.00%), Postives = 199/300 (66.33%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            L+I+L++ +K Y E E + G+V +  K+   H GI+LT+ G+VNL++SSK+ G F+A YNSVKPIQL   ++E++K GK+P G  EIPFE PL      T G K L ETY GVF+ I Y L  D+KRSLL K      + +V      +K     P P  F +    + N      LP F + G +D+    + QP+TG ++VE+ + PIKSIELQLVRVETCGCAEG+++D+TEI+N+Q+ EGDV   L IP+Y++ PRLFTCP++ + NF ++FE+ +VI+  D+HLITE+ PLK+ R
Sbjct:    5 LDIKLKRANKVYHEGETVAGVVMLSCKEAMQHHGISLTMEGIVNLQLSSKSVGVFEAFYNSVKPIQLISSNIEVAKAGKVPGGKTEIPFEFPLL-----TKGNKVLYETYHGVFVNIQYSLRCDLKRSLLAKDLSRTCEFIVHSQPQKSK---VVPTPVNFTITPDTLQNTREKSSLPKFLIRGHLDATNCVISQPLTGEVVVENSEVPIKSIELQLVRVETCGCAEGYARDATEIQNIQIAEGDVCHGLSIPIYMVFPRLFTCPTLETTNFKVEFEINIVIVLHDDHLITENFPLKLCR 296          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Medaka
Match: vps26c (VPS26 endosomal protein sorting factor C [Source:NCBI gene;Acc:101169309])

HSP 1 Score: 261.151 bits (666), Expect = 3.260e-85
Identity = 127/272 (46.69%), Postives = 177/272 (65.07%), Query Frame = 3
Query:  120 LEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINF 935
            L+I+L++ +K Y E E + G+V +  K+   H GI+LT+ G+VNL++SSK+ G F+A YNSVKPIQL   ++E++K GK+P G  EIPFE PL      T G K L ETY GVF+ I Y L  D+KRSLL K      + +V      +K     P P  F +    + N      LP F + G +D+    + QP+TG ++VE+ + PIKSIELQLVRVETCGCAEG+++D+TEI+N+Q+ EGDV   L IP+Y++ PRLFTCP++ + NF
Sbjct:    5 LDIKLKRANKVYHEGETVAGVVMLSCKEAMQHHGISLTMEGIVNLQLSSKSVGVFEAFYNSVKPIQLISSNIEVAKAGKVPGGKTEIPFEFPLL-----TKGNKVLYETYHGVFVNIQYSLRCDLKRSLLAKDLSRTCEFIVHSQPQKSK---VVPTPVNFTITPDTLQNTREKSSLPKFLIRGHLDATNCVISQPLTGEVVVENSEVPIKSIELQLVRVETCGCAEGYARDATEIQNIQIAEGDVCHGLSIPIYMVFPRLFTCPTLETTNF 268          
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Medaka
Match: vps26c (VPS26 endosomal protein sorting factor C [Source:NCBI gene;Acc:101169309])

HSP 1 Score: 227.254 bits (578), Expect = 1.482e-72
Identity = 117/258 (45.35%), Postives = 164/258 (63.57%), Query Frame = 3
Query:  246 VNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITR 1019
            V+L+I  K   R + +Y+   PIQL   ++E++K GK+P G  EIPFE PL      T G K L ETY GVF+ I Y L  D+KRSLL K      + +V      +K     P P  F +    + N      LP F + G +D+    + QP+TG ++VE+ + PIKSIELQLVRVETCGCAEG+++D+TEI+N+Q+ EGDV   L IP+Y++ PRLFTCP++ + NF ++FE+ +VI+  D+HLITE+ PLK+ R
Sbjct:    3 VSLDIKLK---RANKVYHE-GPIQLISSNIEVAKAGKVPGGKTEIPFEFPL-----LTKGNKVLYETYHGVFVNIQYSLRCDLKRSLLAKDLSRTCEFIVHSQPQKSK---VVPTPVNFTITPDTLQNTREKSSLPKFLIRGHLDATNCVISQPLTGEVVVENSEVPIKSIELQLVRVETCGCAEGYARDATEIQNIQIAEGDVCHGLSIPIYMVFPRLFTCPTLETTNFKVEFEINIVIVLHDDHLITENFPLKLCR 248          
BLAST of Down syndrome critical region protein 3-like protein vs. Planmine SMEST
Match: SMESG000025294.1 (SMESG000025294.1)

HSP 1 Score: 622.468 bits (1604), Expect = 0.000e+0
Identity = 306/306 (100.00%), Postives = 306/306 (100.00%), Query Frame = 3
Query:  105 MSQPILEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITRF 1022
            MSQPILEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITRF
Sbjct:    1 MSQPILEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNLEISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKSCASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYNDMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQPITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGDVFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLPLKITRF 306          
The following BLAST results are available for this feature:
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
VPS26C3.165e-9345.67VPS26 endosomal protein sorting factor C [Source:H... [more]
VPS26C2.125e-8242.67VPS26 endosomal protein sorting factor C [Source:H... [more]
VPS26C9.245e-7044.53VPS26 endosomal protein sorting factor C [Source:H... [more]
VPS26C1.575e-4747.26VPS26 endosomal protein sorting factor C [Source:H... [more]
back to top
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vps-263.958e-724.03Vacuolar protein sorting-associated protein 26 [S... [more]
vps-265.608e-724.03Vacuolar protein sorting-associated protein 26 [S... [more]
vps-265.608e-724.03Vacuolar protein sorting-associated protein 26 [S... [more]
vps-266.028e-724.03Vacuolar protein sorting-associated protein 26 [S... [more]
vps-267.240e-724.03Vacuolar protein sorting-associated protein 26 [S... [more]
back to top
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG40743.175e-7443.21gene:FBgn0037017 transcript:FBtr0345811[more]
CG40743.175e-7443.21gene:FBgn0037017 transcript:FBtr0078280[more]
back to top
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps26c5.059e-9846.18VPS26 endosomal protein sorting factor C [Source:Z... [more]
back to top
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
baiap26.626e-9546.69BAI1-associated protein 2 [Source:Xenbase;Acc:XB-G... [more]
baiap28.231e-8848.90BAI1-associated protein 2 [Source:Xenbase;Acc:XB-G... [more]
baiap24.325e-8145.10BAI1-associated protein 2 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Vps26c1.069e-9847.00VPS26 endosomal protein sorting factor C [Source:M... [more]
Vps26c3.229e-3148.72VPS26 endosomal protein sorting factor C [Source:M... [more]
back to top
BLAST of Down syndrome critical region protein 3-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35075|VP26C_MOUSE7.479e-9847.00Vacuolar protein sorting-associated protein 26C OS... [more]
sp|O14972|VP26C_HUMAN1.520e-9245.67Vacuolar protein sorting-associated protein 26C OS... [more]
sp|Q5RF33|VP26C_PONAB1.826e-9145.00Vacuolar protein sorting-associated protein 26C OS... [more]
sp|Q54DI8|VP26C_DICDI3.992e-7439.74Vacuolar protein sorting-associated protein 26C OS... [more]
sp|O01258|VPS26_CAEEL7.134e-624.03Vacuolar protein sorting-associated protein 26 OS=... [more]
back to top
BLAST of Down syndrome critical region protein 3-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S0ZLV34.721e-10752.16Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
K1QVL41.141e-10650.66Down syndrome critical region protein 3-like prote... [more]
A0A0B7B0H71.146e-10550.50Uncharacterized protein (Fragment) OS=Arion vulgar... [more]
W4XNG26.905e-10348.68Uncharacterized protein OS=Strongylocentrotus purp... [more]
C3XQF07.947e-10350.00Uncharacterized protein OS=Branchiostoma floridae ... [more]
back to top
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps26c1.921e-9748.17VPS26 endosomal protein sorting factor C [Source:Z... [more]
back to top
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
vps26c2.524e-9344.59VPS26 endosomal protein sorting factor C [Source:Z... [more]
back to top
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO399466.606e-8648.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Down syndrome critical region protein 3-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
vps26c6.240e-9747.00VPS26 endosomal protein sorting factor C [Source:N... [more]
vps26c3.260e-8546.69VPS26 endosomal protein sorting factor C [Source:N... [more]
vps26c1.482e-7245.35VPS26 endosomal protein sorting factor C [Source:N... [more]
back to top
BLAST of Down syndrome critical region protein 3-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000025294.10.000e+0100.00SMESG000025294.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30031383 ID=SMED30031383|Name=Down syndrome critical region protein 3-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1145bp
GTAAAATTAAAGCAGTTGTTTTAATAAATCAATTGAATTATTGACATTTT
AAGATTTATACGGAATTGATTTGTTAATTGTTTTTAAATTTTATTTTAAT
AGAGATGTCACAACCGATTTTAGAAATAAGACTTCAGAAAATAAGTAAAA
CCTATGTAGAAAATGAAATGATTAAAGGCCTTGTTTTTATTGATTCAAAG
CAAGAGTTTTCTCACCAAGGAATTAATCTAACCCTGAACGGAATGGTAAA
TTTGGAGATCAGTAGTAAAACACATGGCAGATTTGATGCTCTATATAATT
CTGTTAAACCGATCCAACTGGCTCACAAATCATTGGAACTAAGCAAACCG
GGTAAAATTCCTTCTGGAATTATTGAAATCCCTTTTGAAATCCCATTGAA
ATCTTGTGCCAGTTCGACAACTGGAATCAAACGTCTGTTGGAAACTTATC
GAGGCGTGTTCATCATTATATCGTATTTTTTAACGGTTGATGTGAAACGG
TCGTTGCTCTTGAAATCGTTCCAGGCTCAGACTGATGTCCTCGTTCAATA
TAATGATATGGGCAACAAGGATGAAGTGGCAACGCCTAAACCGAAGAAAT
TCCAAATGAATTCTAAAAACGTTTCCAATGTTGCAAATCCCCAGAAATTA
CCGAATTTCAGCGTGGTTGGCCAAATCGATAGCTTGGAGGTATCGATGAA
ACAGCCAATTACTGGCCACATTATTGTCGAGCATTGCGATAGACCAATCA
AATCTATTGAACTTCAACTGGTTCGTGTCGAAACCTGCGGTTGTGCTGAA
GGCCACTCCAAGGATTCGACGGAAATAGAAAATCTGCAAATGGGTGAAGG
AGATGTGTTTCGCAATTTGGAGATTCCTTTGTATTTGATCTTACCCAGGT
TATTCACATGTCCATCAGTTTATTCCATCAATTTTATAATCGATTTCGAG
CTGGTTGTTGTCATTCTGTTTGCCGATAATCACCTCATTACCGAGTCACT
ACCGTTGAAAATAACTCGATTCTAAACAATTTTGATAGTTTCATTCTAAA
TAAATTGATTTTACACTTTGCCTTCTATAATTGTCCTTATTAATCGTTTT
CATGTTTGATTGTTTTTTATGAATTACATTTTTTTTCATTTAAAA
back to top

protein sequence of SMED30031383-orf-1

>SMED30031383-orf-1 ID=SMED30031383-orf-1|Name=SMED30031383-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=307bp
MSQPILEIRLQKISKTYVENEMIKGLVFIDSKQEFSHQGINLTLNGMVNL
EISSKTHGRFDALYNSVKPIQLAHKSLELSKPGKIPSGIIEIPFEIPLKS
CASSTTGIKRLLETYRGVFIIISYFLTVDVKRSLLLKSFQAQTDVLVQYN
DMGNKDEVATPKPKKFQMNSKNVSNVANPQKLPNFSVVGQIDSLEVSMKQ
PITGHIIVEHCDRPIKSIELQLVRVETCGCAEGHSKDSTEIENLQMGEGD
VFRNLEIPLYLILPRLFTCPSVYSINFIIDFELVVVILFADNHLITESLP
LKITRF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR014752Arrestin_C
IPR028934Vps26-related
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005768endosome
Vocabulary: biological process
TermDefinition
GO:0006886intracellular protein transport
Vocabulary: molecular function
TermDefinition
GO:0008565protein transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014752Arrestin, C-terminalGENE3DG3DSA:2.60.40.640coord: 6..150
e-value: 1.1E-24
score: 88.6
IPR014752Arrestin, C-terminalGENE3DG3DSA:2.60.40.640coord: 187..305
e-value: 2.9E-9
score: 38.6
IPR028934Vacuolar protein sorting protein 26 relatedPFAMPF03643Vps26coord: 14..291
e-value: 1.4E-37
score: 129.2
IPR028934Vacuolar protein sorting protein 26 relatedPANTHERPTHR12233VACUOLAR PROTEIN SORTING 26 RELATEDcoord: 6..305
NoneNo IPR availablePANTHERPTHR12233:SF2DOWN SYNDROME CRITICAL REGION PROTEIN 3coord: 6..305